F429735

General Info

Members Datasets Scaffolds Average Seq Length
383 239 767 112

Family's Representative Sequence

Representative Sequence 3300049665|Ga0501227_068272|Ga0501227_068272_145_531
Length 128
Sequence LRYHFVHQSIIEFNRLMDTKDIIAALAALAQESRLSTFRLLVQTGPQGLAASKIAEHLDVAPSSLSFHLKELSHAGLVTSRQEGRFVIYSANFETMNDVLTYLTDNCCGGASCAPVSVTTCRPGKATA

Samples

Sample ID Description Type Environment
1 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
230 2643221664 Massilia sp. Root418 Isolate Unclassified
231 2738541280 Massilia sp. GV090 Isolate Unclassified
232 2738541300 Massilia sp. GV016 Isolate Unclassified
233 2738543018 Massilia sp. GV045 Isolate Unclassified
234 2738543030 Massilia sp. GV097 Isolate Unclassified
235 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
236 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
237 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
238 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
239 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0
Isolates 2.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 2.61
Rhizosphere 86.95
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501227_068272 3300049665 Bacteria 920
2 rootH2_10001635 3300003320 Bacteria 9063
3 rootL2_10352076 3300003322 Bacteria 2633
4 rootH1_10014821 3300003316 Bacteria 1039
5 rootH1_10014821 3300003323 Bacteria 3268
6 rootH1_10160732 3300003323 Bacteria 6407
7 Ga0055526_1000305 3300003771 Bacteria 41039
8 Ga0055526_1085098 3300003771 Unclassified 608
9 Ga0070683_100047519 3300005329 Bacteria 3966
10 Ga0070680_100362781 3300005336 Bacteria 1232
11 Ga0070682_101311600 3300005337 Bacteria 615
12 Ga0070660_100395537 3300005339 Bacteria 1142
13 Ga0070691_10168000 3300005341 Bacteria 1135
14 Ga0070687_100179499 3300005343 Bacteria 1267
15 Ga0070668_100562303 3300005347 Bacteria 994
16 Ga0070667_100306473 3300005367 Bacteria 1431
17 Ga0070714_100500509 3300005435 Bacteria 1159
18 Ga0070713_101896299 3300005436 Bacteria 578
19 Ga0070701_10265870 3300005438 Bacteria 1041
20 Ga0070681_10144581 3300005458 Bacteria 2308
21 Ga0068867_101305102 3300005459 Bacteria 670
22 Ga0070684_100088075 3300005535 Bacteria 2758
23 Ga0068853_100121743 3300005539 Bacteria 2328
24 Ga0070686_101329587 3300005544 Bacteria 601
25 Ga0070665_100042984 3300005548 Bacteria 4543
26 Ga0070704_100095347 3300005549 Bacteria 2228
27 Ga0068855_100017046 3300005563 Bacteria 8738
28 Ga0070664_100021670 3300005564 Bacteria 5298
29 Ga0068857_100069072 3300005577 Bacteria 3146
30 Ga0068856_102365930 3300005614 Bacteria 539
31 Ga0068859_100031814 3300005617 Bacteria 5300
32 Ga0068859_100133085 3300005617 Bacteria 2559
33 Ga0068859_102066585 3300005617 Bacteria 629
34 Ga0068861_100412051 3300005719 Bacteria 1202
35 Ga0068851_10004481 3300005834 Bacteria 6302
36 Ga0068863_100088550 3300005841 Bacteria 2934
37 Ga0068858_100217532 3300005842 Bacteria 1809
38 Ga0068858_100828336 3300005842 Bacteria 903
39 Ga0068860_100018056 3300005843 Bacteria 6868
40 Ga0068860_100763134 3300005843 Bacteria 979
41 Ga0068860_101813035 3300005843 Bacteria 632
42 Ga0075363_100135976 3300006048 Bacteria 1381
43 Ga0075364_10026619 3300006051 Bacteria 3690
44 Ga0075362_10268714 3300006177 Bacteria 842
45 Ga0075367_10060855 3300006178 Bacteria 2252
46 Ga0075369_10030753 3300006186 Bacteria 2263
47 Ga0075366_10019088 3300006195 Bacteria 3962
48 Ga0097621_100394646 3300006237 Bacteria 1238
49 Ga0075370_10134931 3300006353 Bacteria 1441
50 Ga0075434_101282293 3300006871 Bacteria 744
51 Ga0075436_100071336 3300006914 Bacteria 2402
52 Ga0097620_100031809 3300006931 Bacteria 5300
53 Ga0097620_100133092 3300006931 Bacteria 2559
54 Ga0097620_102066334 3300006931 Bacteria 629
55 Ga0075435_100356210 3300007076 Bacteria 1255
56 Ga0105240_10032843 3300009093 Bacteria 6713
57 Ga0105240_10234037 3300009093 Bacteria 2133
58 Ga0105241_10011804 3300009174 Bacteria 6416
59 Ga0105242_11033501 3300009176 Bacteria 831
60 Ga0105237_10131656 3300009545 Bacteria 2496
61 Ga0105238_10002091 3300009551 Bacteria 20161
62 Ga0105239_10004510 3300010375 Bacteria 16609
63 Ga0105239_10976755 3300010375 Bacteria 973
64 Ga0157369_10214338 3300013105 Bacteria 2017
65 Ga0157372_10226155 3300013307 Bacteria 2169
66 Ga0157375_10364277 3300013308 Bacteria 1612
67 Ga0157376_12025219 3300014969 Bacteria 614
68 Ga0182006_1000882 3300015261 Bacteria 20154
69 Ga0163161_10527321 3300017792 Bacteria 965
70 Ga0213872_10020965 3300021361 Bacteria 3010
71 Ga0213872_10065051 3300021361 Bacteria 1646
72 Ga0213872_10211115 3300021361 Unclassified 829
73 Ga0209565_1002643 3300025263 Bacteria 6308
74 Ga0209564_1006716 3300025295 Bacteria 6114
75 Ga0207656_10092089 3300025321 Bacteria 1377
76 Ga0207654_10024755 3300025911 Bacteria 3231
77 Ga0207695_10002944 3300025913 Bacteria 24567
78 Ga0207695_10365976 3300025913 Bacteria 1328
79 Ga0207695_10719382 3300025913 Bacteria 879
80 Ga0207671_10004876 3300025914 Bacteria 12613
81 Ga0207671_10329506 3300025914 Bacteria 1209
82 Ga0207660_10664922 3300025917 Bacteria 849
83 Ga0207662_10133198 3300025918 Bacteria 1569
84 Ga0207657_10298889 3300025919 Bacteria 1275
85 Ga0207694_10000587 3300025924 Bacteria 32890
86 Ga0207694_10316016 3300025924 Bacteria 1288
87 Ga0207650_10560580 3300025925 Bacteria 958
88 Ga0207709_10829785 3300025935 Bacteria 748
89 Ga0207661_10266665 3300025944 Bacteria 1527
90 Ga0207679_10332460 3300025945 Bacteria 1319
91 Ga0207667_10048668 3300025949 Bacteria 4482
92 Ga0207668_10535991 3300025972 Bacteria 1012
93 Ga0207640_10116870 3300025981 Bacteria 1902
94 Ga0207658_10836323 3300025986 Bacteria 837
95 Ga0207703_10014574 3300026035 Bacteria 6134
96 Ga0207639_10165181 3300026041 Bacteria 1869
97 Ga0207639_10552647 3300026041 Bacteria 1057
98 Ga0207641_10137456 3300026088 Bacteria 2201
99 Ga0207674_10090930 3300026116 Bacteria 3043
100 Ga0207674_10961185 3300026116 Bacteria 823
101 Ga0207675_100931443 3300026118 Bacteria 886
102 Ga0209813_10135879 3300027866 Bacteria 869
103 Ga0268264_10044887 3300028381 Bacteria 3668
104 Ga0268264_10942948 3300028381 Bacteria 868
105 Ga0268264_12149448 3300028381 Bacteria 566
106 Ga0307515_10263676 3300028794 Bacteria 1455
107 Ga0265327_10001699 3300031251 Bacteria 26311
108 Ga0265316_10002392 3300031344 Bacteria 19536
109 Ga0307408_100089386 3300031548 Bacteria 2322
110 Ga0316579_10000081 3300031691 Bacteria 24570
111 Ga0307416_100572015 3300032002 Bacteria 1206
112 Ga0307414_10916890 3300032004 Bacteria 804
113 Ga0316583_10004124 3300032133 Bacteria 5167
114 Ga0316583_10005320 3300032133 Bacteria 4617
115 Ga0316574_0280887 3300035398 Unclassified 1060
116 Ga0316582_0025931 3300036647 Bacteria 3524
117 Ga0373925_0118693 3300037068 Bacteria 2051
118 Ga0395899_0001384 3300037312 Bacteria 20803
119 Ga0395905_0092175 3300037471 Bacteria 2841
120 Ga0436361_0529390 3300039447 Bacteria 14686
121 Ga0436361_0609171 3300039447 Bacteria 3075
122 Ga0436361_0633145 3300039447 Unclassified 1932
123 Ga0436361_0814946 3300039447 Bacteria 9965
124 Ga0451577_0466229 3300042876 Bacteria 1147
125 Ga0466961_0028416 3300044693 Bacteria 3596
126 Ga0451576_0632185 3300045051 Bacteria 1125
127 Ga0495617_002083 3300046452 Bacteria 8285
128 Ga0495617_060478 3300046452 Bacteria 1253
129 Ga0495592_0082332 3300046454 Bacteria 2326
130 Ga0495592_0384845 3300046454 Bacteria 892
131 Ga0495603_0011201 3300046455 Bacteria 5434
132 Ga0495603_0020650 3300046455 Bacteria 3990
133 Ga0495591_050773 3300046458 Bacteria 1134
134 Ga0495629_0002005 3300046459 Bacteria 15820
135 Ga0495629_0014028 3300046459 Bacteria 5774
136 Ga0495629_0015571 3300046459 Bacteria 5459
137 Ga0495638_0016030 3300046460 Bacteria 5022
138 Ga0495638_0316224 3300046460 Bacteria 836
139 Ga0495638_0592725 3300046460 Bacteria 545
140 Ga0495641_0006856 3300046461 Bacteria 7283
141 Ga0495651_0833893 3300046462 Bacteria 567
142 Ga0495653_0012847 3300046463 Bacteria 6836
143 Ga0495653_0014743 3300046463 Bacteria 6374
144 Ga0495653_0216877 3300046463 Bacteria 1289
145 Ga0495650_0002170 3300046471 Bacteria 16595
146 Ga0495650_0004207 3300046471 Bacteria 9970
147 Ga0495580_0000069 3300046472 Bacteria 62719
148 Ga0495580_0000083 3300046472 Bacteria 60283
149 Ga0495580_0011619 3300046472 Bacteria 6811
150 Ga0495580_0352690 3300046472 Bacteria 996
151 Ga0495580_0430951 3300046472 Bacteria 886
152 Ga0495582_0001197 3300046473 Bacteria 14603
153 Ga0495582_0285199 3300046473 Bacteria 948
154 Ga0495582_0745071 3300046473 Bacteria 567
155 Ga0495605_0315761 3300046474 Bacteria 659
156 Ga0495639_0032499 3300046475 Bacteria 2327
157 Ga0495662_0020955 3300046476 Bacteria 3162
158 Ga0495662_0033678 3300046476 Bacteria 2475
159 Ga0495664_0000132 3300046477 Bacteria 37870
160 Ga0495664_0019479 3300046477 Bacteria 3901
161 Ga0495584_0000501 3300046491 Bacteria 26833
162 Ga0495584_0020062 3300046491 Bacteria 3395
163 Ga0495585_0010171 3300046492 Bacteria 5617
164 Ga0495585_0069934 3300046492 Bacteria 1915
165 Ga0495594_0212402 3300046499 Bacteria 1103
166 Ga0495594_0784059 3300046499 Bacteria 537
167 Ga0495596_0090984 3300046500 Bacteria 1184
168 Ga0495607_0016464 3300046501 Bacteria 4770
169 Ga0495607_0055101 3300046501 Bacteria 2288
170 Ga0495607_0063016 3300046501 Bacteria 2099
171 Ga0495607_0218890 3300046501 Bacteria 932
172 Ga0495583_0000185 3300046506 Bacteria 105958
173 Ga0495583_0278702 3300046506 Bacteria 667
174 Ga0495606_0005897 3300046507 Bacteria 11523
175 Ga0495606_0006450 3300046507 Bacteria 10818
176 Ga0495606_0011140 3300046507 Bacteria 7369
177 Ga0495606_0077505 3300046507 Bacteria 2075
178 Ga0495606_0267234 3300046507 Bacteria 941
179 Ga0495608_0149643 3300046511 Bacteria 1488
180 Ga0495610_0008180 3300046512 Bacteria 6817
181 Ga0495610_0056840 3300046512 Bacteria 1880
182 Ga0495610_0080683 3300046512 Bacteria 1495
183 Ga0495610_0329603 3300046512 Bacteria 580
184 Ga0495616_0024404 3300046513 Bacteria 3243
185 Ga0495616_0069790 3300046513 Bacteria 1702
186 Ga0495616_0112541 3300046513 Bacteria 1263
187 Ga0495616_0147716 3300046513 Bacteria 1065
188 Ga0495616_0414805 3300046513 Bacteria 551
189 Ga0495618_0010828 3300046514 Bacteria 5522
190 Ga0495628_0015147 3300046516 Bacteria 6441
191 Ga0495628_0028195 3300046516 Bacteria 4564
192 Ga0495630_0009300 3300046517 Bacteria 7066
193 Ga0495630_0046550 3300046517 Bacteria 3242
194 Ga0495630_0832387 3300046517 Bacteria 704
195 Ga0495644_0000163 3300046523 Bacteria 31558
196 Ga0495644_0000578 3300046523 Bacteria 15353
197 Ga0495644_0216883 3300046523 Bacteria 739
198 Ga0495648_0001891 3300046524 Bacteria 20009
199 Ga0495648_0007830 3300046524 Bacteria 8501
200 Ga0495648_0034626 3300046524 Bacteria 3284
201 Ga0495648_0243472 3300046524 Bacteria 872
202 Ga0495648_0489123 3300046524 Bacteria 530
203 Ga0495666_0008656 3300046526 Bacteria 5096
204 Ga0495666_0462832 3300046526 Bacteria 568
205 Ga0495642_0005477 3300046528 Bacteria 4875
206 Ga0495642_0051166 3300046528 Bacteria 1699
207 Ga0495652_0051494 3300046529 Bacteria 3516
208 Ga0495652_0509069 3300046529 Bacteria 833
209 Ga0495652_0753145 3300046529 Bacteria 652
210 Ga0495654_0014381 3300046530 Bacteria 4211
211 Ga0495654_0075050 3300046530 Bacteria 1596
212 Ga0495654_0146476 3300046530 Bacteria 1048
213 Ga0495665_0000238 3300046531 Bacteria 27643
214 Ga0495665_0011389 3300046531 Bacteria 4813
215 Ga0495665_0130291 3300046531 Bacteria 1316
216 Ga0495665_0559444 3300046531 Bacteria 573
217 Ga0495640_0009755 3300046533 Bacteria 7458
218 Ga0495586_0007344 3300046535 Bacteria 5880
219 Ga0495586_0324583 3300046535 Bacteria 883
220 Ga0495587_0006408 3300046536 Bacteria 7677
221 Ga0495609_0004671 3300046538 Bacteria 7424
222 Ga0495597_0005778 3300046542 Bacteria 6492
223 Ga0495597_0180808 3300046542 Bacteria 852
224 Ga0495645_0000648 3300046543 Bacteria 23976
225 Ga0495645_0011445 3300046543 Bacteria 6243
226 Ga0495633_0002048 3300046558 Bacteria 14532
227 Ga0495633_0019181 3300046558 Bacteria 3459
228 Ga0495633_0027384 3300046558 Bacteria 2787
229 Ga0495667_0344678 3300046559 Bacteria 941
230 Ga0495656_0032052 3300046615 Bacteria 2136
231 Ga0495656_0081083 3300046615 Bacteria 1464
232 Ga0495656_0147533 3300046615 Bacteria 1133
233 Ga0495668_0000101 3300046616 Bacteria 137289
234 Ga0495634_0003652 3300046642 Bacteria 12272
235 Ga0495634_0127625 3300046642 Bacteria 1624
236 Ga0495611_0016040 3300046648 Bacteria 3203
237 Ga0495611_0043722 3300046648 Bacteria 2003
238 Ga0495625_0001069 3300046660 Bacteria 35654
239 Ga0495625_0069820 3300046660 Bacteria 2467
240 Ga0495625_0069876 3300046660 Bacteria 2466
241 Ga0495635_0008465 3300046663 Bacteria 7185
242 Ga0495635_0008984 3300046663 Bacteria 6974
243 Ga0495659_0000074 3300046664 Bacteria 42753
244 Ga0495659_0001563 3300046664 Bacteria 7710
245 Ga0495661_0014180 3300046665 Bacteria 5339
246 Ga0495661_0059878 3300046665 Bacteria 2264
247 Ga0495661_0308741 3300046665 Bacteria 789
248 Ga0495588_0039520 3300046674 Bacteria 2404
249 Ga0495588_0045726 3300046674 Bacteria 2245
250 Ga0495599_0036292 3300046678 Bacteria 3095
251 Ga0495599_0176040 3300046678 Bacteria 1319
252 Ga0495623_0006312 3300046679 Bacteria 7707
253 Ga0495623_0102908 3300046679 Bacteria 1738
254 Ga0495646_0000864 3300046680 Bacteria 17168
255 Ga0495646_0006937 3300046680 Bacteria 7188
256 Ga0495669_0448113 3300046684 Bacteria 627
257 Ga0495669_0659491 3300046684 Bacteria 509
258 Ga0495613_0003379 3300046689 Bacteria 11927
259 Ga0495624_0002390 3300046690 Bacteria 14246
260 Ga0495624_0040753 3300046690 Bacteria 2973
261 Ga0495670_0032000 3300046691 Bacteria 2614
262 Ga0495671_0000493 3300046692 Bacteria 30406
263 Ga0495671_0053823 3300046692 Bacteria 1996
264 Ga0495671_0059139 3300046692 Bacteria 1895
265 Ga0495671_0090946 3300046692 Bacteria 1493
266 Ga0495649_0127768 3300046694 Bacteria 1342
267 Ga0495589_0137901 3300046794 Bacteria 1169
268 Ga0495589_0446071 3300046794 Bacteria 592
269 Ga0495589_0584158 3300046794 Bacteria 509
270 Ga0495660_0002079 3300046810 Bacteria 12978
271 Ga0495581_0010796 3300047315 Bacteria 5283
272 Ga0495581_0145267 3300047315 Bacteria 1384
273 Ga0495604_0015629 3300047317 Bacteria 6060
274 Ga0495604_0017207 3300047317 Bacteria 5784
275 Ga0495636_0000415 3300047318 Bacteria 15830
276 Ga0495674_0032570 3300047319 Bacteria 4727
277 Ga0495674_0053452 3300047319 Bacteria 3550
278 Ga0495674_0313555 3300047319 Bacteria 1279
279 Ga0495674_0340235 3300047319 Bacteria 1219
280 Ga0495672_0000026 3300047320 Bacteria 340319
281 Ga0495672_0041488 3300047320 Bacteria 2782
282 Ga0495672_0070937 3300047320 Bacteria 1972
283 Ga0495672_0106500 3300047320 Bacteria 1511
284 Ga0495676_0021067 3300047321 Bacteria 5705
285 Ga0495676_0801923 3300047321 Bacteria 606
286 Ga0495680_0000740 3300047322 Bacteria 36610
287 Ga0495680_0006326 3300047322 Bacteria 11022
288 Ga0495680_0246056 3300047322 Bacteria 1269
289 Ga0495683_0020554 3300047323 Bacteria 3404
290 Ga0495683_0082429 3300047323 Bacteria 1567
291 Ga0495683_0427799 3300047323 Bacteria 546
292 Ga0495683_0428013 3300047323 Bacteria 546
293 Ga0495687_010285 3300047443 Bacteria 5138
294 Ga0495675_0010485 3300047444 Bacteria 5792
295 Ga0495675_0090267 3300047444 Bacteria 1923
296 Ga0495675_0533082 3300047444 Bacteria 671
297 Ga0495677_0003811 3300047445 Bacteria 5832
298 Ga0495677_0005236 3300047445 Bacteria 4931
299 Ga0495677_0091992 3300047445 Bacteria 1143
300 Ga0495679_002284 3300047446 Bacteria 9891
301 Ga0495679_069983 3300047446 Bacteria 1012
302 Ga0495685_000036 3300047447 Bacteria 55288
303 Ga0495673_0000304 3300047469 Bacteria 65575
304 Ga0495673_0060031 3300047469 Bacteria 1632
305 Ga0495681_0177834 3300047470 Bacteria 876
306 Ga0495684_0016956 3300047471 Bacteria 5612
307 Ga0495686_0001489 3300047472 Bacteria 25384
308 Ga0495686_0025396 3300047472 Bacteria 3884
309 Ga0495686_0105086 3300047472 Bacteria 1699
310 Ga0495593_0000984 3300047673 Bacteria 16724
311 Ga0495593_0007578 3300047673 Bacteria 6339
312 Ga0495593_0052210 3300047673 Bacteria 2161
313 Ga0495602_0010204 3300048088 Bacteria 9747
314 Ga0495602_0027304 3300048088 Bacteria 5487
315 Ga0495614_0005702 3300048089 Bacteria 5612
316 Ga0495614_0660544 3300048089 Bacteria 504
317 Ga0495626_0002059 3300048091 Bacteria 14686
318 Ga0495626_0203486 3300048091 Bacteria 811
319 Ga0496100_0909423 3300048903 Bacteria 691
320 Ga0496101_0385156 3300048904 Bacteria 1103
321 Ga0496102_0569764 3300048905 Bacteria 1055
322 Ga0496104_0304435 3300048907 Bacteria 1506
323 Ga0496106_1320972 3300048909 Bacteria 559
324 Ga0496107_0272631 3300048910 Bacteria 1259
325 Ga0496108_1103521 3300048911 Bacteria 674
326 Ga0496110_0522086 3300048913 Bacteria 1080
327 Ga0496114_0049425 3300048917 Bacteria 3499
328 Ga0496115_0324261 3300048918 Bacteria 1259
329 Ga0496121_0372090 3300048924 Bacteria 945
330 Ga0496123_0336122 3300048926 Bacteria 707
331 Ga0496125_0208817 3300048928 Bacteria 1270
332 Ga0496126_0078414 3300048929 Bacteria 2927
333 Ga0496126_1196154 3300048929 Unclassified 559
334 Ga0495678_001775 3300049459 Bacteria 15966
335 Ga0495678_013722 3300049459 Bacteria 3793
336 Ga0495682_0000206 3300049460 Bacteria 47410
337 Ga0495682_0000271 3300049460 Bacteria 40623
338 Ga0495682_0000923 3300049460 Bacteria 17837
339 Ga0495682_0086321 3300049460 Bacteria 1127
340 Ga0501031_0011456 3300049568 Bacteria 5777
341 Ga0501032_0042141 3300049569 Bacteria 3098
342 Ga0501032_0988539 3300049569 Bacteria 529
343 Ga0501033_0045940 3300049570 Bacteria 3248
344 Ga0501033_0064704 3300049570 Bacteria 2691
345 Ga0501034_0003326 3300049571 Bacteria 18347
346 Ga0501034_0028660 3300049571 Bacteria 5665
347 Ga0501036_0285123 3300049572 Bacteria 1382
348 Ga0501036_0598638 3300049572 Bacteria 914
349 Ga0501037_0869135 3300049573 Bacteria 592
350 Ga0501039_0739416 3300049575 Bacteria 768
351 Ga0501039_1301303 3300049575 Bacteria 561
352 Ga0501043_0210689 3300049579 Bacteria 1506
353 Ga0501047_0244452 3300049581 Bacteria 1644
354 Ga0501207_020494 3300049654 Bacteria 1056
355 Ga0501079_0785326 3300049741 Bacteria 750
356 Ga0501079_0804588 3300049741 Bacteria 740
357 Ga0501080_0015372 3300049742 Bacteria 7055
358 Ga0501035_0092439 3300049822 Bacteria 2662
359 Ga0501044_0002599 3300049823 Bacteria 20523
360 Ga0501044_0105330 3300049823 Bacteria 2833
361 nmdc:mga03683_166379_c1 3300050489 Bacteria 1001
362 nmdc:mga03n38_12793_c1 3300050490 Bacteria 3169
363 nmdc:mga00v17_56001_c1 3300050491 Bacteria 2410
364 nmdc:mga0yw44_59048_c1 3300050492 Bacteria 2346
365 nmdc:mga0k408_16018_c1 3300050493 Bacteria 4152
366 nmdc:mga06z11_60758_c1 3300050494 Bacteria 1969
367 nmdc:mga04h51_158848_c1 3300050495 Bacteria 869
368 nmdc:mga07m45_81094_c1 3300050496 Bacteria 1853
369 nmdc:mga0n895_132868_c1 3300050512 Bacteria 2514
370 nmdc:mga0rr50_22211_c1 3300050513 Bacteria 4350
371 nmdc:mga08x19_204926_c1 3300050514 Bacteria 1353
372 nmdc:mga0sz30_52015_c1 3300050516 Bacteria 1739
373 Ga0500559_0241324 3300053136 Bacteria 852
374 Ga0500586_008253 3300053145 Bacteria 2828
375 2644358990 2643221664 Bacteria 7272945
376 2738738574 2738541280 Bacteria 6630198
377 2738842620 2738541300 Bacteria 6675882
378 2739273367 2738543018 Bacteria 6718814
379 2739342411 2738543030 Bacteria 6719714
380 2904444589 2904439833 Bacteria 5931679
381 2904605117 2904601388 Bacteria 5884906
382 2904615699 2904615490 Bacteria 10047340
383 2919049101 2919046199 Bacteria 5567169
384 2923513150 2923510766 Bacteria 5926163
385 Ga0501227_068272
386 rootH2_10001635
387 rootL2_10352076
388 rootH1_10014821
389 rootH1_10160732
390 Ga0055526_1000305
391 Ga0055526_1085098
392 Ga0070683_100047519
393 Ga0070680_100362781
394 Ga0070682_101311600
395 Ga0070660_100395537
396 Ga0070691_10168000
397 Ga0070687_100179499
398 Ga0070668_100562303
399 Ga0070667_100306473
400 Ga0070714_100500509
401 Ga0070713_101896299
402 Ga0070701_10265870
403 Ga0070681_10144581
404 Ga0068867_101305102
405 Ga0070684_100088075
406 Ga0068853_100121743
407 Ga0070686_101329587
408 Ga0070665_100042984
409 Ga0070704_100095347
410 Ga0068855_100017046
411 Ga0070664_100021670
412 Ga0068857_100069072
413 Ga0068856_102365930
414 Ga0068859_100031814
415 Ga0068859_100133085
416 Ga0068859_102066585
417 Ga0068861_100412051
418 Ga0068851_10004481
419 Ga0068863_100088550
420 Ga0068858_100217532
421 Ga0068858_100828336
422 Ga0068860_100018056
423 Ga0068860_100763134
424 Ga0068860_101813035
425 Ga0075363_100135976
426 Ga0075364_10026619
427 Ga0075362_10268714
428 Ga0075367_10060855
429 Ga0075369_10030753
430 Ga0075366_10019088
431 Ga0097621_100394646
432 Ga0075370_10134931
433 Ga0075434_101282293
434 Ga0075436_100071336
435 Ga0097620_100031809
436 Ga0097620_100133092
437 Ga0097620_102066334
438 Ga0075435_100356210
439 Ga0105240_10032843
440 Ga0105240_10234037
441 Ga0105241_10011804
442 Ga0105242_11033501
443 Ga0105237_10131656
444 Ga0105238_10002091
445 Ga0105239_10004510
446 Ga0105239_10976755
447 Ga0157369_10214338
448 Ga0157372_10226155
449 Ga0157375_10364277
450 Ga0157376_12025219
451 Ga0182006_1000882
452 Ga0163161_10527321
453 Ga0213872_10020965
454 Ga0213872_10065051
455 Ga0213872_10211115
456 Ga0209565_1002643
457 Ga0209564_1006716
458 Ga0207656_10092089
459 Ga0207654_10024755
460 Ga0207695_10002944
461 Ga0207695_10365976
462 Ga0207695_10719382
463 Ga0207671_10004876
464 Ga0207671_10329506
465 Ga0207660_10664922
466 Ga0207662_10133198
467 Ga0207657_10298889
468 Ga0207694_10000587
469 Ga0207694_10316016
470 Ga0207650_10560580
471 Ga0207709_10829785
472 Ga0207661_10266665
473 Ga0207679_10332460
474 Ga0207667_10048668
475 Ga0207668_10535991
476 Ga0207640_10116870
477 Ga0207658_10836323
478 Ga0207703_10014574
479 Ga0207639_10165181
480 Ga0207639_10552647
481 Ga0207641_10137456
482 Ga0207674_10090930
483 Ga0207674_10961185
484 Ga0207675_100931443
485 Ga0209813_10135879
486 Ga0268264_10044887
487 Ga0268264_10942948
488 Ga0268264_12149448
489 Ga0307515_10263676
490 Ga0265327_10001699
491 Ga0265316_10002392
492 Ga0307408_100089386
493 Ga0316579_10000081
494 Ga0307416_100572015
495 Ga0307414_10916890
496 Ga0316583_10004124
497 Ga0316583_10005320
498 Ga0316574_0280887
499 Ga0316582_0025931
500 Ga0373925_0118693
501 Ga0395899_0001384
502 Ga0395905_0092175
503 Ga0436361_0529390
504 Ga0436361_0609171
505 Ga0436361_0633145
506 Ga0436361_0814946
507 Ga0451577_0466229
508 Ga0466961_0028416
509 Ga0451576_0632185
510 Ga0495617_002083
511 Ga0495617_060478
512 Ga0495592_0082332
513 Ga0495592_0384845
514 Ga0495603_0011201
515 Ga0495603_0020650
516 Ga0495591_050773
517 Ga0495629_0002005
518 Ga0495629_0014028
519 Ga0495629_0015571
520 Ga0495638_0016030
521 Ga0495638_0316224
522 Ga0495638_0592725
523 Ga0495641_0006856
524 Ga0495651_0833893
525 Ga0495653_0012847
526 Ga0495653_0014743
527 Ga0495653_0216877
528 Ga0495650_0002170
529 Ga0495650_0004207
530 Ga0495580_0000069
531 Ga0495580_0000083
532 Ga0495580_0011619
533 Ga0495580_0352690
534 Ga0495580_0430951
535 Ga0495582_0001197
536 Ga0495582_0285199
537 Ga0495582_0745071
538 Ga0495605_0315761
539 Ga0495639_0032499
540 Ga0495662_0020955
541 Ga0495662_0033678
542 Ga0495664_0000132
543 Ga0495664_0019479
544 Ga0495584_0000501
545 Ga0495584_0020062
546 Ga0495585_0010171
547 Ga0495585_0069934
548 Ga0495594_0212402
549 Ga0495594_0784059
550 Ga0495596_0090984
551 Ga0495607_0016464
552 Ga0495607_0055101
553 Ga0495607_0063016
554 Ga0495607_0218890
555 Ga0495583_0000185
556 Ga0495583_0278702
557 Ga0495606_0005897
558 Ga0495606_0006450
559 Ga0495606_0011140
560 Ga0495606_0077505
561 Ga0495606_0267234
562 Ga0495608_0149643
563 Ga0495610_0008180
564 Ga0495610_0056840
565 Ga0495610_0080683
566 Ga0495610_0329603
567 Ga0495616_0024404
568 Ga0495616_0069790
569 Ga0495616_0112541
570 Ga0495616_0147716
571 Ga0495616_0414805
572 Ga0495618_0010828
573 Ga0495628_0015147
574 Ga0495628_0028195
575 Ga0495630_0009300
576 Ga0495630_0046550
577 Ga0495630_0832387
578 Ga0495644_0000163
579 Ga0495644_0000578
580 Ga0495644_0216883
581 Ga0495648_0001891
582 Ga0495648_0007830
583 Ga0495648_0034626
584 Ga0495648_0243472
585 Ga0495648_0489123
586 Ga0495666_0008656
587 Ga0495666_0462832
588 Ga0495642_0005477
589 Ga0495642_0051166
590 Ga0495652_0051494
591 Ga0495652_0509069
592 Ga0495652_0753145
593 Ga0495654_0014381
594 Ga0495654_0075050
595 Ga0495654_0146476
596 Ga0495665_0000238
597 Ga0495665_0011389
598 Ga0495665_0130291
599 Ga0495665_0559444
600 Ga0495640_0009755
601 Ga0495586_0007344
602 Ga0495586_0324583
603 Ga0495587_0006408
604 Ga0495609_0004671
605 Ga0495597_0005778
606 Ga0495597_0180808
607 Ga0495645_0000648
608 Ga0495645_0011445
609 Ga0495633_0002048
610 Ga0495633_0019181
611 Ga0495633_0027384
612 Ga0495667_0344678
613 Ga0495656_0032052
614 Ga0495656_0081083
615 Ga0495656_0147533
616 Ga0495668_0000101
617 Ga0495634_0003652
618 Ga0495634_0127625
619 Ga0495611_0016040
620 Ga0495611_0043722
621 Ga0495625_0001069
622 Ga0495625_0069820
623 Ga0495625_0069876
624 Ga0495635_0008465
625 Ga0495635_0008984
626 Ga0495659_0000074
627 Ga0495659_0001563
628 Ga0495661_0014180
629 Ga0495661_0059878
630 Ga0495661_0308741
631 Ga0495588_0039520
632 Ga0495588_0045726
633 Ga0495599_0036292
634 Ga0495599_0176040
635 Ga0495623_0006312
636 Ga0495623_0102908
637 Ga0495646_0000864
638 Ga0495646_0006937
639 Ga0495669_0448113
640 Ga0495669_0659491
641 Ga0495613_0003379
642 Ga0495624_0002390
643 Ga0495624_0040753
644 Ga0495670_0032000
645 Ga0495671_0000493
646 Ga0495671_0053823
647 Ga0495671_0059139
648 Ga0495671_0090946
649 Ga0495649_0127768
650 Ga0495589_0137901
651 Ga0495589_0446071
652 Ga0495589_0584158
653 Ga0495660_0002079
654 Ga0495581_0010796
655 Ga0495581_0145267
656 Ga0495604_0015629
657 Ga0495604_0017207
658 Ga0495636_0000415
659 Ga0495674_0032570
660 Ga0495674_0053452
661 Ga0495674_0313555
662 Ga0495674_0340235
663 Ga0495672_0000026
664 Ga0495672_0041488
665 Ga0495672_0070937
666 Ga0495672_0106500
667 Ga0495676_0021067
668 Ga0495676_0801923
669 Ga0495680_0000740
670 Ga0495680_0006326
671 Ga0495680_0246056
672 Ga0495683_0020554
673 Ga0495683_0082429
674 Ga0495683_0427799
675 Ga0495683_0428013
676 Ga0495687_010285
677 Ga0495675_0010485
678 Ga0495675_0090267
679 Ga0495675_0533082
680 Ga0495677_0003811
681 Ga0495677_0005236
682 Ga0495677_0091992
683 Ga0495679_002284
684 Ga0495679_069983
685 Ga0495685_000036
686 Ga0495673_0000304
687 Ga0495673_0060031
688 Ga0495681_0177834
689 Ga0495684_0016956
690 Ga0495686_0001489
691 Ga0495686_0025396
692 Ga0495686_0105086
693 Ga0495593_0000984
694 Ga0495593_0007578
695 Ga0495593_0052210
696 Ga0495602_0010204
697 Ga0495602_0027304
698 Ga0495614_0005702
699 Ga0495614_0660544
700 Ga0495626_0002059
701 Ga0495626_0203486
702 Ga0496100_0909423
703 Ga0496101_0385156
704 Ga0496102_0569764
705 Ga0496104_0304435
706 Ga0496106_1320972
707 Ga0496107_0272631
708 Ga0496108_1103521
709 Ga0496110_0522086
710 Ga0496114_0049425
711 Ga0496115_0324261
712 Ga0496121_0372090
713 Ga0496123_0336122
714 Ga0496125_0208817
715 Ga0496126_0078414
716 Ga0496126_1196154
717 Ga0495678_001775
718 Ga0495678_013722
719 Ga0495682_0000206
720 Ga0495682_0000271
721 Ga0495682_0000923
722 Ga0495682_0086321
723 Ga0501031_0011456
724 Ga0501032_0042141
725 Ga0501032_0988539
726 Ga0501033_0045940
727 Ga0501033_0064704
728 Ga0501034_0003326
729 Ga0501034_0028660
730 Ga0501036_0285123
731 Ga0501036_0598638
732 Ga0501037_0869135
733 Ga0501039_0739416
734 Ga0501039_1301303
735 Ga0501043_0210689
736 Ga0501047_0244452
737 Ga0501207_020494
738 Ga0501079_0785326
739 Ga0501079_0804588
740 Ga0501080_0015372
741 Ga0501035_0092439
742 Ga0501044_0002599
743 Ga0501044_0105330
744 nmdc:mga03683_166379_c1
745 nmdc:mga03n38_12793_c1
746 nmdc:mga00v17_56001_c1
747 nmdc:mga0yw44_59048_c1
748 nmdc:mga0k408_16018_c1
749 nmdc:mga06z11_60758_c1
750 nmdc:mga04h51_158848_c1
751 nmdc:mga07m45_81094_c1
752 nmdc:mga0n895_132868_c1
753 nmdc:mga0rr50_22211_c1
754 nmdc:mga08x19_204926_c1
755 nmdc:mga0sz30_52015_c1
756 Ga0500559_0241324
757 Ga0500586_008253
758 2644358990
759 2738738574
760 2738842620
761 2739273367
762 2739342411
763 2904444589
764 2904605117
765 2904615699
766 2919049101
767 2923513150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

29

81

0.96

PF01022

HTH_5

Bacterial regulatory protein, arsR family

39

80

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9393 18 75
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9377 1 89
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.9256 15 77
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.918 1 89
2oqg-assembly1.cif.gz_D arsr-like transcriptional regulator from rhodococcus sp. rha1 0.9094 4 93
ID Description Score Start End Superfamily
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9646 33 75 3.30.230.130
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9571 15 75 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9566 15 75 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9562 15 74 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9551 18 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7R6ZWG1-F1-model_v4 Transcriptional regulator 0.9857 1 88 GO:0003700
AF-A0A0N1MUW4-F1-model_v4 ArsR family transcriptional regulator 0.9857 1 95 GO:0003700
AF-A0A496WWI5-F1-model_v4 Transcriptional regulator 0.9852 1 87 GO:0003700
AF-A0A2W7IWC3-F1-model_v4 Protein-tyrosine-phosphatase 0.9842 1 94 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A2S6UF84-F1-model_v4 HTH arsR-type domain-containing protein 0.9828 1 93 GO:0003700

Map