F429680

General Info

Members Datasets Scaffolds Average Seq Length
383 261 766 436

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0022530|Ga0466970_0022530_19_1431
Length 470
Sequence VAVDVQVRRSSRSAPDPTPSRTGQENRMTQNAAAAWRFETAQVHAGAQPDPATGARATPIYKTTSYVFENSDHARDLFALAQPGNIYSRIMNPTNDVVEQRIAALEGGSGALLVSSGQAAETYAVLNIAGAGDHIVSSSSIYGGTYNLFKYTLAKLGIETTFVEDQDDLEEWRRAVRPNTKLFFAETIGNPKINVLDITGVSDVAHEAGVPLIVDNTIATPYLIRPFEHGADVVVHSATKFLGGHGTVIGGVIVDGGRFAWSDHADRFPEFNTPDPSYHGAVFAQAVGNELAYIVKARVQLLRDLGASNSPDTAFALLQGIETLSLRIERHVSNAQEIAEWLDRHPDVATVAYAGLPTSPWYAAANRYAPKGVGAVLSFELKGGVPAGKAFVDNLSLFSHLANIGDVRSLVIHPASTTHSQLTPEQQLTTGVTPGLVRLSVGIENVEDLRADLEAGLAAARAVSQEGLRA

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
157 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
158 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
159 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
160 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
164 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
165 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
172 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
173 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
174 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
175 2643221546 Microbacterium sp. Root53 Isolate Unclassified
176 2643221549 Agromyces sp. Root1464 Isolate Unclassified
177 2643221553 Microbacterium sp. Root553 Isolate Unclassified
178 2643221566 Microbacterium sp. Root166 Isolate Unclassified
179 2643221572 Leifsonia sp. Root60 Isolate Unclassified
180 2643221575 Microbacterium sp. Root61 Isolate Unclassified
181 2643221597 Microbacterium sp. Root180 Isolate Unclassified
182 2643221616 Leifsonia sp. Root227 Isolate Unclassified
183 2643221619 Agromyces sp. Root81 Isolate Unclassified
184 2643221630 Microbacterium sp. Root322 Isolate Unclassified
185 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
186 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
187 2643221649 Leifsonia sp. Root4 Isolate Unclassified
188 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
189 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
190 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
191 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
192 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
193 2773857759 Microbacterium sp. 1294 Isolate Unclassified
194 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
195 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
196 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
197 2808606372 Agromyces sp. 23-23 Isolate Unclassified
198 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
199 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
200 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
201 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
202 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
203 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
204 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
205 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
206 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
207 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
208 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
209 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
210 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
211 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
212 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
213 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
214 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
215 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
216 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
217 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
218 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
219 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
220 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
221 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
222 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
223 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
224 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
225 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
226 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
227 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
228 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
229 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
230 2919069694 Microbacterium sp. 1154 Isolate Unclassified
231 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
232 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
233 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
234 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
235 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
236 2928153084 Leifsonia sp. 563 Isolate Unclassified
237 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
238 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
239 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
240 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
241 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
242 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
243 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
244 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
245 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
246 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
247 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
248 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
249 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
250 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
251 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
252 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
253 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
254 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
255 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
256 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
257 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
258 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
259 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
260 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
261 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.37
Metatranscriptomes 2.61
Isolates 24.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.78
Bulb 0
Endosphere 14.62
Nodule 0.52
Rhizoplane 3.39
Rhizosphere 51.44
Stem 0
Stem Tuber 0.26
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0022530 3300044765 Bacteria 3287
2 JGI24740J21852_10008539 3300001979 Bacteria 4074
3 JGI24740J21852_10038983 3300001979 Bacteria 1453
4 JGI24739J22299_10028715 3300001989 Bacteria 1938
5 JGI24735J21928_10001102 3300002067 Bacteria 9670
6 JGI25154J39366_1001611 3300002738 Bacteria 7666
7 JGI25164J39214_1000917 3300002772 Bacteria 9799
8 JGI25165J46597_1000044 3300003214 Bacteria 263289
9 Ga0006562J51391_1014374 3300003578 Bacteria 18050
10 Ga0006562J51391_1014378 3300003578 Bacteria 9390
11 Ga0006562J51391_1062142 3300003578 Bacteria 3710
12 Ga0055539_1000027 3300003752 Bacteria 258020
13 Ga0055533_1000020 3300003756 Bacteria 353998
14 Ga0055525_1000296 3300003759 Bacteria 43199
15 Ga0055527_1000005 3300003760 Bacteria 504776
16 Ga0055542_1000006 3300003762 Bacteria 504776
17 Ga0055542_1006227 3300003762 Bacteria 2577
18 Ga0055529_1000013 3300003763 Bacteria 373267
19 Ga0055541_1002903 3300003841 Bacteria 3310
20 Ga0065704_10101798 3300005289 Bacteria 2225
21 Ga0065707_10082265 3300005295 Bacteria 17909
22 Ga0070658_10000162 3300005327 Bacteria 58038
23 Ga0070658_10006377 3300005327 Bacteria 9559
24 Ga0070658_10007450 3300005327 Bacteria 8835
25 Ga0068868_100005298 3300005338 Bacteria 9062
26 Ga0070661_100031249 3300005344 Bacteria 3849
27 Ga0070659_100103983 3300005366 Bacteria 2288
28 Ga0070710_10097210 3300005437 Bacteria 1747
29 Ga0068853_100009060 3300005539 Bacteria 8014
30 Ga0068855_100025463 3300005563 Bacteria 7078
31 Ga0068856_100129458 3300005614 Bacteria 2528
32 Ga0068852_100053338 3300005616 Bacteria 3480
33 Ga0068861_100017878 3300005719 Bacteria 5039
34 Ga0068851_10000005 3300005834 Bacteria 262808
35 Ga0068870_10053053 3300005840 Bacteria 2152
36 Ga0068858_100002205 3300005842 Bacteria 19723
37 Ga0081539_10002454 3300005985 Bacteria 26134
38 Ga0075364_10005508 3300006051 Bacteria 7366
39 Ga0075364_10052925 3300006051 Bacteria 2653
40 Ga0075367_10016535 3300006178 Bacteria 4029
41 Ga0105244_10077165 3300009036 Bacteria 1653
42 Ga0105247_10047988 3300009101 Bacteria 2623
43 Ga0105248_10063864 3300009177 Bacteria 4133
44 Ga0105237_10000464 3300009545 Bacteria 57468
45 Ga0105238_10002588 3300009551 Bacteria 18027
46 Ga0105246_10064854 3300011119 Bacteria 2553
47 Ga0157371_10000414 3300013102 Bacteria 52787
48 Ga0157370_10004830 3300013104 Bacteria 15322
49 Ga0157369_10000103 3300013105 Bacteria 118273
50 Ga0157369_10059386 3300013105 Bacteria 4124
51 Ga0157369_10378979 3300013105 Bacteria 1468
52 Ga0171462_1001 3300013250 Bacteria 1135406
53 Ga0157372_10088518 3300013307 Bacteria 3516
54 Ga0157372_10263466 3300013307 Bacteria 2002
55 Ga0163163_10049816 3300014325 Bacteria 4123
56 Ga0157380_10000775 3300014326 Bacteria 20002
57 Ga0157380_10090113 3300014326 Bacteria 2529
58 Ga0197907_10701590 3300020069 Bacteria 4724
59 Ga0206356_11230400 3300020070 Bacteria 1785
60 Ga0206350_10286752 3300020080 Bacteria 1362
61 Ga0206354_10116423 3300020081 Bacteria 3790
62 Ga0206353_10360380 3300020082 Bacteria 2664
63 Ga0206353_10373074 3300020082 Bacteria 19601
64 Ga0209566_100043 3300025225 Bacteria 266609
65 Ga0209674_100001 3300025226 Bacteria 4013750
66 Ga0209672_100003 3300025228 Bacteria 1560476
67 Ga0209563_100001 3300025230 Bacteria 4013775
68 Ga0207427_100126 3300025231 Bacteria 95170
69 Ga0209437_101068 3300025233 Bacteria 8913
70 Ga0209258_103042 3300025242 Bacteria 3851
71 Ga0209646_1000134 3300025246 Bacteria 124492
72 Ga0209677_100001 3300025253 Bacteria 4013787
73 Ga0209677_100508 3300025253 Bacteria 21770
74 Ga0209148_1000004 3300025254 Bacteria 1844481
75 Ga0209148_1000401 3300025254 Bacteria 50504
76 Ga0209233_1000014 3300025261 Bacteria 996641
77 Ga0209455_1000046 3300025272 Bacteria 382681
78 Ga0209455_1001325 3300025272 Bacteria 11451
79 Ga0207656_10000001 3300025321 Bacteria 1323684
80 Ga0207656_10000003 3300025321 Bacteria 771644
81 Ga0207656_10000004 3300025321 Bacteria 632320
82 Ga0207655_1011862 3300025728 Bacteria 5145
83 Ga0207710_10021669 3300025900 Bacteria 2756
84 Ga0207647_10071306 3300025904 Bacteria 2096
85 Ga0207643_10067333 3300025908 Bacteria 2055
86 Ga0207705_10000001 3300025909 Bacteria 2061880
87 Ga0207654_10000003 3300025911 Bacteria 1030378
88 Ga0207695_10022665 3300025913 Bacteria 7120
89 Ga0207671_10000001 3300025914 Bacteria 1318881
90 Ga0207671_10029137 3300025914 Bacteria 4124
91 Ga0207657_10006049 3300025919 Bacteria 12580
92 Ga0207694_10000066 3300025924 Bacteria 128281
93 Ga0207687_10004508 3300025927 Bacteria 9267
94 Ga0207664_10086681 3300025929 Bacteria 2558
95 Ga0207690_10001774 3300025932 Bacteria 13270
96 Ga0207711_10001250 3300025941 Bacteria 24124
97 Ga0207667_10106058 3300025949 Bacteria 2899
98 Ga0207668_10057749 3300025972 Bacteria 2709
99 Ga0207677_10004525 3300026023 Bacteria 7478
100 Ga0207703_10000026 3300026035 Bacteria 211591
101 Ga0207702_10047397 3300026078 Bacteria 3621
102 Ga0207674_10012612 3300026116 Bacteria 9445
103 Ga0207675_100039976 3300026118 Bacteria 4377
104 Ga0207698_10000243 3300026142 Bacteria 33530
105 Ga0307515_10230963 3300028794 Bacteria 1643
106 Ga0265330_10000700 3300031235 Bacteria 21309
107 Ga0307514_10013492 3300031649 Bacteria 6774
108 Ga0307406_10000025 3300031901 Bacteria 92128
109 Ga0307406_10024858 3300031901 Bacteria 3582
110 Ga0307406_10092354 3300031901 Bacteria 2041
111 Ga0307407_10073725 3300031903 Bacteria 2041
112 Ga0395899_0009371 3300037312 Bacteria 7519
113 Ga0395900_0008066 3300037418 Bacteria 10838
114 Ga0395900_0077091 3300037418 Bacteria 3425
115 Ga0395900_0192260 3300037418 Bacteria 2069
116 Ga0395898_0000098 3300037466 Bacteria 229806
117 Ga0451793_0150338 3300041452 Bacteria 2005
118 Ga0466972_0039843 3300044658 Bacteria 2291
119 Ga0466966_0088702 3300044684 Bacteria 1922
120 Ga0466961_0032783 3300044693 Bacteria 3338
121 Ga0466961_0094832 3300044693 Bacteria 1882
122 Ga0453684_0007131 3300044712 Bacteria 20819
123 Ga0466970_0002080 3300044765 Bacteria 9679
124 Ga0466970_0005428 3300044765 Bacteria 6324
125 Ga0466970_0021018 3300044765 Bacteria 3397
126 Ga0466970_0037115 3300044765 Bacteria 2582
127 Ga0466960_0032879 3300044901 Bacteria 2406
128 Ga0466959_0033760 3300045049 Bacteria 3784
129 Ga0466958_0118293 3300045836 Bacteria 1657
130 Ga0495627_000588 3300046453 Bacteria 29097
131 Ga0495590_0000357 3300046457 Bacteria 23376
132 Ga0495638_0000663 3300046460 Bacteria 37532
133 Ga0495650_0000757 3300046471 Bacteria 40371
134 Ga0495632_0007148 3300046519 Bacteria 7062
135 Ga0495656_0025237 3300046615 Bacteria 2355
136 Ga0496101_0013044 3300048904 Bacteria 5560
137 Ga0496103_0017299 3300048906 Bacteria 4314
138 Ga0496104_0074147 3300048907 Bacteria 3239
139 Ga0496106_0094910 3300048909 Bacteria 2307
140 Ga0496111_0025658 3300048914 Bacteria 4159
141 Ga0496112_0183487 3300048915 Bacteria 2056
142 Ga0496114_0020064 3300048917 Bacteria 5421
143 Ga0496114_0030499 3300048917 Bacteria 4437
144 Ga0496114_0162631 3300048917 Bacteria 1942
145 Ga0496115_0015465 3300048918 Bacteria 5788
146 Ga0496115_0025165 3300048918 Bacteria 4632
147 Ga0496115_0114710 3300048918 Bacteria 2214
148 Ga0496117_0000028 3300048920 Bacteria 407392
149 Ga0496117_0000214 3300048920 Bacteria 111723
150 Ga0496117_0001188 3300048920 Bacteria 39155
151 Ga0496117_0001743 3300048920 Bacteria 30010
152 Ga0496117_0005043 3300048920 Bacteria 14159
153 Ga0496117_0023470 3300048920 Bacteria 4913
154 Ga0496117_0025667 3300048920 Bacteria 4627
155 Ga0496117_0034331 3300048920 Bacteria 3823
156 Ga0496118_0001331 3300048921 Bacteria 37503
157 Ga0496118_0003500 3300048921 Bacteria 19693
158 Ga0496118_0017609 3300048921 Bacteria 6491
159 Ga0496118_0058635 3300048921 Bacteria 2875
160 Ga0496118_0063654 3300048921 Bacteria 2712
161 Ga0496118_0067765 3300048921 Bacteria 2596
162 Ga0496119_0001492 3300048922 Bacteria 28020
163 Ga0496119_0002724 3300048922 Bacteria 19053
164 Ga0496119_0003102 3300048922 Bacteria 17539
165 Ga0496119_0004343 3300048922 Bacteria 14146
166 Ga0496119_0008297 3300048922 Bacteria 9158
167 Ga0496119_0023350 3300048922 Bacteria 4391
168 Ga0496119_0034446 3300048922 Bacteria 3334
169 Ga0496119_0056132 3300048922 Bacteria 2387
170 Ga0496120_0000617 3300048923 Bacteria 53694
171 Ga0496120_0001254 3300048923 Bacteria 31918
172 Ga0496120_0001547 3300048923 Bacteria 26928
173 Ga0496120_0020128 3300048923 Bacteria 4250
174 Ga0496120_0023692 3300048923 Bacteria 3839
175 Ga0496120_0024775 3300048923 Bacteria 3735
176 Ga0496120_0045290 3300048923 Bacteria 2549
177 Ga0496120_0071941 3300048923 Bacteria 1897
178 Ga0496121_0000289 3300048924 Bacteria 104434
179 Ga0496121_0092724 3300048924 Bacteria 2354
180 Ga0496121_0124534 3300048924 Bacteria 1940
181 Ga0496121_0128079 3300048924 Bacteria 1905
182 Ga0496122_0000055 3300048925 Bacteria 258485
183 Ga0496122_0000948 3300048925 Bacteria 52491
184 Ga0496122_0002343 3300048925 Bacteria 27312
185 Ga0496122_0006061 3300048925 Bacteria 14088
186 Ga0496122_0023088 3300048925 Bacteria 5501
187 Ga0496123_0000003 3300048926 Bacteria 866556
188 Ga0496123_0000169 3300048926 Bacteria 130983
189 Ga0496123_0002276 3300048926 Bacteria 24168
190 Ga0496123_0008632 3300048926 Bacteria 9319
191 Ga0496123_0029043 3300048926 Bacteria 4082
192 Ga0496124_0000037 3300048927 Bacteria 317430
193 Ga0496124_0001959 3300048927 Bacteria 28130
194 Ga0496124_0008428 3300048927 Bacteria 10782
195 Ga0496124_0041396 3300048927 Bacteria 3975
196 Ga0496124_0162726 3300048927 Bacteria 1738
197 Ga0496125_0000120 3300048928 Bacteria 175991
198 Ga0496125_0004022 3300048928 Bacteria 17256
199 Ga0496125_0010333 3300048928 Bacteria 9446
200 Ga0496125_0015877 3300048928 Bacteria 7255
201 Ga0496125_0022500 3300048928 Bacteria 5850
202 Ga0496126_0004638 3300048929 Bacteria 16263
203 Ga0496126_0031721 3300048929 Bacteria 4986
204 Ga0496126_0048198 3300048929 Bacteria 3895
205 Ga0496126_0098425 3300048929 Bacteria 2562
206 Ga0496126_0134147 3300048929 Bacteria 2137
207 Ga0501031_0007200 3300049568 Bacteria 7259
208 Ga0501031_0027101 3300049568 Bacteria 3735
209 Ga0501032_0014700 3300049569 Bacteria 5539
210 Ga0501032_0022382 3300049569 Bacteria 4381
211 Ga0501033_0016961 3300049570 Bacteria 5504
212 Ga0501033_0100687 3300049570 Bacteria 2108
213 Ga0501034_0000909 3300049571 Bacteria 43164
214 Ga0501034_0009277 3300049571 Bacteria 10313
215 Ga0501034_0018615 3300049571 Bacteria 7119
216 Ga0501034_0034722 3300049571 Bacteria 5113
217 Ga0501034_0048540 3300049571 Bacteria 4284
218 Ga0501034_0060089 3300049571 Bacteria 3818
219 Ga0501034_0158687 3300049571 Bacteria 2234
220 Ga0501036_0007703 3300049572 Bacteria 8796
221 Ga0501036_0022552 3300049572 Bacteria 5296
222 Ga0501037_0007987 3300049573 Bacteria 7754
223 Ga0501037_0019735 3300049573 Bacteria 4973
224 Ga0501037_0103455 3300049573 Bacteria 2054
225 Ga0501038_0008790 3300049574 Bacteria 9263
226 Ga0501038_0106991 3300049574 Bacteria 2320
227 Ga0501039_0008389 3300049575 Bacteria 7874
228 Ga0501039_0008664 3300049575 Bacteria 7749
229 Ga0501040_0132574 3300049576 Bacteria 1753
230 Ga0501042_0035689 3300049578 Bacteria 3527
231 Ga0501043_0005323 3300049579 Bacteria 10403
232 Ga0501043_0018427 3300049579 Bacteria 5475
233 Ga0501043_0031966 3300049579 Bacteria 4136
234 Ga0501046_0013437 3300049580 Bacteria 6931
235 Ga0501046_0024680 3300049580 Bacteria 4927
236 Ga0501046_0080898 3300049580 Bacteria 2509
237 Ga0501047_0018634 3300049581 Bacteria 6656
238 Ga0501047_0024170 3300049581 Bacteria 5835
239 Ga0501047_0048978 3300049581 Bacteria 4080
240 Ga0501047_0145913 3300049581 Bacteria 2243
241 Ga0501048_0004091 3300049582 Bacteria 11106
242 Ga0501069_0005312 3300049585 Bacteria 6692
243 Ga0501070_0000044 3300049586 Bacteria 108859
244 Ga0501070_0000988 3300049586 Bacteria 25553
245 Ga0501070_0007445 3300049586 Bacteria 9301
246 Ga0501071_0000167 3300049587 Bacteria 28392
247 Ga0501073_0000475 3300049589 Bacteria 27774
248 Ga0501080_0000057 3300049742 Bacteria 72729
249 Ga0501083_0000072 3300049744 Bacteria 66576
250 Ga0501083_0008866 3300049744 Bacteria 7103
251 Ga0501035_0014817 3300049822 Bacteria 7198
252 Ga0501035_0039587 3300049822 Bacteria 4264
253 Ga0501035_0128604 3300049822 Bacteria 2209
254 Ga0501035_0130662 3300049822 Bacteria 2189
255 Ga0501044_0012527 3300049823 Bacteria 9185
256 Ga0501044_0016409 3300049823 Bacteria 7951
257 Ga0501044_0018382 3300049823 Bacteria 7489
258 Ga0501044_0090262 3300049823 Bacteria 3091
259 Ga0501044_0205579 3300049823 Bacteria 1926
260 nmdc:mga00v17_62277_c1 3300050491 Bacteria 2295
261 nmdc:mga0yw44_14924_c1 3300050492 Bacteria 4144
262 nmdc:mga0yw44_31565_c1 3300050492 Bacteria 3082
263 nmdc:mga06z11_16867_c1 3300050494 Bacteria 3301
264 nmdc:mga0sz30_12706_c2 3300050516 Bacteria 2958
265 Ga0500635_0000004 3300053080 Bacteria 210675
266 Ga0500635_0012561 3300053080 Bacteria 2436
267 Ga0500643_000353 3300053087 Bacteria 36455
268 Ga0500651_0000284 3300053093 Bacteria 29700
269 Ga0500650_0000538 3300053098 Bacteria 9679
270 Ga0500556_0000007 3300053104 Bacteria 331400
271 Ga0500556_0000559 3300053104 Bacteria 24852
272 Ga0500562_001194 3300053108 Bacteria 6401
273 Ga0500593_002562 3300053117 Bacteria 6697
274 Ga0500559_0000160 3300053136 Bacteria 53115
275 Ga0500559_0000643 3300053136 Bacteria 23541
276 Ga0500559_0002566 3300053136 Bacteria 9314
277 Ga0500568_0000021 3300053139 Bacteria 185406
278 Ga0500568_0000176 3300053139 Bacteria 55879
279 Ga0500568_0011031 3300053139 Bacteria 4208
280 Ga0500573_0000007 3300053140 Bacteria 272970
281 Ga0500573_0007334 3300053140 Bacteria 6012
282 Ga0500573_0009900 3300053140 Bacteria 5309
283 Ga0500577_0002156 3300053142 Bacteria 5024
284 Ga0500590_014218 3300053148 Bacteria 4099
285 Ga0500604_0045401 3300053151 Bacteria 1341
286 Ga0500616_0000021 3300053153 Bacteria 484527
287 Ga0500616_0000394 3300053153 Bacteria 60261
288 Ga0500620_000319 3300053155 Bacteria 9097
289 Ga0501084_0016397 3300054114 Bacteria 6154
290 Ga0587130_002907 3300059631 Bacteria 1417
291 Ga0466962_0040784 3300061719 Bacteria 2221
292 2514587913 2513237351 Bacteria 6968952
293 2587864791 2585428094 Bacteria 3604039
294 2588106719 2585428157 Bacteria 3018951
295 2643734153 2643221542 Bacteria 3563959
296 2643754033 2643221546 Bacteria 2910897
297 2643769558 2643221549 Bacteria 4042819
298 2643785311 2643221553 Bacteria 3544260
299 2643849399 2643221566 Bacteria 3460379
300 2643874693 2643221572 Bacteria 3614809
301 2643888555 2643221575 Bacteria 4022601
302 2643996421 2643221597 Bacteria 3347721
303 2644095117 2643221616 Bacteria 4066575
304 2644114177 2643221619 Bacteria 4158469
305 2644170739 2643221630 Bacteria 3601215
306 2644180890 2643221632 Bacteria 3406696
307 2644198914 2643221635 Bacteria 2632343
308 2644277521 2643221649 Bacteria 3867359
309 2644381749 2643221669 Bacteria 3611286
310 2723642842 2721755702 Bacteria 4373124
311 2753302358 2751185788 Bacteria 4541048
312 2758224410 2757320536 Bacteria 3629334
313 2774378533 2773857758 Bacteria 3592392
314 2774383675 2773857759 Bacteria 2963774
315 2774400225 2773857763 Bacteria 4180068
316 2808631751 2808606306 Bacteria 3608896
317 2808885066 2808606368 Bacteria 3174172
318 2808902835 2808606372 Bacteria 4649509
319 2809226852 2808606447 Bacteria 3572005
320 2812322465 2811994872 Bacteria 4121241
321 2821269389 2821268502 Bacteria 3750023
322 2833710294 2833709550 Bacteria 4008291
323 2844841594 2844841374 Bacteria 3917147
324 2844855741 2844852863 Bacteria 3849151
325 2852633072 2852632344 Bacteria 3463163
326 2852645020 2852643534 Bacteria 3013378
327 2852664734 2852663356 Bacteria 4090475
328 2852679045 2852677369 Bacteria 3768884
329 2857721063 2857720070 Bacteria 3189373
330 2857723350 2857723135 Bacteria 4217853
331 2857732276 2857729791 Bacteria 4040535
332 2857736784 2857733635 Bacteria 3532004
333 2857740000 2857737099 Bacteria 3104305
334 2862993334 2862993130 Bacteria 3860849
335 2862995436 2862993130 Bacteria 3860849
336 2870622952 2870622029 Bacteria 3643329
337 2870629755 2870628048 Bacteria 3696012
338 2881850302 2881845957 Bacteria 6611900
339 2884764517 2884763398 Bacteria 4091164
340 2895662935 2895660088 Bacteria 3782833
341 2897563095 2897561785 Bacteria 3256946
342 2904432829 2904430863 Bacteria 3486923
343 2904503281 2904501621 Bacteria 3401437
344 2904510032 2904509784 Bacteria 3520416
345 2906800809 2906799679 Bacteria 4031749
346 2908675542 2908674828 Bacteria 3382763
347 2908678755 2908678064 Bacteria 3482747
348 2909074598 2909074476 Bacteria 3436050
349 2919040946 2919039151 Bacteria 3391018
350 2919045516 2919042368 Bacteria 3905917
351 2919057250 2919055335 Bacteria 3875751
352 2919071107 2919069694 Bacteria 3622919
353 2919443410 2919443155 Bacteria 4072969
354 2919523602 2919523602 Bacteria 3788128
355 2928091215 2928090899 Bacteria 3158267
356 2928105301 2928104781 Bacteria 3877447
357 2928124832 2928121344 Bacteria 3972376
358 2928155028 2928153084 Bacteria 4020257
359 2928500526 2928500415 Bacteria 3384541
360 2935412986 2935409751 Bacteria 4179611
361 2939657359 2939657138 Bacteria 3740283
362 2939664133 2939660829 Bacteria 3784848
363 2946043685 2946041624 Bacteria 4191385
364 2946081399 2946080515 Bacteria 4310960
365 2966921803 2966921586 Bacteria 3092803
366 2966925186 2966924647 Bacteria 3268643
367 2974298031 2974294766 Bacteria 3767688
368 2974325731 2974324384 Bacteria 3750535
369 2977230650 2977228692 Bacteria 3450105
370 2977251811 2977251589 Bacteria 2952848
371 2977265917 2977264416 Bacteria 3750737
372 2984542766 2984542743 Bacteria 3569378
373 2984554507 2984551494 Bacteria 3877562
374 2984582034 2984580707 Bacteria 3351387
375 2995728500 2995726249 Bacteria 3470435
376 8004185605 8004182704 Bacteria 3391155
377 8004214645 8004212874 Bacteria 2861420
378 8016254685 8016254467 Bacteria 3797036
379 8045832696 8045830549 Bacteria 4444727
380 8046355820 8046352972 Bacteria 3613806
381 8055035413 8055034563 Bacteria 3562128
382 8055038915 8055037949 Bacteria 3337834
383 8057348498 8057345674 Bacteria 4160394
384 Ga0466970_0022530
385 JGI24740J21852_10008539
386 JGI24740J21852_10038983
387 JGI24739J22299_10028715
388 JGI24735J21928_10001102
389 JGI25154J39366_1001611
390 JGI25164J39214_1000917
391 JGI25165J46597_1000044
392 Ga0006562J51391_1014374
393 Ga0006562J51391_1014378
394 Ga0006562J51391_1062142
395 Ga0055539_1000027
396 Ga0055533_1000020
397 Ga0055525_1000296
398 Ga0055527_1000005
399 Ga0055542_1000006
400 Ga0055542_1006227
401 Ga0055529_1000013
402 Ga0055541_1002903
403 Ga0065704_10101798
404 Ga0065707_10082265
405 Ga0070658_10000162
406 Ga0070658_10006377
407 Ga0070658_10007450
408 Ga0068868_100005298
409 Ga0070661_100031249
410 Ga0070659_100103983
411 Ga0070710_10097210
412 Ga0068853_100009060
413 Ga0068855_100025463
414 Ga0068856_100129458
415 Ga0068852_100053338
416 Ga0068861_100017878
417 Ga0068851_10000005
418 Ga0068870_10053053
419 Ga0068858_100002205
420 Ga0081539_10002454
421 Ga0075364_10005508
422 Ga0075364_10052925
423 Ga0075367_10016535
424 Ga0105244_10077165
425 Ga0105247_10047988
426 Ga0105248_10063864
427 Ga0105237_10000464
428 Ga0105238_10002588
429 Ga0105246_10064854
430 Ga0157371_10000414
431 Ga0157370_10004830
432 Ga0157369_10000103
433 Ga0157369_10059386
434 Ga0157369_10378979
435 Ga0171462_1001
436 Ga0157372_10088518
437 Ga0157372_10263466
438 Ga0163163_10049816
439 Ga0157380_10000775
440 Ga0157380_10090113
441 Ga0197907_10701590
442 Ga0206356_11230400
443 Ga0206350_10286752
444 Ga0206354_10116423
445 Ga0206353_10360380
446 Ga0206353_10373074
447 Ga0209566_100043
448 Ga0209674_100001
449 Ga0209672_100003
450 Ga0209563_100001
451 Ga0207427_100126
452 Ga0209437_101068
453 Ga0209258_103042
454 Ga0209646_1000134
455 Ga0209677_100001
456 Ga0209677_100508
457 Ga0209148_1000004
458 Ga0209148_1000401
459 Ga0209233_1000014
460 Ga0209455_1000046
461 Ga0209455_1001325
462 Ga0207656_10000001
463 Ga0207656_10000003
464 Ga0207656_10000004
465 Ga0207655_1011862
466 Ga0207710_10021669
467 Ga0207647_10071306
468 Ga0207643_10067333
469 Ga0207705_10000001
470 Ga0207654_10000003
471 Ga0207695_10022665
472 Ga0207671_10000001
473 Ga0207671_10029137
474 Ga0207657_10006049
475 Ga0207694_10000066
476 Ga0207687_10004508
477 Ga0207664_10086681
478 Ga0207690_10001774
479 Ga0207711_10001250
480 Ga0207667_10106058
481 Ga0207668_10057749
482 Ga0207677_10004525
483 Ga0207703_10000026
484 Ga0207702_10047397
485 Ga0207674_10012612
486 Ga0207675_100039976
487 Ga0207698_10000243
488 Ga0307515_10230963
489 Ga0265330_10000700
490 Ga0307514_10013492
491 Ga0307406_10000025
492 Ga0307406_10024858
493 Ga0307406_10092354
494 Ga0307407_10073725
495 Ga0395899_0009371
496 Ga0395900_0008066
497 Ga0395900_0077091
498 Ga0395900_0192260
499 Ga0395898_0000098
500 Ga0451793_0150338
501 Ga0466972_0039843
502 Ga0466966_0088702
503 Ga0466961_0032783
504 Ga0466961_0094832
505 Ga0453684_0007131
506 Ga0466970_0002080
507 Ga0466970_0005428
508 Ga0466970_0021018
509 Ga0466970_0037115
510 Ga0466960_0032879
511 Ga0466959_0033760
512 Ga0466958_0118293
513 Ga0495627_000588
514 Ga0495590_0000357
515 Ga0495638_0000663
516 Ga0495650_0000757
517 Ga0495632_0007148
518 Ga0495656_0025237
519 Ga0496101_0013044
520 Ga0496103_0017299
521 Ga0496104_0074147
522 Ga0496106_0094910
523 Ga0496111_0025658
524 Ga0496112_0183487
525 Ga0496114_0020064
526 Ga0496114_0030499
527 Ga0496114_0162631
528 Ga0496115_0015465
529 Ga0496115_0025165
530 Ga0496115_0114710
531 Ga0496117_0000028
532 Ga0496117_0000214
533 Ga0496117_0001188
534 Ga0496117_0001743
535 Ga0496117_0005043
536 Ga0496117_0023470
537 Ga0496117_0025667
538 Ga0496117_0034331
539 Ga0496118_0001331
540 Ga0496118_0003500
541 Ga0496118_0017609
542 Ga0496118_0058635
543 Ga0496118_0063654
544 Ga0496118_0067765
545 Ga0496119_0001492
546 Ga0496119_0002724
547 Ga0496119_0003102
548 Ga0496119_0004343
549 Ga0496119_0008297
550 Ga0496119_0023350
551 Ga0496119_0034446
552 Ga0496119_0056132
553 Ga0496120_0000617
554 Ga0496120_0001254
555 Ga0496120_0001547
556 Ga0496120_0020128
557 Ga0496120_0023692
558 Ga0496120_0024775
559 Ga0496120_0045290
560 Ga0496120_0071941
561 Ga0496121_0000289
562 Ga0496121_0092724
563 Ga0496121_0124534
564 Ga0496121_0128079
565 Ga0496122_0000055
566 Ga0496122_0000948
567 Ga0496122_0002343
568 Ga0496122_0006061
569 Ga0496122_0023088
570 Ga0496123_0000003
571 Ga0496123_0000169
572 Ga0496123_0002276
573 Ga0496123_0008632
574 Ga0496123_0029043
575 Ga0496124_0000037
576 Ga0496124_0001959
577 Ga0496124_0008428
578 Ga0496124_0041396
579 Ga0496124_0162726
580 Ga0496125_0000120
581 Ga0496125_0004022
582 Ga0496125_0010333
583 Ga0496125_0015877
584 Ga0496125_0022500
585 Ga0496126_0004638
586 Ga0496126_0031721
587 Ga0496126_0048198
588 Ga0496126_0098425
589 Ga0496126_0134147
590 Ga0501031_0007200
591 Ga0501031_0027101
592 Ga0501032_0014700
593 Ga0501032_0022382
594 Ga0501033_0016961
595 Ga0501033_0100687
596 Ga0501034_0000909
597 Ga0501034_0009277
598 Ga0501034_0018615
599 Ga0501034_0034722
600 Ga0501034_0048540
601 Ga0501034_0060089
602 Ga0501034_0158687
603 Ga0501036_0007703
604 Ga0501036_0022552
605 Ga0501037_0007987
606 Ga0501037_0019735
607 Ga0501037_0103455
608 Ga0501038_0008790
609 Ga0501038_0106991
610 Ga0501039_0008389
611 Ga0501039_0008664
612 Ga0501040_0132574
613 Ga0501042_0035689
614 Ga0501043_0005323
615 Ga0501043_0018427
616 Ga0501043_0031966
617 Ga0501046_0013437
618 Ga0501046_0024680
619 Ga0501046_0080898
620 Ga0501047_0018634
621 Ga0501047_0024170
622 Ga0501047_0048978
623 Ga0501047_0145913
624 Ga0501048_0004091
625 Ga0501069_0005312
626 Ga0501070_0000044
627 Ga0501070_0000988
628 Ga0501070_0007445
629 Ga0501071_0000167
630 Ga0501073_0000475
631 Ga0501080_0000057
632 Ga0501083_0000072
633 Ga0501083_0008866
634 Ga0501035_0014817
635 Ga0501035_0039587
636 Ga0501035_0128604
637 Ga0501035_0130662
638 Ga0501044_0012527
639 Ga0501044_0016409
640 Ga0501044_0018382
641 Ga0501044_0090262
642 Ga0501044_0205579
643 nmdc:mga00v17_62277_c1
644 nmdc:mga0yw44_14924_c1
645 nmdc:mga0yw44_31565_c1
646 nmdc:mga06z11_16867_c1
647 nmdc:mga0sz30_12706_c2
648 Ga0500635_0000004
649 Ga0500635_0012561
650 Ga0500643_000353
651 Ga0500651_0000284
652 Ga0500650_0000538
653 Ga0500556_0000007
654 Ga0500556_0000559
655 Ga0500562_001194
656 Ga0500593_002562
657 Ga0500559_0000160
658 Ga0500559_0000643
659 Ga0500559_0002566
660 Ga0500568_0000021
661 Ga0500568_0000176
662 Ga0500568_0011031
663 Ga0500573_0000007
664 Ga0500573_0007334
665 Ga0500573_0009900
666 Ga0500577_0002156
667 Ga0500590_014218
668 Ga0500604_0045401
669 Ga0500616_0000021
670 Ga0500616_0000394
671 Ga0500620_000319
672 Ga0501084_0016397
673 Ga0587130_002907
674 Ga0466962_0040784
675 2514587913
676 2587864791
677 2588106719
678 2643734153
679 2643754033
680 2643769558
681 2643785311
682 2643849399
683 2643874693
684 2643888555
685 2643996421
686 2644095117
687 2644114177
688 2644170739
689 2644180890
690 2644198914
691 2644277521
692 2644381749
693 2723642842
694 2753302358
695 2758224410
696 2774378533
697 2774383675
698 2774400225
699 2808631751
700 2808885066
701 2808902835
702 2809226852
703 2812322465
704 2821269389
705 2833710294
706 2844841594
707 2844855741
708 2852633072
709 2852645020
710 2852664734
711 2852679045
712 2857721063
713 2857723350
714 2857732276
715 2857736784
716 2857740000
717 2862993334
718 2862995436
719 2870622952
720 2870629755
721 2881850302
722 2884764517
723 2895662935
724 2897563095
725 2904432829
726 2904503281
727 2904510032
728 2906800809
729 2908675542
730 2908678755
731 2909074598
732 2919040946
733 2919045516
734 2919057250
735 2919071107
736 2919443410
737 2919523602
738 2928091215
739 2928105301
740 2928124832
741 2928155028
742 2928500526
743 2935412986
744 2939657359
745 2939664133
746 2946043685
747 2946081399
748 2966921803
749 2966925186
750 2974298031
751 2974325731
752 2977230650
753 2977251811
754 2977265917
755 2984542766
756 2984554507
757 2984582034
758 2995728500
759 8004185605
760 8004214645
761 8016254685
762 8045832696
763 8046355820
764 8055035413
765 8055038915
766 8057348498

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

39

458

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kam-assembly2.cif.gz_A x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m 0.9794 6 433
4kam-assembly3.cif.gz_C x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m 0.9763 6 433
4kam-assembly2.cif.gz_B x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m 0.9759 6 433
8eqw-assembly2.cif.gz_B crystal structure of fub7 0.9717 8 431
4kam-assembly3.cif.gz_D x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m 0.9717 6 427
ID Description Score Start End Superfamily
4kamA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9821 68 295 3.40.640.10
4kamB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9771 298 433 3.90.1150.10
af_O53390_302_449_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9746 298 435 3.90.1150.10
af_O13326_295_429_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9733 298 429 3.90.1150.10
af_P32929_263_402_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9731 297 431 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A2N6VIN7-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase (EC 2.5.1.49) 0.9883 57 169 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-T0V080-F1-model_v4 O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) 0.988 83 308 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A7J5Q3C0-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase 0.9859 36 402 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A3D4TPV9-F1-model_v4 Bifunctional O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (EC 2.5.1.49) 0.9859 87 255 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-R7HSQ6-F1-model_v4 O-acetylhomoserine sulfhydrolase 0.9846 176 430 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0016787
GO:0019346
GO:0030170
GO:0071269

Map