F429667

General Info

Members Datasets Scaffolds Average Seq Length
383 234 766 493

Family's Representative Sequence

Representative Sequence 3300041443|Ga0451789_1109880|Ga0451789_1109880_101_1576
Length 476
Sequence MNARDPNLPLQPDEATAIAEFANRTWDEEIVPALTDYIAIPAKSPMFDADWQKNGHLERVVRDAASWVESKKVAGLKLEVVRLEGRTPVIFFEVPATKAGSTDTICLYGHLDKQPEFNGWRSDLGPWTPKYENGLLYGRGAADDGYAVYASLTAIMALDRQGIPRPRCVGIIEACEESGSFDLPAYLDVLRERLGNVSLVVCLDSGAGNYDQLWLTTSLRGMVSGVLKVEILTEGIHSGDSSGLVPSSFRILRQVLDRLEDSKTGRLLPESFHCEVPGDRLAQARTTAQILGDEVWKRFPWACGADGGPTLPTTTDPTEALLNRTLKNAGNVLRPYTAFKLSLRLPPLVDGNEAAMRLKTLLEDNAPYNARVTFAADGRAGAYGASGWNAPSLAPWLEDALNSASQAQFGAPCGYVGQGGTIPLMSLLQKGFPKAQMMVCGVLGPKSNAHGPNEFLHVPYGKKLTAAVAQVMAACP

Samples

Sample ID Description Type Environment
1 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
135 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
170 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
171 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
172 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
173 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
204 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
210 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
214 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
218 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
220 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
221 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
222 2643221585 Pelomonas sp. Root662 Isolate Unclassified
223 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
224 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
225 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
226 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
227 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
228 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
229 2643221656 Pelomonas sp. Root405 Isolate Unclassified
230 2643221660 Methylibium sp. Root1272 Isolate Unclassified
231 2738541337 Pelomonas sp. BT06 Isolate Unclassified
232 2831864461 Roseateles noduli HZ7 Isolate Nodule
233 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
234 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0.26
Isolates 4.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.02
Nodule 1.57
Rhizoplane 2.09
Rhizosphere 65.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451789_1109880 3300041443 Bacteria 2447
2 JGI25156J39149_1000880 3300002705 Bacteria 14916
3 JGI25154J39366_1001463 3300002738 Bacteria 8362
4 JGI25157J39369_1000069 3300002741 Bacteria 93257
5 JGI25152J39213_1001988 3300002773 Bacteria 8071
6 JGI25153J46596_10002279 3300003215 Bacteria 11177
7 rootL2_10003559 3300003322 Bacteria 24543
8 rootH1_10046785 3300003323 Bacteria 3439
9 Ga0055539_1000500 3300003752 Bacteria 12279
10 Ga0055539_1002029 3300003752 Bacteria 3320
11 Ga0055533_1000026 3300003756 Bacteria 323407
12 Ga0055533_1000068 3300003756 Bacteria 155215
13 Ga0055525_1000056 3300003759 Bacteria 212321
14 Ga0055525_1001449 3300003759 Bacteria 4280
15 Ga0055535_1000252 3300003761 Bacteria 56714
16 Ga0055529_1000150 3300003763 Bacteria 99993
17 Ga0055526_1001773 3300003771 Bacteria 14994
18 Ga0055526_1003866 3300003771 Bacteria 9284
19 Ga0055524_1000033 3300003775 Bacteria 180833
20 Ga0055524_1003264 3300003775 Bacteria 7939
21 Ga0055540_1000184 3300003792 Bacteria 60646
22 Ga0055531_10000655 3300003794 Bacteria 29766
23 Ga0055531_10005360 3300003794 Bacteria 7519
24 Ga0055531_10009349 3300003794 Bacteria 5019
25 Ga0055543_1002258 3300004625 Bacteria 6517
26 Ga0065165_1000063 3300005262 Bacteria 176477
27 Ga0065165_1000460 3300005262 Bacteria 63833
28 Ga0070658_10024813 3300005327 Bacteria 4808
29 Ga0070658_10033024 3300005327 Bacteria 4161
30 Ga0070676_10008653 3300005328 Bacteria 5489
31 Ga0070670_100002390 3300005331 Bacteria 15466
32 Ga0070670_100033475 3300005331 Bacteria 4426
33 Ga0070670_100066211 3300005331 Bacteria 3100
34 Ga0070677_10004368 3300005333 Bacteria 4609
35 Ga0070677_10007983 3300005333 Bacteria 3545
36 Ga0068869_100013371 3300005334 Bacteria 5459
37 Ga0068869_100022741 3300005334 Bacteria 4324
38 Ga0068868_100010354 3300005338 Bacteria 6746
39 Ga0068868_100026794 3300005338 Bacteria 4395
40 Ga0068868_100095534 3300005338 Bacteria 2399
41 Ga0070660_100168782 3300005339 Bacteria 1766
42 Ga0070669_100003438 3300005353 Bacteria 11408
43 Ga0070669_100037632 3300005353 Bacteria 3510
44 Ga0070675_100004907 3300005354 Bacteria 10203
45 Ga0070675_100011363 3300005354 Bacteria 6969
46 Ga0070675_100026325 3300005354 Bacteria 4668
47 Ga0070675_100042351 3300005354 Bacteria 3720
48 Ga0070671_100007484 3300005355 Bacteria 8727
49 Ga0070671_100064885 3300005355 Bacteria 3041
50 Ga0070674_100024763 3300005356 Bacteria 3898
51 Ga0070674_100039275 3300005356 Bacteria 3195
52 Ga0070673_100000881 3300005364 Bacteria 16929
53 Ga0070673_100004600 3300005364 Bacteria 8749
54 Ga0070673_100006967 3300005364 Bacteria 7401
55 Ga0070673_100064321 3300005364 Bacteria 2922
56 Ga0070673_100087124 3300005364 Bacteria 2545
57 Ga0070667_100051156 3300005367 Bacteria 3483
58 Ga0070667_100180138 3300005367 Bacteria 1868
59 Ga0070700_100023236 3300005441 Bacteria 3625
60 Ga0070694_100005289 3300005444 Bacteria 7806
61 Ga0070663_100000177 3300005455 Bacteria 32482
62 Ga0070678_100003058 3300005456 Bacteria 9273
63 Ga0070678_100024625 3300005456 Bacteria 4034
64 Ga0070678_100043127 3300005456 Bacteria 3211
65 Ga0068867_100000279 3300005459 Bacteria 33713
66 Ga0068867_100013387 3300005459 Bacteria 5811
67 Ga0068867_100022951 3300005459 Bacteria 4464
68 Ga0068867_100041847 3300005459 Bacteria 3348
69 Ga0068853_100013903 3300005539 Bacteria 6580
70 Ga0070672_100002066 3300005543 Bacteria 12636
71 Ga0070672_100018056 3300005543 Bacteria 5091
72 Ga0070672_100018915 3300005543 Bacteria 4990
73 Ga0070672_100031163 3300005543 Bacteria 4012
74 Ga0070693_100052337 3300005547 Bacteria 2340
75 Ga0068855_100198210 3300005563 Bacteria 2261
76 Ga0070664_100035293 3300005564 Bacteria 4197
77 Ga0070664_100190361 3300005564 Bacteria 1828
78 Ga0070664_100191689 3300005564 Bacteria 1821
79 Ga0068857_100100371 3300005577 Bacteria 2596
80 Ga0068854_100084816 3300005578 Bacteria 2344
81 Ga0068854_100105293 3300005578 Bacteria 2120
82 Ga0068856_100003535 3300005614 Bacteria 15759
83 Ga0068856_100065008 3300005614 Bacteria 3604
84 Ga0070702_100030909 3300005615 Bacteria 2924
85 Ga0068852_100028808 3300005616 Bacteria 4550
86 Ga0068859_100001692 3300005617 Bacteria 22475
87 Ga0068859_100196699 3300005617 Bacteria 2100
88 Ga0068864_100001174 3300005618 Bacteria 21813
89 Ga0068864_100003663 3300005618 Bacteria 12706
90 Ga0068864_100015152 3300005618 Bacteria 6411
91 Ga0068861_100001573 3300005719 Bacteria 14520
92 Ga0068861_100026911 3300005719 Bacteria 4185
93 Ga0068863_100019041 3300005841 Bacteria 6571
94 Ga0068863_100117072 3300005841 Bacteria 2539
95 Ga0068858_100003671 3300005842 Bacteria 15203
96 Ga0068860_100025793 3300005843 Bacteria 5669
97 Ga0068860_100044216 3300005843 Bacteria 4246
98 Ga0068860_100158709 3300005843 Bacteria 2180
99 Ga0068862_100020956 3300005844 Bacteria 5462
100 Ga0068862_100025277 3300005844 Bacteria 4986
101 Ga0075366_10045204 3300006195 Bacteria 2610
102 Ga0075366_10053664 3300006195 Bacteria 2394
103 Ga0097621_100077351 3300006237 Bacteria 2762
104 Ga0075370_10000225 3300006353 Bacteria 20118
105 Ga0075370_10004591 3300006353 Bacteria 6735
106 Ga0068871_100024334 3300006358 Bacteria 4694
107 Ga0068865_100002021 3300006881 Bacteria 11969
108 Ga0097620_100001692 3300006931 Bacteria 22475
109 Ga0097620_100196681 3300006931 Bacteria 2100
110 Ga0099823_1000033 3300006944 Bacteria 68228
111 Ga0079104_1000009 3300006946 Bacteria 367015
112 Ga0105240_10223165 3300009093 Bacteria 2194
113 Ga0105243_10004453 3300009148 Bacteria 11081
114 Ga0105243_10052189 3300009148 Bacteria 3238
115 Ga0105242_10058105 3300009176 Bacteria 3170
116 Ga0105248_10020910 3300009177 Bacteria 7253
117 Ga0105248_10158437 3300009177 Bacteria 2554
118 Ga0105238_10020929 3300009551 Bacteria 6664
119 Ga0105239_10023168 3300010375 Bacteria 6844
120 Ga0157319_1000007 3300012497 Bacteria 318528
121 Ga0157369_10199845 3300013105 Bacteria 2098
122 Ga0157374_10084684 3300013296 Bacteria 3014
123 Ga0157378_10008040 3300013297 Bacteria 9206
124 Ga0163162_10006818 3300013306 Bacteria 11080
125 Ga0163162_10016099 3300013306 Bacteria 7309
126 Ga0163162_10016986 3300013306 Bacteria 7120
127 Ga0157372_10045051 3300013307 Bacteria 4891
128 Ga0157375_10034877 3300013308 Bacteria 4797
129 Ga0163163_10000524 3300014325 Bacteria 34246
130 Ga0157380_10037383 3300014326 Bacteria 3762
131 Ga0157377_10000006 3300014745 Bacteria 419853
132 Ga0157377_10050177 3300014745 Bacteria 2349
133 Ga0157379_10002725 3300014968 Bacteria 14911
134 Ga0157379_10010646 3300014968 Bacteria 8015
135 Ga0157379_10049564 3300014968 Bacteria 3750
136 Ga0157379_10062713 3300014968 Bacteria 3324
137 Ga0213872_10000009 3300021361 Bacteria 221470
138 Ga0213872_10000066 3300021361 Bacteria 93052
139 Ga0213872_10000208 3300021361 Bacteria 52289
140 Ga0213872_10000226 3300021361 Bacteria 49354
141 Ga0213872_10014723 3300021361 Bacteria 3645
142 Ga0213872_10041208 3300021361 Bacteria 2107
143 Ga0209674_100024 3300025226 Bacteria 535481
144 Ga0209563_100014 3300025230 Bacteria 940582
145 Ga0209563_100101 3300025230 Bacteria 152297
146 Ga0207427_101408 3300025231 Bacteria 8786
147 Ga0209258_100080 3300025242 Bacteria 255287
148 Ga0209258_100912 3300025242 Bacteria 14962
149 Ga0207425_1000681 3300025245 Bacteria 18553
150 Ga0209646_1000012 3300025246 Bacteria 573300
151 Ga0209026_1000004 3300025250 Bacteria 949012
152 Ga0209677_100091 3300025253 Bacteria 106743
153 Ga0209677_100150 3300025253 Bacteria 64346
154 Ga0209677_101979 3300025253 Bacteria 8140
155 Ga0209759_1000003 3300025256 Bacteria 792130
156 Ga0209759_1000067 3300025256 Bacteria 183764
157 Ga0209759_1000827 3300025256 Bacteria 24481
158 Ga0209759_1000945 3300025256 Bacteria 20847
159 Ga0209759_1011547 3300025256 Bacteria 2503
160 Ga0209129_1000038 3300025258 Bacteria 322778
161 Ga0209565_1010557 3300025263 Bacteria 2284
162 Ga0209455_1000030 3300025272 Bacteria 533479
163 Ga0209673_1006116 3300025273 Bacteria 5902
164 Ga0209564_1000030 3300025295 Bacteria 503296
165 Ga0209564_1000162 3300025295 Bacteria 162265
166 Ga0209758_1000152 3300025297 Bacteria 162418
167 Ga0209050_1001318 3300025298 Bacteria 27770
168 Ga0209050_1005806 3300025298 Bacteria 7582
169 Ga0209256_1000019 3300025299 Bacteria 558627
170 Ga0209256_1000154 3300025299 Bacteria 144509
171 Ga0209256_1001630 3300025299 Bacteria 21865
172 Ga0209051_1000004 3300025303 Bacteria 1155596
173 Ga0209051_1001939 3300025303 Bacteria 15964
174 Ga0209051_1002219 3300025303 Bacteria 14333
175 Ga0209257_1000038 3300025304 Bacteria 609032
176 Ga0209257_1000044 3300025304 Bacteria 486709
177 Ga0209257_1001143 3300025304 Bacteria 33909
178 Ga0209257_1002818 3300025304 Bacteria 16333
179 Ga0207682_10004149 3300025893 Bacteria 6133
180 Ga0207682_10014925 3300025893 Bacteria 3025
181 Ga0207680_10003513 3300025903 Bacteria 7375
182 Ga0207645_10012170 3300025907 Bacteria 5843
183 Ga0207645_10021151 3300025907 Bacteria 4246
184 Ga0207695_10105531 3300025913 Bacteria 2805
185 Ga0207671_10075450 3300025914 Bacteria 2522
186 Ga0207657_10026574 3300025919 Bacteria 5316
187 Ga0207657_10068876 3300025919 Bacteria 3005
188 Ga0207649_10018750 3300025920 Bacteria 3942
189 Ga0207681_10021197 3300025923 Bacteria 4128
190 Ga0207681_10069642 3300025923 Bacteria 2447
191 Ga0207694_10012459 3300025924 Bacteria 6410
192 Ga0207650_10001509 3300025925 Bacteria 16629
193 Ga0207650_10007976 3300025925 Bacteria 7218
194 Ga0207659_10000693 3300025926 Bacteria 19984
195 Ga0207659_10001411 3300025926 Bacteria 14308
196 Ga0207644_10045695 3300025931 Bacteria 3116
197 Ga0207644_10055810 3300025931 Bacteria 2848
198 Ga0207706_10001423 3300025933 Bacteria 23955
199 Ga0207706_10002215 3300025933 Bacteria 18972
200 Ga0207686_10028087 3300025934 Bacteria 3303
201 Ga0207709_10002660 3300025935 Bacteria 11087
202 Ga0207709_10025543 3300025935 Bacteria 3383
203 Ga0207704_10030787 3300025938 Bacteria 3014
204 Ga0207691_10001450 3300025940 Bacteria 23610
205 Ga0207691_10004652 3300025940 Bacteria 13287
206 Ga0207691_10008046 3300025940 Bacteria 10136
207 Ga0207711_10050249 3300025941 Bacteria 3569
208 Ga0207689_10011085 3300025942 Bacteria 7746
209 Ga0207689_10015431 3300025942 Bacteria 6467
210 Ga0207689_10079389 3300025942 Bacteria 2697
211 Ga0207679_10018387 3300025945 Bacteria 4681
212 Ga0207667_10024814 3300025949 Bacteria 6575
213 Ga0207667_10030671 3300025949 Bacteria 5812
214 Ga0207651_10001652 3300025960 Bacteria 10230
215 Ga0207651_10012840 3300025960 Bacteria 4761
216 Ga0207651_10042158 3300025960 Bacteria 3035
217 Ga0207651_10066919 3300025960 Bacteria 2526
218 Ga0207651_10107555 3300025960 Bacteria 2085
219 Ga0207658_10010141 3300025986 Bacteria 6402
220 Ga0207658_10051643 3300025986 Bacteria 3031
221 Ga0207658_10084451 3300025986 Bacteria 2443
222 Ga0207677_10002495 3300026023 Bacteria 9657
223 Ga0207677_10012736 3300026023 Bacteria 4849
224 Ga0207703_10002312 3300026035 Bacteria 16637
225 Ga0207703_10056989 3300026035 Bacteria 3184
226 Ga0207678_10000060 3300026067 Bacteria 85708
227 Ga0207708_10005130 3300026075 Bacteria 9662
228 Ga0207702_10001911 3300026078 Bacteria 20342
229 Ga0207702_10108411 3300026078 Bacteria 2464
230 Ga0207641_10002061 3300026088 Bacteria 19091
231 Ga0207641_10057629 3300026088 Bacteria 3304
232 Ga0207648_10000873 3300026089 Bacteria 33984
233 Ga0207648_10026807 3300026089 Bacteria 5118
234 Ga0207648_10070328 3300026089 Bacteria 3051
235 Ga0207648_10078950 3300026089 Bacteria 2872
236 Ga0207676_10001594 3300026095 Bacteria 16708
237 Ga0207676_10079982 3300026095 Bacteria 2652
238 Ga0207676_10158442 3300026095 Bacteria 1958
239 Ga0207675_100001114 3300026118 Bacteria 26600
240 Ga0207675_100011882 3300026118 Bacteria 8138
241 Ga0207675_100039804 3300026118 Bacteria 4386
242 Ga0207675_100042676 3300026118 Bacteria 4235
243 Ga0207683_10014068 3300026121 Bacteria 6821
244 Ga0207698_10007748 3300026142 Bacteria 6743
245 Ga0207698_10086628 3300026142 Bacteria 2548
246 Ga0207698_10135325 3300026142 Bacteria 2113
247 Ga0209281_1000023 3300027111 Bacteria 519955
248 Ga0209389_1000236 3300027296 Bacteria 36611
249 Ga0209371_1007985 3300027312 Bacteria 3587
250 Ga0209968_1000828 3300027526 Bacteria 4792
251 Ga0209966_1000113 3300027695 Bacteria 35785
252 Ga0268265_10001580 3300028380 Bacteria 18852
253 Ga0268264_10000909 3300028381 Bacteria 31074
254 Ga0268264_10007785 3300028381 Bacteria 8921
255 Ga0268264_10111650 3300028381 Bacteria 2395
256 Ga0268264_10135333 3300028381 Bacteria 2190
257 Ga0265336_10000030 3300028666 Bacteria 169335
258 Ga0307517_10017742 3300028786 Bacteria 9252
259 Ga0307515_10001320 3300028794 Bacteria 56334
260 Ga0307515_10024658 3300028794 Bacteria 10463
261 Ga0307515_10051729 3300028794 Bacteria 6115
262 Ga0307515_10064784 3300028794 Bacteria 5103
263 Ga0307515_10121756 3300028794 Bacteria 2949
264 Ga0265324_10000234 3300029957 Bacteria 41958
265 Ga0307512_10007489 3300030522 Bacteria 10812
266 Ga0265327_10000020 3300031251 Bacteria 424552
267 Ga0307513_10004000 3300031456 Bacteria 19785
268 Ga0307513_10013278 3300031456 Bacteria 10114
269 Ga0307513_10121386 3300031456 Bacteria 2580
270 Ga0307509_10000139 3300031507 Bacteria 108589
271 Ga0307509_10001408 3300031507 Bacteria 40683
272 Ga0307509_10025683 3300031507 Bacteria 6576
273 Ga0307509_10143964 3300031507 Bacteria 2313
274 Ga0307509_10215734 3300031507 Bacteria 1738
275 Ga0307508_10000291 3300031616 Bacteria 61434
276 Ga0307514_10001154 3300031649 Bacteria 35951
277 Ga0307514_10032607 3300031649 Bacteria 4166
278 Ga0307516_10000942 3300031730 Bacteria 40129
279 Ga0307516_10009715 3300031730 Bacteria 10683
280 Ga0307516_10157874 3300031730 Bacteria 2021
281 Ga0307413_10098781 3300031824 Bacteria 1923
282 Ga0307406_10045406 3300031901 Bacteria 2758
283 Ga0307412_10043555 3300031911 Bacteria 2923
284 Ga0307416_100005998 3300032002 Bacteria 7555
285 Ga0307411_10023145 3300032005 Bacteria 3673
286 Ga0307415_100005075 3300032126 Bacteria 6934
287 Ga0307510_10019224 3300033180 Bacteria 8016
288 Ga0373931_0007490 3300035691 Bacteria 5140
289 Ga0373931_0010384 3300035691 Bacteria 4475
290 Ga0373931_0080961 3300035691 Bacteria 1792
291 Ga0373927_0014011 3300035695 Bacteria 5315
292 Ga0373933_0011079 3300035724 Bacteria 4957
293 Ga0373925_0010228 3300037068 Bacteria 6809
294 Ga0395898_0000990 3300037466 Bacteria 44660
295 Ga0395905_0000951 3300037471 Bacteria 37161
296 Ga0395905_0010013 3300037471 Bacteria 9240
297 Ga0395905_0022128 3300037471 Bacteria 6014
298 Ga0436365_0646122 3300039437 Bacteria 1920
299 Ga0436361_0052534 3300039447 Bacteria 27577
300 Ga0436361_0074986 3300039447 Bacteria 19532
301 Ga0436361_0096676 3300039447 Bacteria 32751
302 Ga0436361_0175408 3300039447 Bacteria 3418
303 Ga0436361_0572581 3300039447 Bacteria 116104
304 Ga0436361_0700101 3300039447 Bacteria 4175
305 Ga0451839_1036224 3300041496 Bacteria 2105
306 Ga0451853_2259034 3300041512 Bacteria 1866
307 Ga0450919_001453 3300042121 Bacteria 3096
308 Ga0450890_001062 3300042127 Bacteria 3999
309 Ga0450891_000051 3300042129 Bacteria 9004
310 Ga0450889_000094 3300042144 Bacteria 8413
311 Ga0450918_000285 3300042531 Bacteria 11477
312 Ga0451577_0001207 3300042876 Bacteria 36165
313 Ga0451577_0002739 3300042876 Bacteria 20447
314 Ga0451577_0037499 3300042876 Bacteria 4362
315 Ga0466969_0000186 3300044656 Bacteria 33421
316 Ga0466972_0000314 3300044658 Bacteria 27904
317 Ga0466972_0018977 3300044658 Bacteria 3437
318 Ga0466965_0005778 3300044683 Bacteria 5585
319 Ga0466966_0013029 3300044684 Bacteria 5505
320 Ga0466963_0025412 3300044694 Bacteria 3777
321 Ga0466963_0058324 3300044694 Bacteria 2574
322 Ga0453684_0003748 3300044712 Bacteria 33606
323 Ga0453684_0076523 3300044712 Bacteria 4201
324 Ga0466970_0024276 3300044765 Bacteria 3170
325 Ga0466959_0085207 3300045049 Bacteria 2274
326 Ga0451576_0005858 3300045051 Bacteria 15264
327 Ga0495592_0000350 3300046454 Bacteria 37566
328 Ga0495650_0006168 3300046471 Bacteria 7534
329 Ga0495639_0019812 3300046475 Bacteria 2936
330 Ga0495585_0043007 3300046492 Bacteria 2528
331 Ga0495632_0005504 3300046519 Bacteria 8357
332 Ga0495586_0030058 3300046535 Bacteria 2908
333 Ga0495645_0109321 3300046543 Bacteria 1957
334 Ga0495625_0018743 3300046660 Bacteria 5391
335 Ga0495647_0056872 3300046681 Bacteria 1534
336 Ga0495670_0064679 3300046691 Bacteria 1843
337 Ga0495684_0020473 3300047471 Bacteria 5099
338 Ga0495686_0010295 3300047472 Bacteria 6661
339 Ga0496102_0129556 3300048905 Bacteria 2360
340 Ga0496106_0024789 3300048909 Bacteria 4460
341 Ga0496109_0023327 3300048912 Bacteria 5491
342 Ga0496109_0071335 3300048912 Bacteria 3189
343 Ga0496109_0171242 3300048912 Bacteria 2037
344 Ga0496111_0061718 3300048914 Bacteria 2717
345 Ga0496114_0004762 3300048917 Bacteria 10564
346 Ga0496124_0003437 3300048927 Bacteria 19388
347 Ga0496124_0014788 3300048927 Bacteria 7527
348 Ga0496125_0004680 3300048928 Bacteria 15593
349 Ga0501198_000033 3300049649 Bacteria 56683
350 Ga0501222_000016 3300049662 Bacteria 80046
351 nmdc:mga0k408_21546_c1 3300050493 Bacteria 3620
352 nmdc:mga07m45_18436_c2 3300050496 Bacteria 3424
353 nmdc:mga07m45_6492_c1 3300050496 Bacteria 5915
354 Ga0500635_0000047 3300053080 Bacteria 84059
355 Ga0495619_0024704 3300053085 Bacteria 3856
356 Ga0500578_0014097 3300053086 Bacteria 5144
357 Ga0500628_003028 3300053129 Bacteria 2761
358 Ga0500642_0015376 3300053130 Bacteria 2876
359 Ga0500559_0000252 3300053136 Bacteria 42525
360 Ga0500577_0015160 3300053142 Bacteria 2401
361 Ga0500619_000182 3300053154 Bacteria 15103
362 Ga0500622_0000300 3300053156 Bacteria 50701
363 Ga0500622_0002158 3300053156 Bacteria 14594
364 Ga0500622_0003941 3300053156 Bacteria 9591
365 Ga0500645_015383 3300053730 Bacteria 2424
366 Ga0500587_001862 3300053739 Bacteria 3006
367 Ga0587073_0008257 3300059492 Bacteria 1679
368 2587732514 2585428058 Bacteria 6853932
369 2588291881 2588253510 Bacteria 6901809
370 2643741772 2643221544 Bacteria 5886209
371 2643935042 2643221585 Bacteria 5812563
372 2643971465 2643221592 Bacteria 6608788
373 2644141000 2643221625 Bacteria 6512927
374 2644246642 2643221644 Bacteria 6865017
375 2644259254 2643221646 Bacteria 6433402
376 2644276792 2643221648 Bacteria 6521465
377 2644303731 2643221654 Bacteria 5273570
378 2644316529 2643221656 Bacteria 5809961
379 2644339266 2643221660 Bacteria 4208257
380 2739053520 2738541337 Bacteria 6183410
381 2831870143 2831864461 Bacteria 6502356
382 2886849442 2886848708 Bacteria 5632523
383 2894027659 2894023352 Bacteria 5167372
384 Ga0451789_1109880
385 JGI25156J39149_1000880
386 JGI25154J39366_1001463
387 JGI25157J39369_1000069
388 JGI25152J39213_1001988
389 JGI25153J46596_10002279
390 rootL2_10003559
391 rootH1_10046785
392 Ga0055539_1000500
393 Ga0055539_1002029
394 Ga0055533_1000026
395 Ga0055533_1000068
396 Ga0055525_1000056
397 Ga0055525_1001449
398 Ga0055535_1000252
399 Ga0055529_1000150
400 Ga0055526_1001773
401 Ga0055526_1003866
402 Ga0055524_1000033
403 Ga0055524_1003264
404 Ga0055540_1000184
405 Ga0055531_10000655
406 Ga0055531_10005360
407 Ga0055531_10009349
408 Ga0055543_1002258
409 Ga0065165_1000063
410 Ga0065165_1000460
411 Ga0070658_10024813
412 Ga0070658_10033024
413 Ga0070676_10008653
414 Ga0070670_100002390
415 Ga0070670_100033475
416 Ga0070670_100066211
417 Ga0070677_10004368
418 Ga0070677_10007983
419 Ga0068869_100013371
420 Ga0068869_100022741
421 Ga0068868_100010354
422 Ga0068868_100026794
423 Ga0068868_100095534
424 Ga0070660_100168782
425 Ga0070669_100003438
426 Ga0070669_100037632
427 Ga0070675_100004907
428 Ga0070675_100011363
429 Ga0070675_100026325
430 Ga0070675_100042351
431 Ga0070671_100007484
432 Ga0070671_100064885
433 Ga0070674_100024763
434 Ga0070674_100039275
435 Ga0070673_100000881
436 Ga0070673_100004600
437 Ga0070673_100006967
438 Ga0070673_100064321
439 Ga0070673_100087124
440 Ga0070667_100051156
441 Ga0070667_100180138
442 Ga0070700_100023236
443 Ga0070694_100005289
444 Ga0070663_100000177
445 Ga0070678_100003058
446 Ga0070678_100024625
447 Ga0070678_100043127
448 Ga0068867_100000279
449 Ga0068867_100013387
450 Ga0068867_100022951
451 Ga0068867_100041847
452 Ga0068853_100013903
453 Ga0070672_100002066
454 Ga0070672_100018056
455 Ga0070672_100018915
456 Ga0070672_100031163
457 Ga0070693_100052337
458 Ga0068855_100198210
459 Ga0070664_100035293
460 Ga0070664_100190361
461 Ga0070664_100191689
462 Ga0068857_100100371
463 Ga0068854_100084816
464 Ga0068854_100105293
465 Ga0068856_100003535
466 Ga0068856_100065008
467 Ga0070702_100030909
468 Ga0068852_100028808
469 Ga0068859_100001692
470 Ga0068859_100196699
471 Ga0068864_100001174
472 Ga0068864_100003663
473 Ga0068864_100015152
474 Ga0068861_100001573
475 Ga0068861_100026911
476 Ga0068863_100019041
477 Ga0068863_100117072
478 Ga0068858_100003671
479 Ga0068860_100025793
480 Ga0068860_100044216
481 Ga0068860_100158709
482 Ga0068862_100020956
483 Ga0068862_100025277
484 Ga0075366_10045204
485 Ga0075366_10053664
486 Ga0097621_100077351
487 Ga0075370_10000225
488 Ga0075370_10004591
489 Ga0068871_100024334
490 Ga0068865_100002021
491 Ga0097620_100001692
492 Ga0097620_100196681
493 Ga0099823_1000033
494 Ga0079104_1000009
495 Ga0105240_10223165
496 Ga0105243_10004453
497 Ga0105243_10052189
498 Ga0105242_10058105
499 Ga0105248_10020910
500 Ga0105248_10158437
501 Ga0105238_10020929
502 Ga0105239_10023168
503 Ga0157319_1000007
504 Ga0157369_10199845
505 Ga0157374_10084684
506 Ga0157378_10008040
507 Ga0163162_10006818
508 Ga0163162_10016099
509 Ga0163162_10016986
510 Ga0157372_10045051
511 Ga0157375_10034877
512 Ga0163163_10000524
513 Ga0157380_10037383
514 Ga0157377_10000006
515 Ga0157377_10050177
516 Ga0157379_10002725
517 Ga0157379_10010646
518 Ga0157379_10049564
519 Ga0157379_10062713
520 Ga0213872_10000009
521 Ga0213872_10000066
522 Ga0213872_10000208
523 Ga0213872_10000226
524 Ga0213872_10014723
525 Ga0213872_10041208
526 Ga0209674_100024
527 Ga0209563_100014
528 Ga0209563_100101
529 Ga0207427_101408
530 Ga0209258_100080
531 Ga0209258_100912
532 Ga0207425_1000681
533 Ga0209646_1000012
534 Ga0209026_1000004
535 Ga0209677_100091
536 Ga0209677_100150
537 Ga0209677_101979
538 Ga0209759_1000003
539 Ga0209759_1000067
540 Ga0209759_1000827
541 Ga0209759_1000945
542 Ga0209759_1011547
543 Ga0209129_1000038
544 Ga0209565_1010557
545 Ga0209455_1000030
546 Ga0209673_1006116
547 Ga0209564_1000030
548 Ga0209564_1000162
549 Ga0209758_1000152
550 Ga0209050_1001318
551 Ga0209050_1005806
552 Ga0209256_1000019
553 Ga0209256_1000154
554 Ga0209256_1001630
555 Ga0209051_1000004
556 Ga0209051_1001939
557 Ga0209051_1002219
558 Ga0209257_1000038
559 Ga0209257_1000044
560 Ga0209257_1001143
561 Ga0209257_1002818
562 Ga0207682_10004149
563 Ga0207682_10014925
564 Ga0207680_10003513
565 Ga0207645_10012170
566 Ga0207645_10021151
567 Ga0207695_10105531
568 Ga0207671_10075450
569 Ga0207657_10026574
570 Ga0207657_10068876
571 Ga0207649_10018750
572 Ga0207681_10021197
573 Ga0207681_10069642
574 Ga0207694_10012459
575 Ga0207650_10001509
576 Ga0207650_10007976
577 Ga0207659_10000693
578 Ga0207659_10001411
579 Ga0207644_10045695
580 Ga0207644_10055810
581 Ga0207706_10001423
582 Ga0207706_10002215
583 Ga0207686_10028087
584 Ga0207709_10002660
585 Ga0207709_10025543
586 Ga0207704_10030787
587 Ga0207691_10001450
588 Ga0207691_10004652
589 Ga0207691_10008046
590 Ga0207711_10050249
591 Ga0207689_10011085
592 Ga0207689_10015431
593 Ga0207689_10079389
594 Ga0207679_10018387
595 Ga0207667_10024814
596 Ga0207667_10030671
597 Ga0207651_10001652
598 Ga0207651_10012840
599 Ga0207651_10042158
600 Ga0207651_10066919
601 Ga0207651_10107555
602 Ga0207658_10010141
603 Ga0207658_10051643
604 Ga0207658_10084451
605 Ga0207677_10002495
606 Ga0207677_10012736
607 Ga0207703_10002312
608 Ga0207703_10056989
609 Ga0207678_10000060
610 Ga0207708_10005130
611 Ga0207702_10001911
612 Ga0207702_10108411
613 Ga0207641_10002061
614 Ga0207641_10057629
615 Ga0207648_10000873
616 Ga0207648_10026807
617 Ga0207648_10070328
618 Ga0207648_10078950
619 Ga0207676_10001594
620 Ga0207676_10079982
621 Ga0207676_10158442
622 Ga0207675_100001114
623 Ga0207675_100011882
624 Ga0207675_100039804
625 Ga0207675_100042676
626 Ga0207683_10014068
627 Ga0207698_10007748
628 Ga0207698_10086628
629 Ga0207698_10135325
630 Ga0209281_1000023
631 Ga0209389_1000236
632 Ga0209371_1007985
633 Ga0209968_1000828
634 Ga0209966_1000113
635 Ga0268265_10001580
636 Ga0268264_10000909
637 Ga0268264_10007785
638 Ga0268264_10111650
639 Ga0268264_10135333
640 Ga0265336_10000030
641 Ga0307517_10017742
642 Ga0307515_10001320
643 Ga0307515_10024658
644 Ga0307515_10051729
645 Ga0307515_10064784
646 Ga0307515_10121756
647 Ga0265324_10000234
648 Ga0307512_10007489
649 Ga0265327_10000020
650 Ga0307513_10004000
651 Ga0307513_10013278
652 Ga0307513_10121386
653 Ga0307509_10000139
654 Ga0307509_10001408
655 Ga0307509_10025683
656 Ga0307509_10143964
657 Ga0307509_10215734
658 Ga0307508_10000291
659 Ga0307514_10001154
660 Ga0307514_10032607
661 Ga0307516_10000942
662 Ga0307516_10009715
663 Ga0307516_10157874
664 Ga0307413_10098781
665 Ga0307406_10045406
666 Ga0307412_10043555
667 Ga0307416_100005998
668 Ga0307411_10023145
669 Ga0307415_100005075
670 Ga0307510_10019224
671 Ga0373931_0007490
672 Ga0373931_0010384
673 Ga0373931_0080961
674 Ga0373927_0014011
675 Ga0373933_0011079
676 Ga0373925_0010228
677 Ga0395898_0000990
678 Ga0395905_0000951
679 Ga0395905_0010013
680 Ga0395905_0022128
681 Ga0436365_0646122
682 Ga0436361_0052534
683 Ga0436361_0074986
684 Ga0436361_0096676
685 Ga0436361_0175408
686 Ga0436361_0572581
687 Ga0436361_0700101
688 Ga0451839_1036224
689 Ga0451853_2259034
690 Ga0450919_001453
691 Ga0450890_001062
692 Ga0450891_000051
693 Ga0450889_000094
694 Ga0450918_000285
695 Ga0451577_0001207
696 Ga0451577_0002739
697 Ga0451577_0037499
698 Ga0466969_0000186
699 Ga0466972_0000314
700 Ga0466972_0018977
701 Ga0466965_0005778
702 Ga0466966_0013029
703 Ga0466963_0025412
704 Ga0466963_0058324
705 Ga0453684_0003748
706 Ga0453684_0076523
707 Ga0466970_0024276
708 Ga0466959_0085207
709 Ga0451576_0005858
710 Ga0495592_0000350
711 Ga0495650_0006168
712 Ga0495639_0019812
713 Ga0495585_0043007
714 Ga0495632_0005504
715 Ga0495586_0030058
716 Ga0495645_0109321
717 Ga0495625_0018743
718 Ga0495647_0056872
719 Ga0495670_0064679
720 Ga0495684_0020473
721 Ga0495686_0010295
722 Ga0496102_0129556
723 Ga0496106_0024789
724 Ga0496109_0023327
725 Ga0496109_0071335
726 Ga0496109_0171242
727 Ga0496111_0061718
728 Ga0496114_0004762
729 Ga0496124_0003437
730 Ga0496124_0014788
731 Ga0496125_0004680
732 Ga0501198_000033
733 Ga0501222_000016
734 nmdc:mga0k408_21546_c1
735 nmdc:mga07m45_18436_c2
736 nmdc:mga07m45_6492_c1
737 Ga0500635_0000047
738 Ga0495619_0024704
739 Ga0500578_0014097
740 Ga0500628_003028
741 Ga0500642_0015376
742 Ga0500559_0000252
743 Ga0500577_0015160
744 Ga0500619_000182
745 Ga0500622_0000300
746 Ga0500622_0002158
747 Ga0500622_0003941
748 Ga0500645_015383
749 Ga0500587_001862
750 Ga0587073_0008257
751 2587732514
752 2588291881
753 2643741772
754 2643935042
755 2643971465
756 2644141000
757 2644246642
758 2644259254
759 2644276792
760 2644303731
761 2644316529
762 2644339266
763 2739053520
764 2831870143
765 2886849442
766 2894027659

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

106

474

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pfe-assembly1.cif.gz_A-2 crystal structure of a m20a metallo peptidase (dape, lpg0809) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 a resolution 0.9343 14 489
3pfe-assembly1.cif.gz_A-2 crystal structure of a m20a metallo peptidase (dape, lpg0809) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 a resolution 0.9191 14 489
2pok-assembly1.cif.gz_B crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae 0.7895 12 490
2pok-assembly1.cif.gz_B crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae 0.7865 12 490
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.7745 14 489
ID Description Score Start End Superfamily
3pfeA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9426 14 489 3.40.630.10
af_Q54X02_3_472_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9288 13 490 3.40.630.10
af_Q54X02_3_472_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9213 13 490 3.40.630.10
3pfeA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9203 14 489 3.40.630.10
af_Q4DBK5_22_457_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9179 32 481 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2W6TVC0-F1-model_v4 Peptidase M20 0.9462 13 221 GO:0006508
GO:0008233
AF-A0A432FL51-F1-model_v4 Peptidase M20 0.9444 13 214 GO:0006508
GO:0008233
AF-A0A2H9SMK8-F1-model_v4 Peptidase M20 0.9425 14 489 GO:0006508
GO:0008233
AF-A0A2D5BN82-F1-model_v4 Peptidase M20 0.9403 13 490 GO:0006508
GO:0008233
AF-A0A1R2C2F4-F1-model_v4 Uncharacterized protein 0.9402 13 489 GO:0006508
GO:0008233

Map