F429680
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 383 | 261 | 766 | 436 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0022530|Ga0466970_0022530_19_1431 |
| Length | 470 |
| Sequence | VAVDVQVRRSSRSAPDPTPSRTGQENRMTQNAAAAWRFETAQVHAGAQPDPATGARATPIYKTTSYVFENSDHARDLFALAQPGNIYSRIMNPTNDVVEQRIAALEGGSGALLVSSGQAAETYAVLNIAGAGDHIVSSSSIYGGTYNLFKYTLAKLGIETTFVEDQDDLEEWRRAVRPNTKLFFAETIGNPKINVLDITGVSDVAHEAGVPLIVDNTIATPYLIRPFEHGADVVVHSATKFLGGHGTVIGGVIVDGGRFAWSDHADRFPEFNTPDPSYHGAVFAQAVGNELAYIVKARVQLLRDLGASNSPDTAFALLQGIETLSLRIERHVSNAQEIAEWLDRHPDVATVAYAGLPTSPWYAAANRYAPKGVGAVLSFELKGGVPAGKAFVDNLSLFSHLANIGDVRSLVIHPASTTHSQLTPEQQLTTGVTPGLVRLSVGIENVEDLRADLEAGLAAARAVSQEGLRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 34 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 60 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 88 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 89 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 90 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 91 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 92 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 93 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 94 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 95 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 96 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 97 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 98 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 99 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 100 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 101 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 102 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 103 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 110 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 111 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 112 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 113 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 114 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 115 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 116 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 117 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 118 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 119 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 120 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 121 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 122 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 123 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 124 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 125 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 126 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 127 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 150 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 151 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 152 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 153 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 154 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 155 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 156 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 157 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 158 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 159 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 160 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 161 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 162 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 163 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 164 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 165 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 166 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 167 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 168 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 171 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 172 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 173 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 174 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 175 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 176 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 177 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 178 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 179 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 180 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 181 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 182 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 183 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 184 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 185 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 186 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 187 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 188 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 189 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 190 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 191 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 192 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 193 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 194 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 195 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 196 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 197 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 198 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 199 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 200 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 201 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 202 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 203 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 204 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 205 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 206 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 207 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 208 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 209 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 210 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 211 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 212 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 213 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 214 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 215 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 216 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 217 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 218 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 219 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 220 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 221 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 222 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 223 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 224 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 225 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 226 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 227 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 228 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 229 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 230 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 231 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 232 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 233 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 234 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 235 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 236 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 237 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 238 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 239 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 240 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 241 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 242 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 243 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 244 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 245 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 246 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 247 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 248 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 249 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 250 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 251 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 252 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 253 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 254 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 255 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 256 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 257 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 258 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 259 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 260 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 261 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.37 |
| Metatranscriptomes | 2.61 |
| Isolates | 24.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.78 |
| Bulb | 0 |
| Endosphere | 14.62 |
| Nodule | 0.52 |
| Rhizoplane | 3.39 |
| Rhizosphere | 51.44 |
| Stem | 0 |
| Stem Tuber | 0.26 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466970_0022530 | 3300044765 | Bacteria | 3287 |
| 2 | JGI24740J21852_10008539 | 3300001979 | Bacteria | 4074 |
| 3 | JGI24740J21852_10038983 | 3300001979 | Bacteria | 1453 |
| 4 | JGI24739J22299_10028715 | 3300001989 | Bacteria | 1938 |
| 5 | JGI24735J21928_10001102 | 3300002067 | Bacteria | 9670 |
| 6 | JGI25154J39366_1001611 | 3300002738 | Bacteria | 7666 |
| 7 | JGI25164J39214_1000917 | 3300002772 | Bacteria | 9799 |
| 8 | JGI25165J46597_1000044 | 3300003214 | Bacteria | 263289 |
| 9 | Ga0006562J51391_1014374 | 3300003578 | Bacteria | 18050 |
| 10 | Ga0006562J51391_1014378 | 3300003578 | Bacteria | 9390 |
| 11 | Ga0006562J51391_1062142 | 3300003578 | Bacteria | 3710 |
| 12 | Ga0055539_1000027 | 3300003752 | Bacteria | 258020 |
| 13 | Ga0055533_1000020 | 3300003756 | Bacteria | 353998 |
| 14 | Ga0055525_1000296 | 3300003759 | Bacteria | 43199 |
| 15 | Ga0055527_1000005 | 3300003760 | Bacteria | 504776 |
| 16 | Ga0055542_1000006 | 3300003762 | Bacteria | 504776 |
| 17 | Ga0055542_1006227 | 3300003762 | Bacteria | 2577 |
| 18 | Ga0055529_1000013 | 3300003763 | Bacteria | 373267 |
| 19 | Ga0055541_1002903 | 3300003841 | Bacteria | 3310 |
| 20 | Ga0065704_10101798 | 3300005289 | Bacteria | 2225 |
| 21 | Ga0065707_10082265 | 3300005295 | Bacteria | 17909 |
| 22 | Ga0070658_10000162 | 3300005327 | Bacteria | 58038 |
| 23 | Ga0070658_10006377 | 3300005327 | Bacteria | 9559 |
| 24 | Ga0070658_10007450 | 3300005327 | Bacteria | 8835 |
| 25 | Ga0068868_100005298 | 3300005338 | Bacteria | 9062 |
| 26 | Ga0070661_100031249 | 3300005344 | Bacteria | 3849 |
| 27 | Ga0070659_100103983 | 3300005366 | Bacteria | 2288 |
| 28 | Ga0070710_10097210 | 3300005437 | Bacteria | 1747 |
| 29 | Ga0068853_100009060 | 3300005539 | Bacteria | 8014 |
| 30 | Ga0068855_100025463 | 3300005563 | Bacteria | 7078 |
| 31 | Ga0068856_100129458 | 3300005614 | Bacteria | 2528 |
| 32 | Ga0068852_100053338 | 3300005616 | Bacteria | 3480 |
| 33 | Ga0068861_100017878 | 3300005719 | Bacteria | 5039 |
| 34 | Ga0068851_10000005 | 3300005834 | Bacteria | 262808 |
| 35 | Ga0068870_10053053 | 3300005840 | Bacteria | 2152 |
| 36 | Ga0068858_100002205 | 3300005842 | Bacteria | 19723 |
| 37 | Ga0081539_10002454 | 3300005985 | Bacteria | 26134 |
| 38 | Ga0075364_10005508 | 3300006051 | Bacteria | 7366 |
| 39 | Ga0075364_10052925 | 3300006051 | Bacteria | 2653 |
| 40 | Ga0075367_10016535 | 3300006178 | Bacteria | 4029 |
| 41 | Ga0105244_10077165 | 3300009036 | Bacteria | 1653 |
| 42 | Ga0105247_10047988 | 3300009101 | Bacteria | 2623 |
| 43 | Ga0105248_10063864 | 3300009177 | Bacteria | 4133 |
| 44 | Ga0105237_10000464 | 3300009545 | Bacteria | 57468 |
| 45 | Ga0105238_10002588 | 3300009551 | Bacteria | 18027 |
| 46 | Ga0105246_10064854 | 3300011119 | Bacteria | 2553 |
| 47 | Ga0157371_10000414 | 3300013102 | Bacteria | 52787 |
| 48 | Ga0157370_10004830 | 3300013104 | Bacteria | 15322 |
| 49 | Ga0157369_10000103 | 3300013105 | Bacteria | 118273 |
| 50 | Ga0157369_10059386 | 3300013105 | Bacteria | 4124 |
| 51 | Ga0157369_10378979 | 3300013105 | Bacteria | 1468 |
| 52 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 53 | Ga0157372_10088518 | 3300013307 | Bacteria | 3516 |
| 54 | Ga0157372_10263466 | 3300013307 | Bacteria | 2002 |
| 55 | Ga0163163_10049816 | 3300014325 | Bacteria | 4123 |
| 56 | Ga0157380_10000775 | 3300014326 | Bacteria | 20002 |
| 57 | Ga0157380_10090113 | 3300014326 | Bacteria | 2529 |
| 58 | Ga0197907_10701590 | 3300020069 | Bacteria | 4724 |
| 59 | Ga0206356_11230400 | 3300020070 | Bacteria | 1785 |
| 60 | Ga0206350_10286752 | 3300020080 | Bacteria | 1362 |
| 61 | Ga0206354_10116423 | 3300020081 | Bacteria | 3790 |
| 62 | Ga0206353_10360380 | 3300020082 | Bacteria | 2664 |
| 63 | Ga0206353_10373074 | 3300020082 | Bacteria | 19601 |
| 64 | Ga0209566_100043 | 3300025225 | Bacteria | 266609 |
| 65 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 66 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 67 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 68 | Ga0207427_100126 | 3300025231 | Bacteria | 95170 |
| 69 | Ga0209437_101068 | 3300025233 | Bacteria | 8913 |
| 70 | Ga0209258_103042 | 3300025242 | Bacteria | 3851 |
| 71 | Ga0209646_1000134 | 3300025246 | Bacteria | 124492 |
| 72 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 73 | Ga0209677_100508 | 3300025253 | Bacteria | 21770 |
| 74 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 75 | Ga0209148_1000401 | 3300025254 | Bacteria | 50504 |
| 76 | Ga0209233_1000014 | 3300025261 | Bacteria | 996641 |
| 77 | Ga0209455_1000046 | 3300025272 | Bacteria | 382681 |
| 78 | Ga0209455_1001325 | 3300025272 | Bacteria | 11451 |
| 79 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 80 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 81 | Ga0207656_10000004 | 3300025321 | Bacteria | 632320 |
| 82 | Ga0207655_1011862 | 3300025728 | Bacteria | 5145 |
| 83 | Ga0207710_10021669 | 3300025900 | Bacteria | 2756 |
| 84 | Ga0207647_10071306 | 3300025904 | Bacteria | 2096 |
| 85 | Ga0207643_10067333 | 3300025908 | Bacteria | 2055 |
| 86 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 87 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 88 | Ga0207695_10022665 | 3300025913 | Bacteria | 7120 |
| 89 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 90 | Ga0207671_10029137 | 3300025914 | Bacteria | 4124 |
| 91 | Ga0207657_10006049 | 3300025919 | Bacteria | 12580 |
| 92 | Ga0207694_10000066 | 3300025924 | Bacteria | 128281 |
| 93 | Ga0207687_10004508 | 3300025927 | Bacteria | 9267 |
| 94 | Ga0207664_10086681 | 3300025929 | Bacteria | 2558 |
| 95 | Ga0207690_10001774 | 3300025932 | Bacteria | 13270 |
| 96 | Ga0207711_10001250 | 3300025941 | Bacteria | 24124 |
| 97 | Ga0207667_10106058 | 3300025949 | Bacteria | 2899 |
| 98 | Ga0207668_10057749 | 3300025972 | Bacteria | 2709 |
| 99 | Ga0207677_10004525 | 3300026023 | Bacteria | 7478 |
| 100 | Ga0207703_10000026 | 3300026035 | Bacteria | 211591 |
| 101 | Ga0207702_10047397 | 3300026078 | Bacteria | 3621 |
| 102 | Ga0207674_10012612 | 3300026116 | Bacteria | 9445 |
| 103 | Ga0207675_100039976 | 3300026118 | Bacteria | 4377 |
| 104 | Ga0207698_10000243 | 3300026142 | Bacteria | 33530 |
| 105 | Ga0307515_10230963 | 3300028794 | Bacteria | 1643 |
| 106 | Ga0265330_10000700 | 3300031235 | Bacteria | 21309 |
| 107 | Ga0307514_10013492 | 3300031649 | Bacteria | 6774 |
| 108 | Ga0307406_10000025 | 3300031901 | Bacteria | 92128 |
| 109 | Ga0307406_10024858 | 3300031901 | Bacteria | 3582 |
| 110 | Ga0307406_10092354 | 3300031901 | Bacteria | 2041 |
| 111 | Ga0307407_10073725 | 3300031903 | Bacteria | 2041 |
| 112 | Ga0395899_0009371 | 3300037312 | Bacteria | 7519 |
| 113 | Ga0395900_0008066 | 3300037418 | Bacteria | 10838 |
| 114 | Ga0395900_0077091 | 3300037418 | Bacteria | 3425 |
| 115 | Ga0395900_0192260 | 3300037418 | Bacteria | 2069 |
| 116 | Ga0395898_0000098 | 3300037466 | Bacteria | 229806 |
| 117 | Ga0451793_0150338 | 3300041452 | Bacteria | 2005 |
| 118 | Ga0466972_0039843 | 3300044658 | Bacteria | 2291 |
| 119 | Ga0466966_0088702 | 3300044684 | Bacteria | 1922 |
| 120 | Ga0466961_0032783 | 3300044693 | Bacteria | 3338 |
| 121 | Ga0466961_0094832 | 3300044693 | Bacteria | 1882 |
| 122 | Ga0453684_0007131 | 3300044712 | Bacteria | 20819 |
| 123 | Ga0466970_0002080 | 3300044765 | Bacteria | 9679 |
| 124 | Ga0466970_0005428 | 3300044765 | Bacteria | 6324 |
| 125 | Ga0466970_0021018 | 3300044765 | Bacteria | 3397 |
| 126 | Ga0466970_0037115 | 3300044765 | Bacteria | 2582 |
| 127 | Ga0466960_0032879 | 3300044901 | Bacteria | 2406 |
| 128 | Ga0466959_0033760 | 3300045049 | Bacteria | 3784 |
| 129 | Ga0466958_0118293 | 3300045836 | Bacteria | 1657 |
| 130 | Ga0495627_000588 | 3300046453 | Bacteria | 29097 |
| 131 | Ga0495590_0000357 | 3300046457 | Bacteria | 23376 |
| 132 | Ga0495638_0000663 | 3300046460 | Bacteria | 37532 |
| 133 | Ga0495650_0000757 | 3300046471 | Bacteria | 40371 |
| 134 | Ga0495632_0007148 | 3300046519 | Bacteria | 7062 |
| 135 | Ga0495656_0025237 | 3300046615 | Bacteria | 2355 |
| 136 | Ga0496101_0013044 | 3300048904 | Bacteria | 5560 |
| 137 | Ga0496103_0017299 | 3300048906 | Bacteria | 4314 |
| 138 | Ga0496104_0074147 | 3300048907 | Bacteria | 3239 |
| 139 | Ga0496106_0094910 | 3300048909 | Bacteria | 2307 |
| 140 | Ga0496111_0025658 | 3300048914 | Bacteria | 4159 |
| 141 | Ga0496112_0183487 | 3300048915 | Bacteria | 2056 |
| 142 | Ga0496114_0020064 | 3300048917 | Bacteria | 5421 |
| 143 | Ga0496114_0030499 | 3300048917 | Bacteria | 4437 |
| 144 | Ga0496114_0162631 | 3300048917 | Bacteria | 1942 |
| 145 | Ga0496115_0015465 | 3300048918 | Bacteria | 5788 |
| 146 | Ga0496115_0025165 | 3300048918 | Bacteria | 4632 |
| 147 | Ga0496115_0114710 | 3300048918 | Bacteria | 2214 |
| 148 | Ga0496117_0000028 | 3300048920 | Bacteria | 407392 |
| 149 | Ga0496117_0000214 | 3300048920 | Bacteria | 111723 |
| 150 | Ga0496117_0001188 | 3300048920 | Bacteria | 39155 |
| 151 | Ga0496117_0001743 | 3300048920 | Bacteria | 30010 |
| 152 | Ga0496117_0005043 | 3300048920 | Bacteria | 14159 |
| 153 | Ga0496117_0023470 | 3300048920 | Bacteria | 4913 |
| 154 | Ga0496117_0025667 | 3300048920 | Bacteria | 4627 |
| 155 | Ga0496117_0034331 | 3300048920 | Bacteria | 3823 |
| 156 | Ga0496118_0001331 | 3300048921 | Bacteria | 37503 |
| 157 | Ga0496118_0003500 | 3300048921 | Bacteria | 19693 |
| 158 | Ga0496118_0017609 | 3300048921 | Bacteria | 6491 |
| 159 | Ga0496118_0058635 | 3300048921 | Bacteria | 2875 |
| 160 | Ga0496118_0063654 | 3300048921 | Bacteria | 2712 |
| 161 | Ga0496118_0067765 | 3300048921 | Bacteria | 2596 |
| 162 | Ga0496119_0001492 | 3300048922 | Bacteria | 28020 |
| 163 | Ga0496119_0002724 | 3300048922 | Bacteria | 19053 |
| 164 | Ga0496119_0003102 | 3300048922 | Bacteria | 17539 |
| 165 | Ga0496119_0004343 | 3300048922 | Bacteria | 14146 |
| 166 | Ga0496119_0008297 | 3300048922 | Bacteria | 9158 |
| 167 | Ga0496119_0023350 | 3300048922 | Bacteria | 4391 |
| 168 | Ga0496119_0034446 | 3300048922 | Bacteria | 3334 |
| 169 | Ga0496119_0056132 | 3300048922 | Bacteria | 2387 |
| 170 | Ga0496120_0000617 | 3300048923 | Bacteria | 53694 |
| 171 | Ga0496120_0001254 | 3300048923 | Bacteria | 31918 |
| 172 | Ga0496120_0001547 | 3300048923 | Bacteria | 26928 |
| 173 | Ga0496120_0020128 | 3300048923 | Bacteria | 4250 |
| 174 | Ga0496120_0023692 | 3300048923 | Bacteria | 3839 |
| 175 | Ga0496120_0024775 | 3300048923 | Bacteria | 3735 |
| 176 | Ga0496120_0045290 | 3300048923 | Bacteria | 2549 |
| 177 | Ga0496120_0071941 | 3300048923 | Bacteria | 1897 |
| 178 | Ga0496121_0000289 | 3300048924 | Bacteria | 104434 |
| 179 | Ga0496121_0092724 | 3300048924 | Bacteria | 2354 |
| 180 | Ga0496121_0124534 | 3300048924 | Bacteria | 1940 |
| 181 | Ga0496121_0128079 | 3300048924 | Bacteria | 1905 |
| 182 | Ga0496122_0000055 | 3300048925 | Bacteria | 258485 |
| 183 | Ga0496122_0000948 | 3300048925 | Bacteria | 52491 |
| 184 | Ga0496122_0002343 | 3300048925 | Bacteria | 27312 |
| 185 | Ga0496122_0006061 | 3300048925 | Bacteria | 14088 |
| 186 | Ga0496122_0023088 | 3300048925 | Bacteria | 5501 |
| 187 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 188 | Ga0496123_0000169 | 3300048926 | Bacteria | 130983 |
| 189 | Ga0496123_0002276 | 3300048926 | Bacteria | 24168 |
| 190 | Ga0496123_0008632 | 3300048926 | Bacteria | 9319 |
| 191 | Ga0496123_0029043 | 3300048926 | Bacteria | 4082 |
| 192 | Ga0496124_0000037 | 3300048927 | Bacteria | 317430 |
| 193 | Ga0496124_0001959 | 3300048927 | Bacteria | 28130 |
| 194 | Ga0496124_0008428 | 3300048927 | Bacteria | 10782 |
| 195 | Ga0496124_0041396 | 3300048927 | Bacteria | 3975 |
| 196 | Ga0496124_0162726 | 3300048927 | Bacteria | 1738 |
| 197 | Ga0496125_0000120 | 3300048928 | Bacteria | 175991 |
| 198 | Ga0496125_0004022 | 3300048928 | Bacteria | 17256 |
| 199 | Ga0496125_0010333 | 3300048928 | Bacteria | 9446 |
| 200 | Ga0496125_0015877 | 3300048928 | Bacteria | 7255 |
| 201 | Ga0496125_0022500 | 3300048928 | Bacteria | 5850 |
| 202 | Ga0496126_0004638 | 3300048929 | Bacteria | 16263 |
| 203 | Ga0496126_0031721 | 3300048929 | Bacteria | 4986 |
| 204 | Ga0496126_0048198 | 3300048929 | Bacteria | 3895 |
| 205 | Ga0496126_0098425 | 3300048929 | Bacteria | 2562 |
| 206 | Ga0496126_0134147 | 3300048929 | Bacteria | 2137 |
| 207 | Ga0501031_0007200 | 3300049568 | Bacteria | 7259 |
| 208 | Ga0501031_0027101 | 3300049568 | Bacteria | 3735 |
| 209 | Ga0501032_0014700 | 3300049569 | Bacteria | 5539 |
| 210 | Ga0501032_0022382 | 3300049569 | Bacteria | 4381 |
| 211 | Ga0501033_0016961 | 3300049570 | Bacteria | 5504 |
| 212 | Ga0501033_0100687 | 3300049570 | Bacteria | 2108 |
| 213 | Ga0501034_0000909 | 3300049571 | Bacteria | 43164 |
| 214 | Ga0501034_0009277 | 3300049571 | Bacteria | 10313 |
| 215 | Ga0501034_0018615 | 3300049571 | Bacteria | 7119 |
| 216 | Ga0501034_0034722 | 3300049571 | Bacteria | 5113 |
| 217 | Ga0501034_0048540 | 3300049571 | Bacteria | 4284 |
| 218 | Ga0501034_0060089 | 3300049571 | Bacteria | 3818 |
| 219 | Ga0501034_0158687 | 3300049571 | Bacteria | 2234 |
| 220 | Ga0501036_0007703 | 3300049572 | Bacteria | 8796 |
| 221 | Ga0501036_0022552 | 3300049572 | Bacteria | 5296 |
| 222 | Ga0501037_0007987 | 3300049573 | Bacteria | 7754 |
| 223 | Ga0501037_0019735 | 3300049573 | Bacteria | 4973 |
| 224 | Ga0501037_0103455 | 3300049573 | Bacteria | 2054 |
| 225 | Ga0501038_0008790 | 3300049574 | Bacteria | 9263 |
| 226 | Ga0501038_0106991 | 3300049574 | Bacteria | 2320 |
| 227 | Ga0501039_0008389 | 3300049575 | Bacteria | 7874 |
| 228 | Ga0501039_0008664 | 3300049575 | Bacteria | 7749 |
| 229 | Ga0501040_0132574 | 3300049576 | Bacteria | 1753 |
| 230 | Ga0501042_0035689 | 3300049578 | Bacteria | 3527 |
| 231 | Ga0501043_0005323 | 3300049579 | Bacteria | 10403 |
| 232 | Ga0501043_0018427 | 3300049579 | Bacteria | 5475 |
| 233 | Ga0501043_0031966 | 3300049579 | Bacteria | 4136 |
| 234 | Ga0501046_0013437 | 3300049580 | Bacteria | 6931 |
| 235 | Ga0501046_0024680 | 3300049580 | Bacteria | 4927 |
| 236 | Ga0501046_0080898 | 3300049580 | Bacteria | 2509 |
| 237 | Ga0501047_0018634 | 3300049581 | Bacteria | 6656 |
| 238 | Ga0501047_0024170 | 3300049581 | Bacteria | 5835 |
| 239 | Ga0501047_0048978 | 3300049581 | Bacteria | 4080 |
| 240 | Ga0501047_0145913 | 3300049581 | Bacteria | 2243 |
| 241 | Ga0501048_0004091 | 3300049582 | Bacteria | 11106 |
| 242 | Ga0501069_0005312 | 3300049585 | Bacteria | 6692 |
| 243 | Ga0501070_0000044 | 3300049586 | Bacteria | 108859 |
| 244 | Ga0501070_0000988 | 3300049586 | Bacteria | 25553 |
| 245 | Ga0501070_0007445 | 3300049586 | Bacteria | 9301 |
| 246 | Ga0501071_0000167 | 3300049587 | Bacteria | 28392 |
| 247 | Ga0501073_0000475 | 3300049589 | Bacteria | 27774 |
| 248 | Ga0501080_0000057 | 3300049742 | Bacteria | 72729 |
| 249 | Ga0501083_0000072 | 3300049744 | Bacteria | 66576 |
| 250 | Ga0501083_0008866 | 3300049744 | Bacteria | 7103 |
| 251 | Ga0501035_0014817 | 3300049822 | Bacteria | 7198 |
| 252 | Ga0501035_0039587 | 3300049822 | Bacteria | 4264 |
| 253 | Ga0501035_0128604 | 3300049822 | Bacteria | 2209 |
| 254 | Ga0501035_0130662 | 3300049822 | Bacteria | 2189 |
| 255 | Ga0501044_0012527 | 3300049823 | Bacteria | 9185 |
| 256 | Ga0501044_0016409 | 3300049823 | Bacteria | 7951 |
| 257 | Ga0501044_0018382 | 3300049823 | Bacteria | 7489 |
| 258 | Ga0501044_0090262 | 3300049823 | Bacteria | 3091 |
| 259 | Ga0501044_0205579 | 3300049823 | Bacteria | 1926 |
| 260 | nmdc:mga00v17_62277_c1 | 3300050491 | Bacteria | 2295 |
| 261 | nmdc:mga0yw44_14924_c1 | 3300050492 | Bacteria | 4144 |
| 262 | nmdc:mga0yw44_31565_c1 | 3300050492 | Bacteria | 3082 |
| 263 | nmdc:mga06z11_16867_c1 | 3300050494 | Bacteria | 3301 |
| 264 | nmdc:mga0sz30_12706_c2 | 3300050516 | Bacteria | 2958 |
| 265 | Ga0500635_0000004 | 3300053080 | Bacteria | 210675 |
| 266 | Ga0500635_0012561 | 3300053080 | Bacteria | 2436 |
| 267 | Ga0500643_000353 | 3300053087 | Bacteria | 36455 |
| 268 | Ga0500651_0000284 | 3300053093 | Bacteria | 29700 |
| 269 | Ga0500650_0000538 | 3300053098 | Bacteria | 9679 |
| 270 | Ga0500556_0000007 | 3300053104 | Bacteria | 331400 |
| 271 | Ga0500556_0000559 | 3300053104 | Bacteria | 24852 |
| 272 | Ga0500562_001194 | 3300053108 | Bacteria | 6401 |
| 273 | Ga0500593_002562 | 3300053117 | Bacteria | 6697 |
| 274 | Ga0500559_0000160 | 3300053136 | Bacteria | 53115 |
| 275 | Ga0500559_0000643 | 3300053136 | Bacteria | 23541 |
| 276 | Ga0500559_0002566 | 3300053136 | Bacteria | 9314 |
| 277 | Ga0500568_0000021 | 3300053139 | Bacteria | 185406 |
| 278 | Ga0500568_0000176 | 3300053139 | Bacteria | 55879 |
| 279 | Ga0500568_0011031 | 3300053139 | Bacteria | 4208 |
| 280 | Ga0500573_0000007 | 3300053140 | Bacteria | 272970 |
| 281 | Ga0500573_0007334 | 3300053140 | Bacteria | 6012 |
| 282 | Ga0500573_0009900 | 3300053140 | Bacteria | 5309 |
| 283 | Ga0500577_0002156 | 3300053142 | Bacteria | 5024 |
| 284 | Ga0500590_014218 | 3300053148 | Bacteria | 4099 |
| 285 | Ga0500604_0045401 | 3300053151 | Bacteria | 1341 |
| 286 | Ga0500616_0000021 | 3300053153 | Bacteria | 484527 |
| 287 | Ga0500616_0000394 | 3300053153 | Bacteria | 60261 |
| 288 | Ga0500620_000319 | 3300053155 | Bacteria | 9097 |
| 289 | Ga0501084_0016397 | 3300054114 | Bacteria | 6154 |
| 290 | Ga0587130_002907 | 3300059631 | Bacteria | 1417 |
| 291 | Ga0466962_0040784 | 3300061719 | Bacteria | 2221 |
| 292 | 2514587913 | 2513237351 | Bacteria | 6968952 |
| 293 | 2587864791 | 2585428094 | Bacteria | 3604039 |
| 294 | 2588106719 | 2585428157 | Bacteria | 3018951 |
| 295 | 2643734153 | 2643221542 | Bacteria | 3563959 |
| 296 | 2643754033 | 2643221546 | Bacteria | 2910897 |
| 297 | 2643769558 | 2643221549 | Bacteria | 4042819 |
| 298 | 2643785311 | 2643221553 | Bacteria | 3544260 |
| 299 | 2643849399 | 2643221566 | Bacteria | 3460379 |
| 300 | 2643874693 | 2643221572 | Bacteria | 3614809 |
| 301 | 2643888555 | 2643221575 | Bacteria | 4022601 |
| 302 | 2643996421 | 2643221597 | Bacteria | 3347721 |
| 303 | 2644095117 | 2643221616 | Bacteria | 4066575 |
| 304 | 2644114177 | 2643221619 | Bacteria | 4158469 |
| 305 | 2644170739 | 2643221630 | Bacteria | 3601215 |
| 306 | 2644180890 | 2643221632 | Bacteria | 3406696 |
| 307 | 2644198914 | 2643221635 | Bacteria | 2632343 |
| 308 | 2644277521 | 2643221649 | Bacteria | 3867359 |
| 309 | 2644381749 | 2643221669 | Bacteria | 3611286 |
| 310 | 2723642842 | 2721755702 | Bacteria | 4373124 |
| 311 | 2753302358 | 2751185788 | Bacteria | 4541048 |
| 312 | 2758224410 | 2757320536 | Bacteria | 3629334 |
| 313 | 2774378533 | 2773857758 | Bacteria | 3592392 |
| 314 | 2774383675 | 2773857759 | Bacteria | 2963774 |
| 315 | 2774400225 | 2773857763 | Bacteria | 4180068 |
| 316 | 2808631751 | 2808606306 | Bacteria | 3608896 |
| 317 | 2808885066 | 2808606368 | Bacteria | 3174172 |
| 318 | 2808902835 | 2808606372 | Bacteria | 4649509 |
| 319 | 2809226852 | 2808606447 | Bacteria | 3572005 |
| 320 | 2812322465 | 2811994872 | Bacteria | 4121241 |
| 321 | 2821269389 | 2821268502 | Bacteria | 3750023 |
| 322 | 2833710294 | 2833709550 | Bacteria | 4008291 |
| 323 | 2844841594 | 2844841374 | Bacteria | 3917147 |
| 324 | 2844855741 | 2844852863 | Bacteria | 3849151 |
| 325 | 2852633072 | 2852632344 | Bacteria | 3463163 |
| 326 | 2852645020 | 2852643534 | Bacteria | 3013378 |
| 327 | 2852664734 | 2852663356 | Bacteria | 4090475 |
| 328 | 2852679045 | 2852677369 | Bacteria | 3768884 |
| 329 | 2857721063 | 2857720070 | Bacteria | 3189373 |
| 330 | 2857723350 | 2857723135 | Bacteria | 4217853 |
| 331 | 2857732276 | 2857729791 | Bacteria | 4040535 |
| 332 | 2857736784 | 2857733635 | Bacteria | 3532004 |
| 333 | 2857740000 | 2857737099 | Bacteria | 3104305 |
| 334 | 2862993334 | 2862993130 | Bacteria | 3860849 |
| 335 | 2862995436 | 2862993130 | Bacteria | 3860849 |
| 336 | 2870622952 | 2870622029 | Bacteria | 3643329 |
| 337 | 2870629755 | 2870628048 | Bacteria | 3696012 |
| 338 | 2881850302 | 2881845957 | Bacteria | 6611900 |
| 339 | 2884764517 | 2884763398 | Bacteria | 4091164 |
| 340 | 2895662935 | 2895660088 | Bacteria | 3782833 |
| 341 | 2897563095 | 2897561785 | Bacteria | 3256946 |
| 342 | 2904432829 | 2904430863 | Bacteria | 3486923 |
| 343 | 2904503281 | 2904501621 | Bacteria | 3401437 |
| 344 | 2904510032 | 2904509784 | Bacteria | 3520416 |
| 345 | 2906800809 | 2906799679 | Bacteria | 4031749 |
| 346 | 2908675542 | 2908674828 | Bacteria | 3382763 |
| 347 | 2908678755 | 2908678064 | Bacteria | 3482747 |
| 348 | 2909074598 | 2909074476 | Bacteria | 3436050 |
| 349 | 2919040946 | 2919039151 | Bacteria | 3391018 |
| 350 | 2919045516 | 2919042368 | Bacteria | 3905917 |
| 351 | 2919057250 | 2919055335 | Bacteria | 3875751 |
| 352 | 2919071107 | 2919069694 | Bacteria | 3622919 |
| 353 | 2919443410 | 2919443155 | Bacteria | 4072969 |
| 354 | 2919523602 | 2919523602 | Bacteria | 3788128 |
| 355 | 2928091215 | 2928090899 | Bacteria | 3158267 |
| 356 | 2928105301 | 2928104781 | Bacteria | 3877447 |
| 357 | 2928124832 | 2928121344 | Bacteria | 3972376 |
| 358 | 2928155028 | 2928153084 | Bacteria | 4020257 |
| 359 | 2928500526 | 2928500415 | Bacteria | 3384541 |
| 360 | 2935412986 | 2935409751 | Bacteria | 4179611 |
| 361 | 2939657359 | 2939657138 | Bacteria | 3740283 |
| 362 | 2939664133 | 2939660829 | Bacteria | 3784848 |
| 363 | 2946043685 | 2946041624 | Bacteria | 4191385 |
| 364 | 2946081399 | 2946080515 | Bacteria | 4310960 |
| 365 | 2966921803 | 2966921586 | Bacteria | 3092803 |
| 366 | 2966925186 | 2966924647 | Bacteria | 3268643 |
| 367 | 2974298031 | 2974294766 | Bacteria | 3767688 |
| 368 | 2974325731 | 2974324384 | Bacteria | 3750535 |
| 369 | 2977230650 | 2977228692 | Bacteria | 3450105 |
| 370 | 2977251811 | 2977251589 | Bacteria | 2952848 |
| 371 | 2977265917 | 2977264416 | Bacteria | 3750737 |
| 372 | 2984542766 | 2984542743 | Bacteria | 3569378 |
| 373 | 2984554507 | 2984551494 | Bacteria | 3877562 |
| 374 | 2984582034 | 2984580707 | Bacteria | 3351387 |
| 375 | 2995728500 | 2995726249 | Bacteria | 3470435 |
| 376 | 8004185605 | 8004182704 | Bacteria | 3391155 |
| 377 | 8004214645 | 8004212874 | Bacteria | 2861420 |
| 378 | 8016254685 | 8016254467 | Bacteria | 3797036 |
| 379 | 8045832696 | 8045830549 | Bacteria | 4444727 |
| 380 | 8046355820 | 8046352972 | Bacteria | 3613806 |
| 381 | 8055035413 | 8055034563 | Bacteria | 3562128 |
| 382 | 8055038915 | 8055037949 | Bacteria | 3337834 |
| 383 | 8057348498 | 8057345674 | Bacteria | 4160394 |
| 384 | Ga0466970_0022530 | |||
| 385 | JGI24740J21852_10008539 | |||
| 386 | JGI24740J21852_10038983 | |||
| 387 | JGI24739J22299_10028715 | |||
| 388 | JGI24735J21928_10001102 | |||
| 389 | JGI25154J39366_1001611 | |||
| 390 | JGI25164J39214_1000917 | |||
| 391 | JGI25165J46597_1000044 | |||
| 392 | Ga0006562J51391_1014374 | |||
| 393 | Ga0006562J51391_1014378 | |||
| 394 | Ga0006562J51391_1062142 | |||
| 395 | Ga0055539_1000027 | |||
| 396 | Ga0055533_1000020 | |||
| 397 | Ga0055525_1000296 | |||
| 398 | Ga0055527_1000005 | |||
| 399 | Ga0055542_1000006 | |||
| 400 | Ga0055542_1006227 | |||
| 401 | Ga0055529_1000013 | |||
| 402 | Ga0055541_1002903 | |||
| 403 | Ga0065704_10101798 | |||
| 404 | Ga0065707_10082265 | |||
| 405 | Ga0070658_10000162 | |||
| 406 | Ga0070658_10006377 | |||
| 407 | Ga0070658_10007450 | |||
| 408 | Ga0068868_100005298 | |||
| 409 | Ga0070661_100031249 | |||
| 410 | Ga0070659_100103983 | |||
| 411 | Ga0070710_10097210 | |||
| 412 | Ga0068853_100009060 | |||
| 413 | Ga0068855_100025463 | |||
| 414 | Ga0068856_100129458 | |||
| 415 | Ga0068852_100053338 | |||
| 416 | Ga0068861_100017878 | |||
| 417 | Ga0068851_10000005 | |||
| 418 | Ga0068870_10053053 | |||
| 419 | Ga0068858_100002205 | |||
| 420 | Ga0081539_10002454 | |||
| 421 | Ga0075364_10005508 | |||
| 422 | Ga0075364_10052925 | |||
| 423 | Ga0075367_10016535 | |||
| 424 | Ga0105244_10077165 | |||
| 425 | Ga0105247_10047988 | |||
| 426 | Ga0105248_10063864 | |||
| 427 | Ga0105237_10000464 | |||
| 428 | Ga0105238_10002588 | |||
| 429 | Ga0105246_10064854 | |||
| 430 | Ga0157371_10000414 | |||
| 431 | Ga0157370_10004830 | |||
| 432 | Ga0157369_10000103 | |||
| 433 | Ga0157369_10059386 | |||
| 434 | Ga0157369_10378979 | |||
| 435 | Ga0171462_1001 | |||
| 436 | Ga0157372_10088518 | |||
| 437 | Ga0157372_10263466 | |||
| 438 | Ga0163163_10049816 | |||
| 439 | Ga0157380_10000775 | |||
| 440 | Ga0157380_10090113 | |||
| 441 | Ga0197907_10701590 | |||
| 442 | Ga0206356_11230400 | |||
| 443 | Ga0206350_10286752 | |||
| 444 | Ga0206354_10116423 | |||
| 445 | Ga0206353_10360380 | |||
| 446 | Ga0206353_10373074 | |||
| 447 | Ga0209566_100043 | |||
| 448 | Ga0209674_100001 | |||
| 449 | Ga0209672_100003 | |||
| 450 | Ga0209563_100001 | |||
| 451 | Ga0207427_100126 | |||
| 452 | Ga0209437_101068 | |||
| 453 | Ga0209258_103042 | |||
| 454 | Ga0209646_1000134 | |||
| 455 | Ga0209677_100001 | |||
| 456 | Ga0209677_100508 | |||
| 457 | Ga0209148_1000004 | |||
| 458 | Ga0209148_1000401 | |||
| 459 | Ga0209233_1000014 | |||
| 460 | Ga0209455_1000046 | |||
| 461 | Ga0209455_1001325 | |||
| 462 | Ga0207656_10000001 | |||
| 463 | Ga0207656_10000003 | |||
| 464 | Ga0207656_10000004 | |||
| 465 | Ga0207655_1011862 | |||
| 466 | Ga0207710_10021669 | |||
| 467 | Ga0207647_10071306 | |||
| 468 | Ga0207643_10067333 | |||
| 469 | Ga0207705_10000001 | |||
| 470 | Ga0207654_10000003 | |||
| 471 | Ga0207695_10022665 | |||
| 472 | Ga0207671_10000001 | |||
| 473 | Ga0207671_10029137 | |||
| 474 | Ga0207657_10006049 | |||
| 475 | Ga0207694_10000066 | |||
| 476 | Ga0207687_10004508 | |||
| 477 | Ga0207664_10086681 | |||
| 478 | Ga0207690_10001774 | |||
| 479 | Ga0207711_10001250 | |||
| 480 | Ga0207667_10106058 | |||
| 481 | Ga0207668_10057749 | |||
| 482 | Ga0207677_10004525 | |||
| 483 | Ga0207703_10000026 | |||
| 484 | Ga0207702_10047397 | |||
| 485 | Ga0207674_10012612 | |||
| 486 | Ga0207675_100039976 | |||
| 487 | Ga0207698_10000243 | |||
| 488 | Ga0307515_10230963 | |||
| 489 | Ga0265330_10000700 | |||
| 490 | Ga0307514_10013492 | |||
| 491 | Ga0307406_10000025 | |||
| 492 | Ga0307406_10024858 | |||
| 493 | Ga0307406_10092354 | |||
| 494 | Ga0307407_10073725 | |||
| 495 | Ga0395899_0009371 | |||
| 496 | Ga0395900_0008066 | |||
| 497 | Ga0395900_0077091 | |||
| 498 | Ga0395900_0192260 | |||
| 499 | Ga0395898_0000098 | |||
| 500 | Ga0451793_0150338 | |||
| 501 | Ga0466972_0039843 | |||
| 502 | Ga0466966_0088702 | |||
| 503 | Ga0466961_0032783 | |||
| 504 | Ga0466961_0094832 | |||
| 505 | Ga0453684_0007131 | |||
| 506 | Ga0466970_0002080 | |||
| 507 | Ga0466970_0005428 | |||
| 508 | Ga0466970_0021018 | |||
| 509 | Ga0466970_0037115 | |||
| 510 | Ga0466960_0032879 | |||
| 511 | Ga0466959_0033760 | |||
| 512 | Ga0466958_0118293 | |||
| 513 | Ga0495627_000588 | |||
| 514 | Ga0495590_0000357 | |||
| 515 | Ga0495638_0000663 | |||
| 516 | Ga0495650_0000757 | |||
| 517 | Ga0495632_0007148 | |||
| 518 | Ga0495656_0025237 | |||
| 519 | Ga0496101_0013044 | |||
| 520 | Ga0496103_0017299 | |||
| 521 | Ga0496104_0074147 | |||
| 522 | Ga0496106_0094910 | |||
| 523 | Ga0496111_0025658 | |||
| 524 | Ga0496112_0183487 | |||
| 525 | Ga0496114_0020064 | |||
| 526 | Ga0496114_0030499 | |||
| 527 | Ga0496114_0162631 | |||
| 528 | Ga0496115_0015465 | |||
| 529 | Ga0496115_0025165 | |||
| 530 | Ga0496115_0114710 | |||
| 531 | Ga0496117_0000028 | |||
| 532 | Ga0496117_0000214 | |||
| 533 | Ga0496117_0001188 | |||
| 534 | Ga0496117_0001743 | |||
| 535 | Ga0496117_0005043 | |||
| 536 | Ga0496117_0023470 | |||
| 537 | Ga0496117_0025667 | |||
| 538 | Ga0496117_0034331 | |||
| 539 | Ga0496118_0001331 | |||
| 540 | Ga0496118_0003500 | |||
| 541 | Ga0496118_0017609 | |||
| 542 | Ga0496118_0058635 | |||
| 543 | Ga0496118_0063654 | |||
| 544 | Ga0496118_0067765 | |||
| 545 | Ga0496119_0001492 | |||
| 546 | Ga0496119_0002724 | |||
| 547 | Ga0496119_0003102 | |||
| 548 | Ga0496119_0004343 | |||
| 549 | Ga0496119_0008297 | |||
| 550 | Ga0496119_0023350 | |||
| 551 | Ga0496119_0034446 | |||
| 552 | Ga0496119_0056132 | |||
| 553 | Ga0496120_0000617 | |||
| 554 | Ga0496120_0001254 | |||
| 555 | Ga0496120_0001547 | |||
| 556 | Ga0496120_0020128 | |||
| 557 | Ga0496120_0023692 | |||
| 558 | Ga0496120_0024775 | |||
| 559 | Ga0496120_0045290 | |||
| 560 | Ga0496120_0071941 | |||
| 561 | Ga0496121_0000289 | |||
| 562 | Ga0496121_0092724 | |||
| 563 | Ga0496121_0124534 | |||
| 564 | Ga0496121_0128079 | |||
| 565 | Ga0496122_0000055 | |||
| 566 | Ga0496122_0000948 | |||
| 567 | Ga0496122_0002343 | |||
| 568 | Ga0496122_0006061 | |||
| 569 | Ga0496122_0023088 | |||
| 570 | Ga0496123_0000003 | |||
| 571 | Ga0496123_0000169 | |||
| 572 | Ga0496123_0002276 | |||
| 573 | Ga0496123_0008632 | |||
| 574 | Ga0496123_0029043 | |||
| 575 | Ga0496124_0000037 | |||
| 576 | Ga0496124_0001959 | |||
| 577 | Ga0496124_0008428 | |||
| 578 | Ga0496124_0041396 | |||
| 579 | Ga0496124_0162726 | |||
| 580 | Ga0496125_0000120 | |||
| 581 | Ga0496125_0004022 | |||
| 582 | Ga0496125_0010333 | |||
| 583 | Ga0496125_0015877 | |||
| 584 | Ga0496125_0022500 | |||
| 585 | Ga0496126_0004638 | |||
| 586 | Ga0496126_0031721 | |||
| 587 | Ga0496126_0048198 | |||
| 588 | Ga0496126_0098425 | |||
| 589 | Ga0496126_0134147 | |||
| 590 | Ga0501031_0007200 | |||
| 591 | Ga0501031_0027101 | |||
| 592 | Ga0501032_0014700 | |||
| 593 | Ga0501032_0022382 | |||
| 594 | Ga0501033_0016961 | |||
| 595 | Ga0501033_0100687 | |||
| 596 | Ga0501034_0000909 | |||
| 597 | Ga0501034_0009277 | |||
| 598 | Ga0501034_0018615 | |||
| 599 | Ga0501034_0034722 | |||
| 600 | Ga0501034_0048540 | |||
| 601 | Ga0501034_0060089 | |||
| 602 | Ga0501034_0158687 | |||
| 603 | Ga0501036_0007703 | |||
| 604 | Ga0501036_0022552 | |||
| 605 | Ga0501037_0007987 | |||
| 606 | Ga0501037_0019735 | |||
| 607 | Ga0501037_0103455 | |||
| 608 | Ga0501038_0008790 | |||
| 609 | Ga0501038_0106991 | |||
| 610 | Ga0501039_0008389 | |||
| 611 | Ga0501039_0008664 | |||
| 612 | Ga0501040_0132574 | |||
| 613 | Ga0501042_0035689 | |||
| 614 | Ga0501043_0005323 | |||
| 615 | Ga0501043_0018427 | |||
| 616 | Ga0501043_0031966 | |||
| 617 | Ga0501046_0013437 | |||
| 618 | Ga0501046_0024680 | |||
| 619 | Ga0501046_0080898 | |||
| 620 | Ga0501047_0018634 | |||
| 621 | Ga0501047_0024170 | |||
| 622 | Ga0501047_0048978 | |||
| 623 | Ga0501047_0145913 | |||
| 624 | Ga0501048_0004091 | |||
| 625 | Ga0501069_0005312 | |||
| 626 | Ga0501070_0000044 | |||
| 627 | Ga0501070_0000988 | |||
| 628 | Ga0501070_0007445 | |||
| 629 | Ga0501071_0000167 | |||
| 630 | Ga0501073_0000475 | |||
| 631 | Ga0501080_0000057 | |||
| 632 | Ga0501083_0000072 | |||
| 633 | Ga0501083_0008866 | |||
| 634 | Ga0501035_0014817 | |||
| 635 | Ga0501035_0039587 | |||
| 636 | Ga0501035_0128604 | |||
| 637 | Ga0501035_0130662 | |||
| 638 | Ga0501044_0012527 | |||
| 639 | Ga0501044_0016409 | |||
| 640 | Ga0501044_0018382 | |||
| 641 | Ga0501044_0090262 | |||
| 642 | Ga0501044_0205579 | |||
| 643 | nmdc:mga00v17_62277_c1 | |||
| 644 | nmdc:mga0yw44_14924_c1 | |||
| 645 | nmdc:mga0yw44_31565_c1 | |||
| 646 | nmdc:mga06z11_16867_c1 | |||
| 647 | nmdc:mga0sz30_12706_c2 | |||
| 648 | Ga0500635_0000004 | |||
| 649 | Ga0500635_0012561 | |||
| 650 | Ga0500643_000353 | |||
| 651 | Ga0500651_0000284 | |||
| 652 | Ga0500650_0000538 | |||
| 653 | Ga0500556_0000007 | |||
| 654 | Ga0500556_0000559 | |||
| 655 | Ga0500562_001194 | |||
| 656 | Ga0500593_002562 | |||
| 657 | Ga0500559_0000160 | |||
| 658 | Ga0500559_0000643 | |||
| 659 | Ga0500559_0002566 | |||
| 660 | Ga0500568_0000021 | |||
| 661 | Ga0500568_0000176 | |||
| 662 | Ga0500568_0011031 | |||
| 663 | Ga0500573_0000007 | |||
| 664 | Ga0500573_0007334 | |||
| 665 | Ga0500573_0009900 | |||
| 666 | Ga0500577_0002156 | |||
| 667 | Ga0500590_014218 | |||
| 668 | Ga0500604_0045401 | |||
| 669 | Ga0500616_0000021 | |||
| 670 | Ga0500616_0000394 | |||
| 671 | Ga0500620_000319 | |||
| 672 | Ga0501084_0016397 | |||
| 673 | Ga0587130_002907 | |||
| 674 | Ga0466962_0040784 | |||
| 675 | 2514587913 | |||
| 676 | 2587864791 | |||
| 677 | 2588106719 | |||
| 678 | 2643734153 | |||
| 679 | 2643754033 | |||
| 680 | 2643769558 | |||
| 681 | 2643785311 | |||
| 682 | 2643849399 | |||
| 683 | 2643874693 | |||
| 684 | 2643888555 | |||
| 685 | 2643996421 | |||
| 686 | 2644095117 | |||
| 687 | 2644114177 | |||
| 688 | 2644170739 | |||
| 689 | 2644180890 | |||
| 690 | 2644198914 | |||
| 691 | 2644277521 | |||
| 692 | 2644381749 | |||
| 693 | 2723642842 | |||
| 694 | 2753302358 | |||
| 695 | 2758224410 | |||
| 696 | 2774378533 | |||
| 697 | 2774383675 | |||
| 698 | 2774400225 | |||
| 699 | 2808631751 | |||
| 700 | 2808885066 | |||
| 701 | 2808902835 | |||
| 702 | 2809226852 | |||
| 703 | 2812322465 | |||
| 704 | 2821269389 | |||
| 705 | 2833710294 | |||
| 706 | 2844841594 | |||
| 707 | 2844855741 | |||
| 708 | 2852633072 | |||
| 709 | 2852645020 | |||
| 710 | 2852664734 | |||
| 711 | 2852679045 | |||
| 712 | 2857721063 | |||
| 713 | 2857723350 | |||
| 714 | 2857732276 | |||
| 715 | 2857736784 | |||
| 716 | 2857740000 | |||
| 717 | 2862993334 | |||
| 718 | 2862995436 | |||
| 719 | 2870622952 | |||
| 720 | 2870629755 | |||
| 721 | 2881850302 | |||
| 722 | 2884764517 | |||
| 723 | 2895662935 | |||
| 724 | 2897563095 | |||
| 725 | 2904432829 | |||
| 726 | 2904503281 | |||
| 727 | 2904510032 | |||
| 728 | 2906800809 | |||
| 729 | 2908675542 | |||
| 730 | 2908678755 | |||
| 731 | 2909074598 | |||
| 732 | 2919040946 | |||
| 733 | 2919045516 | |||
| 734 | 2919057250 | |||
| 735 | 2919071107 | |||
| 736 | 2919443410 | |||
| 737 | 2919523602 | |||
| 738 | 2928091215 | |||
| 739 | 2928105301 | |||
| 740 | 2928124832 | |||
| 741 | 2928155028 | |||
| 742 | 2928500526 | |||
| 743 | 2935412986 | |||
| 744 | 2939657359 | |||
| 745 | 2939664133 | |||
| 746 | 2946043685 | |||
| 747 | 2946081399 | |||
| 748 | 2966921803 | |||
| 749 | 2966925186 | |||
| 750 | 2974298031 | |||
| 751 | 2974325731 | |||
| 752 | 2977230650 | |||
| 753 | 2977251811 | |||
| 754 | 2977265917 | |||
| 755 | 2984542766 | |||
| 756 | 2984554507 | |||
| 757 | 2984582034 | |||
| 758 | 2995728500 | |||
| 759 | 8004185605 | |||
| 760 | 8004214645 | |||
| 761 | 8016254685 | |||
| 762 | 8045832696 | |||
| 763 | 8046355820 | |||
| 764 | 8055035413 | |||
| 765 | 8055038915 | |||
| 766 | 8057348498 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kam-assembly2.cif.gz_A | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9794 | 6 | 433 |
| 4kam-assembly3.cif.gz_C | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9763 | 6 | 433 |
| 4kam-assembly2.cif.gz_B | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9759 | 6 | 433 |
| 8eqw-assembly2.cif.gz_B | crystal structure of fub7 | 0.9717 | 8 | 431 |
| 4kam-assembly3.cif.gz_D | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9717 | 6 | 427 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kamA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9821 | 68 | 295 | 3.40.640.10 |
| 4kamB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9771 | 298 | 433 | 3.90.1150.10 |
| af_O53390_302_449_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9746 | 298 | 435 | 3.90.1150.10 |
| af_O13326_295_429_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9733 | 298 | 429 | 3.90.1150.10 |
| af_P32929_263_402_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9731 | 297 | 431 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N6VIN7-F1-model_v4 | O-acetylhomoserine aminocarboxypropyltransferase (EC 2.5.1.49) | 0.9883 | 57 | 169 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-T0V080-F1-model_v4 | O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) | 0.988 | 83 | 308 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A7J5Q3C0-F1-model_v4 | O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase | 0.9859 | 36 | 402 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A3D4TPV9-F1-model_v4 | Bifunctional O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (EC 2.5.1.49) | 0.9859 | 87 | 255 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-R7HSQ6-F1-model_v4 | O-acetylhomoserine sulfhydrolase | 0.9846 | 176 | 430 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0016787 GO:0019346 GO:0030170 GO:0071269 |