F429758

General Info

Members Datasets Scaffolds Average Seq Length
383 298 765 253

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2841864319|2841870175
Length 279
Sequence GRSTGFKREEFTMPYRCSTSNRLLAGLAAVALMAGTAVPADAGTATGAATEWTQVLNNGELVALVGKSGEQIQNQLTQISQLAQQIETQLNIYQNLLQNTATLPSHMWGQVESDLNQLRSIVDQGQSISFSMGNADDVLQQRFQSYSSLKTNLPSSESFSSSYQTWSDTNRDTIASTLKAASLTAEQFDTEEGTMSSLRSMSETADGQMKALQVGHEIAAQQVAQMQKLRGLVSQQMTMMGTWLQTEQTDKDLAQARREKFFSGTAPSTSGGEKMKVEW

Samples

Sample ID Description Type Environment
1 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
22 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
25 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
26 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
27 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
28 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
29 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
30 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
45 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
46 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
47 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
48 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
49 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
50 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
51 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
54 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
55 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
56 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
57 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
58 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
59 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
60 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
61 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
62 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
65 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
66 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
67 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
68 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
69 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
70 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
71 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
72 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
75 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
76 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
77 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
78 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
79 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
80 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
83 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
84 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
85 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
86 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
89 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
94 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
95 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
101 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
102 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
103 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
104 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
105 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
106 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
107 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
108 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
109 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
110 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
111 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
112 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
113 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
114 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
115 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
116 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
117 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
118 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
119 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
120 2509276019 Ensifer aridi TW10 Isolate Nodule
121 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
122 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
123 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
124 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
125 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
126 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
127 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
128 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
129 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
130 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
131 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
132 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
133 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
134 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
135 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
136 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
137 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
138 2516143018 Ensifer sp. BR816 Isolate Nodule
139 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
140 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
141 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
142 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
143 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
144 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
145 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
146 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
147 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
148 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
149 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
150 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
151 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
152 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
153 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
154 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
155 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
156 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
157 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
158 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
159 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
160 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
161 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
162 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
163 2643221558 Rhizobium sp. Root149 Isolate Unclassified
164 2643221568 Rhizobium sp. Root564 Isolate Unclassified
165 2643221582 Rhizobium sp. Root651 Isolate Unclassified
166 2643221626 Ensifer sp. Root31 Isolate Unclassified
167 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
168 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
169 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
170 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
171 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
172 2643221718 Rhizobium sp. Root268 Isolate Unclassified
173 2643221719 Rhizobium sp. Root274 Isolate Unclassified
174 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
175 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
176 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
177 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
178 2738541293 Rhizobium sp. GV031 Isolate Unclassified
179 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
180 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
181 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
182 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
183 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
184 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
185 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
186 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
187 2791355256 Rhizobium sp. M10 Isolate Nodule
188 2791355263 Rhizobium chutanense C5 Isolate Nodule
189 2791355266 Rhizobium sp. L43 Isolate Nodule
190 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
191 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
192 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
193 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
194 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
195 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
196 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
197 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
198 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
199 2802429633 Rhizobium anhuiense J3 Isolate Nodule
200 2802429634 Rhizobium anhuiense S10 Isolate Nodule
201 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
202 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
203 2802429637 Rhizobium anhuiense C15 Isolate Nodule
204 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
205 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
206 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
207 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
208 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
209 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
210 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
211 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
212 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
213 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
214 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
215 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
216 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
217 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
218 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
219 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
220 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
221 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
222 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
223 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
224 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
225 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
226 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
227 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
228 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
229 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
230 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
231 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
232 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
233 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
234 2854911287 Brucella lupini LUP21 Isolate Unclassified
235 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
236 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
237 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
238 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
239 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
240 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
241 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
242 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
243 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
244 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
245 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
246 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
247 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
248 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
249 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
250 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
251 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
252 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
253 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
254 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
255 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
256 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
257 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
258 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
259 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
260 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
261 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
262 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
263 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
264 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
265 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
266 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
267 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
268 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
269 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
270 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
271 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
272 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
273 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
274 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
275 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
276 2996887358 Rhizobium sp. R711 Isolate Nodule
277 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
278 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
279 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
280 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
281 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
282 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
283 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
284 8005321885 Rhizobium sp. R72 Isolate Nodule
285 8005395548 Rhizobium sp. R339 Isolate Nodule
286 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
287 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
288 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
289 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
290 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
291 8018176218 Rhizobium sp. N122 Isolate Nodule
292 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
293 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
294 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
295 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
296 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
297 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
298 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.86
Metatranscriptomes 0
Isolates 56.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.23
Nodule 43.86
Rhizoplane 0.26
Rhizosphere 19.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000766 3300002739 Bacteria 6150
2 JGI25150J39212_1000058 3300002774 Bacteria 66130
3 JGI25150J39212_1011267 3300002774 Bacteria 1628
4 JGI25159J45721_1000109 3300002987 Bacteria 38930
5 JGI25159J45721_1001093 3300002987 Bacteria 11574
6 JGI25151J46595_10000241 3300003187 Bacteria 64064
7 rootH1_10002814 3300003316 Bacteria 40375
8 rootH1_10002814 3300003323 Bacteria 12796
9 rootH2_10029723 3300003320 Bacteria 13503
10 rootL2_10010387 3300003322 Bacteria 55016
11 rootH1_10025473 3300003323 Bacteria 4607
12 rootH1_10215341 3300003323 Bacteria 6018
13 JGI25160J50197_1000103 3300003354 Bacteria 80968
14 JGI25160J50197_1003054 3300003354 Bacteria 7633
15 JGI25161J50226_1000090 3300003374 Bacteria 73647
16 JGI25161J50226_1000106 3300003374 Bacteria 65625
17 Ga0055524_1002811 3300003775 Bacteria 8740
18 Ga0055524_1043969 3300003775 Bacteria 1091
19 Ga0055528_1003238 3300003790 Bacteria 8305
20 Ga0055540_1000113 3300003792 Bacteria 86603
21 Ga0058692_1000019 3300003856 Bacteria 255580
22 Ga0055543_1000087 3300004625 Bacteria 81157
23 Ga0055543_1000169 3300004625 Bacteria 54844
24 Ga0065165_1000900 3300005262 Bacteria 38368
25 Ga0065165_1004719 3300005262 Bacteria 8183
26 Ga0070665_100114371 3300005548 Bacteria 2701
27 Ga0075363_100137033 3300006048 Bacteria 1376
28 Ga0075364_10070942 3300006051 Bacteria 2294
29 Ga0075367_10006329 3300006178 Bacteria 5971
30 Ga0123341_1008486 3300009765 Bacteria 9387
31 Ga0123341_1008780 3300009765 Bacteria 9231
32 Ga0123341_1018325 3300009765 Bacteria 6079
33 Ga0123342_1007895 3300009766 Bacteria 13782
34 Ga0123342_1008640 3300009766 Bacteria 12672
35 Ga0123342_1015871 3300009766 Bacteria 6710
36 Ga0182008_10181268 3300014497 Bacteria 1066
37 Ga0214544_1000584 3300021320 Bacteria 68638
38 Ga0214543_1003317 3300021327 Bacteria 31302
39 Ga0214543_1015702 3300021327 Bacteria 8254
40 Ga0228710_1011825 3300022740 Bacteria 11087
41 Ga0209436_100001 3300025208 Bacteria 304543
42 Ga0207425_1000083 3300025245 Bacteria 96984
43 Ga0207425_1000808 3300025245 Bacteria 15733
44 Ga0209129_1000098 3300025258 Bacteria 163406
45 Ga0209129_1011551 3300025258 Bacteria 2099
46 Ga0209565_1031997 3300025263 Bacteria 1019
47 Ga0209673_1000845 3300025273 Bacteria 39932
48 Ga0209130_1000049 3300025284 Bacteria 226841
49 Ga0209130_1000098 3300025284 Bacteria 142506
50 Ga0209025_1000142 3300025294 Bacteria 183903
51 Ga0209564_1000354 3300025295 Bacteria 85718
52 Ga0209758_1000300 3300025297 Bacteria 97000
53 Ga0209758_1003216 3300025297 Bacteria 15213
54 Ga0209758_1008866 3300025297 Bacteria 6394
55 Ga0209758_1014459 3300025297 Bacteria 4195
56 Ga0209758_1027231 3300025297 Bacteria 2448
57 Ga0209256_1023094 3300025299 Bacteria 1864
58 Ga0209256_1029354 3300025299 Bacteria 1534
59 Ga0207426_1000043 3300025302 Bacteria 432827
60 Ga0207426_1000069 3300025302 Bacteria 334513
61 Ga0207426_1000283 3300025302 Bacteria 103487
62 Ga0209051_1000287 3300025303 Bacteria 80935
63 Ga0209257_1008940 3300025304 Bacteria 5511
64 Ga0209371_1000107 3300027312 Bacteria 141889
65 Ga0268266_10048274 3300028379 Bacteria 3649
66 Ga0268266_10142723 3300028379 Bacteria 2150
67 Ga0268256_1000093 3300030500 Bacteria 141889
68 Ga0395905_0004538 3300037471 Bacteria 14378
69 Ga0451833_0152513 3300041491 Bacteria 14791
70 Ga0451835_0471770 3300041492 Bacteria 8979
71 Ga0451839_0363184 3300041496 Bacteria 11590
72 Ga0451841_0555957 3300041498 Bacteria 30671
73 Ga0451845_0312366 3300041501 Bacteria 3937
74 Ga0451849_0565515 3300041505 Bacteria 6553
75 Ga0451851_0193482 3300041507 Bacteria 26742
76 Ga0451843_1389179 3300041509 Bacteria 16178
77 Ga0451853_0193996 3300041512 Bacteria 20097
78 Ga0495617_017166 3300046452 Bacteria 2443
79 Ga0495627_008644 3300046453 Bacteria 3799
80 Ga0495638_0000077 3300046460 Bacteria 158724
81 Ga0495638_0000181 3300046460 Bacteria 96473
82 Ga0495585_0021531 3300046492 Bacteria 3701
83 Ga0495583_0013284 3300046506 Bacteria 4601
84 Ga0495610_0026075 3300046512 Bacteria 3125
85 Ga0495610_0067422 3300046512 Bacteria 1681
86 Ga0495616_0024044 3300046513 Bacteria 3273
87 Ga0495616_0187727 3300046513 Bacteria 915
88 Ga0495620_0000107 3300046515 Bacteria 66810
89 Ga0495632_0000423 3300046519 Bacteria 40113
90 Ga0495637_0004274 3300046520 Bacteria 7418
91 Ga0495643_0003673 3300046522 Bacteria 11135
92 Ga0495643_0121772 3300046522 Bacteria 1317
93 Ga0495648_0120692 3300046524 Bacteria 1409
94 Ga0495663_0003852 3300046525 Bacteria 4277
95 Ga0495663_0009772 3300046525 Bacteria 2662
96 Ga0495654_0004327 3300046530 Bacteria 8462
97 Ga0495609_0014495 3300046538 Bacteria 3703
98 Ga0495622_0068553 3300046557 Bacteria 1638
99 Ga0495611_0000364 3300046648 Bacteria 29296
100 Ga0495625_0028159 3300046660 Bacteria 4217
101 Ga0495625_0161271 3300046660 Bacteria 1502
102 Ga0495661_0040836 3300046665 Bacteria 2874
103 Ga0495661_0049400 3300046665 Bacteria 2551
104 Ga0495588_0091270 3300046674 Bacteria 1596
105 Ga0495613_0004078 3300046689 Bacteria 10920
106 Ga0495670_0000149 3300046691 Bacteria 30870
107 Ga0495671_0001235 3300046692 Bacteria 17511
108 Ga0495649_0039528 3300046694 Bacteria 2586
109 Ga0495660_0080913 3300046810 Bacteria 1704
110 Ga0495687_000105 3300047443 Bacteria 128239
111 Ga0495679_048198 3300047446 Bacteria 1289
112 Ga0495681_0000657 3300047470 Bacteria 26280
113 Ga0495681_0057836 3300047470 Bacteria 1799
114 Ga0495686_0000500 3300047472 Bacteria 57459
115 Ga0495686_0159413 3300047472 Bacteria 1319
116 Ga0496116_0001726 3300048919 Bacteria 23861
117 Ga0496116_0089808 3300048919 Bacteria 1873
118 Ga0496117_0002417 3300048920 Bacteria 23697
119 Ga0496118_0080657 3300048921 Bacteria 2289
120 Ga0496119_0000569 3300048922 Bacteria 49819
121 Ga0496119_0069751 3300048922 Bacteria 2065
122 Ga0496120_0027180 3300048923 Bacteria 3524
123 Ga0496121_0000115 3300048924 Bacteria 178411
124 Ga0496121_0027857 3300048924 Bacteria 5277
125 Ga0496121_0061435 3300048924 Bacteria 3083
126 Ga0496121_0068952 3300048924 Bacteria 2857
127 Ga0496122_0037955 3300048925 Bacteria 3867
128 Ga0496123_0002390 3300048926 Bacteria 23485
129 Ga0496123_0049818 3300048926 Bacteria 2804
130 Ga0496123_0140316 3300048926 Bacteria 1322
131 Ga0496124_0104332 3300048927 Bacteria 2292
132 Ga0496125_0000182 3300048928 Bacteria 137747
133 Ga0496125_0015573 3300048928 Bacteria 7343
134 Ga0496125_0134597 3300048928 Bacteria 1731
135 Ga0496125_0227215 3300048928 Bacteria 1197
136 Ga0496126_0000471 3300048929 Bacteria 80080
137 Ga0496126_0069235 3300048929 Bacteria 3148
138 Ga0495678_000295 3300049459 Bacteria 54788
139 Ga0495682_0003871 3300049460 Bacteria 6550
140 Ga0501033_0000630 3300049570 Bacteria 32555
141 Ga0501036_0028684 3300049572 Bacteria 4704
142 Ga0501038_0006644 3300049574 Bacteria 10695
143 Ga0501035_0000231 3300049822 Bacteria 66354
144 Ga0501035_0000730 3300049822 Bacteria 35664
145 Ga0501035_0247257 3300049822 Bacteria 1516
146 Ga0501044_0001034 3300049823 Bacteria 33520
147 Ga0500610_0062327 3300053079 Bacteria 1946
148 Ga0500583_0001023 3300053092 Bacteria 7980
149 Ga0500555_002431 3300053103 Bacteria 5399
150 Ga0500560_079762 3300053107 Bacteria 1086
151 Ga0500597_103961 3300053120 Bacteria 1234
152 Ga0500608_000646 3300053122 Bacteria 12801
153 Ga0500618_000097 3300053125 Bacteria 71932
154 Ga0500618_000242 3300053125 Bacteria 43374
155 Ga0500618_000952 3300053125 Bacteria 14814
156 Ga0500618_036446 3300053125 Bacteria 1139
157 Ga0500652_117080 3300053131 Bacteria 1113
158 Ga0500561_0002629 3300053137 Bacteria 3042
159 Ga0500564_001819 3300053138 Bacteria 7570
160 Ga0500573_0003603 3300053140 Bacteria 8036
161 Ga0500574_000032 3300053141 Bacteria 18144
162 Ga0500619_002958 3300053154 Bacteria 3385
163 Ga0500622_0000278 3300053156 Bacteria 52272
164 Ga0500624_000353 3300053157 Bacteria 14950
165 Ga0500634_0097539 3300053161 Bacteria 1478
166 Ga0500638_000138 3300053162 Bacteria 13919
167 Ga0500636_0000121 3300053177 Bacteria 40628
168 Ga0500636_0030622 3300053177 Bacteria 3183
169 2841870175 2841864319 Bacteria 6742987
170 2509111908 2508501122 Bacteria 6292184
171 2509378646 2509276019 Bacteria 6802256
172 2512531270 2512047086 Bacteria 6850303
173 2512975104 2512875026 Bacteria 6861065
174 2513573048 2513237084 Bacteria 7231967
175 2513580873 2513237085 Bacteria 7695351
176 2513586404 2513237086 Bacteria 7265287
177 2513600618 2513237088 Bacteria 6927906
178 2513605140 2513237089 Bacteria 6553624
179 2513706779 2513237102 Bacteria 7703324
180 2513869314 2513237138 Bacteria 7368160
181 2513869944 2513237138 Bacteria 7368160
182 2513881842 2513237140 Bacteria 7076289
183 2513885919 2513237140 Bacteria 7076289
184 2513914242 2513237144 Bacteria 7530820
185 2513930108 2513237146 Bacteria 7166346
186 2513988055 2513237156 Bacteria 6402557
187 2513989295 2513237156 Bacteria 6402557
188 2513998921 2513237159 Bacteria 6810126
189 2514001283 2513237159 Bacteria 6810126
190 2514002647 2513237159 Bacteria 6810126
191 2514007829 2513237160 Bacteria 6650282
192 2515109927 2515075009 Bacteria 7288508
193 2515611280 2515154107 Bacteria 6795637
194 2515611853 2515154107 Bacteria 6795637
195 2516210365 2516143018 Bacteria 6951533
196 2517567748 2517487022 Bacteria 7227575
197 2524451574 2524023207 Bacteria 6813453
198 2524460893 2524023209 Bacteria 6679728
199 2524462822 2524023209 Bacteria 6679728
200 2524462871 2524023209 Bacteria 6679728
201 2535521026 2534681796 Bacteria 7146037
202 2551699249 2551306087 Bacteria 7351905
203 2558864271 2558860100 Bacteria 8458965
204 2558867016 2558860100 Bacteria 8458965
205 2558867707 2558860100 Bacteria 8458965
206 2585205206 2582581294 Bacteria 6626667
207 2585258064 2582581304 Bacteria 5831370
208 2585268304 2582581306 Bacteria 6450535
209 2585275731 2582581307 Bacteria 6597605
210 2585281744 2582581308 Bacteria 7413247
211 2585334818 2582581316 Bacteria 7774528
212 2585391201 2582581865 Bacteria 6644329
213 2585534392 2585427527 Bacteria 7273426
214 2585553936 2585427530 Bacteria 7383882
215 2585563678 2585427531 Bacteria 6992870
216 2585897380 2585427608 Bacteria 6544331
217 2585908929 2585427609 Bacteria 6667127
218 2585994093 2585427633 Bacteria 6413184
219 2587984252 2585428125 Bacteria 6662905
220 2599413972 2599185170 Bacteria 7295545
221 2599723324 2599185236 Bacteria 6875203
222 2616310042 2615840626 Bacteria 7921970
223 2616311766 2615840626 Bacteria 7921970
224 2616551458 2615840698 Bacteria 7319877
225 2643810872 2643221558 Bacteria 5460675
226 2643858398 2643221568 Bacteria 5187270
227 2643918127 2643221582 Bacteria 5804683
228 2644147392 2643221626 Bacteria 8069654
229 2644192468 2643221634 Bacteria 6705461
230 2644200553 2643221636 Bacteria 6583769
231 2644208162 2643221637 Bacteria 5345260
232 2644238393 2643221643 Bacteria 5749658
233 2644300760 2643221653 Bacteria 4569637
234 2644651920 2643221718 Bacteria 5345506
235 2644658982 2643221719 Bacteria 4568197
236 2657686637 2657244999 Bacteria 5946535
237 2692320941 2690316117 Bacteria 6800650
238 2720617067 2718218233 Bacteria 6662049
239 2725949143 2724679232 Bacteria 7646494
240 2738805200 2738541293 Bacteria 7065685
241 2738805876 2738541293 Bacteria 7065685
242 2753459421 2751185821 Bacteria 6189929
243 2776268190 2775506902 Bacteria 6208009
244 2776283970 2775506904 Bacteria 5954060
245 2778176768 2775507266 Bacteria 7392367
246 2778179991 2775507266 Bacteria 7392367
247 2778180297 2775507266 Bacteria 7392367
248 2792623752 2791355091 Bacteria 6135441
249 2792624680 2791355091 Bacteria 6135441
250 2792630015 2791355092 Bacteria 6248105
251 2792630800 2791355092 Bacteria 6248105
252 2792641093 2791355094 Bacteria 7011481
253 2792642041 2791355094 Bacteria 7011481
254 2793283262 2791355253 Bacteria 5171699
255 2793298071 2791355256 Bacteria 6798008
256 2793343376 2791355263 Bacteria 6872478
257 2793343567 2791355263 Bacteria 6872478
258 2793363138 2791355266 Bacteria 7116587
259 2793363446 2791355266 Bacteria 7116587
260 2793364261 2791355266 Bacteria 7116587
261 2802721037 2802428858 Bacteria 6636079
262 2802728125 2802428859 Bacteria 6667919
263 2802733591 2802428860 Bacteria 6525526
264 2802736664 2802428861 Bacteria 6534206
265 2802746732 2802428862 Bacteria 6633353
266 2802749771 2802428863 Bacteria 6410669
267 2804750496 2802429268 Bacteria 6094027
268 2805931154 2802429605 Bacteria 6875453
269 2805936956 2802429606 Bacteria 6346811
270 2805937706 2802429606 Bacteria 6346811
271 2806048257 2802429633 Bacteria 7341974
272 2806055725 2802429634 Bacteria 7083200
273 2806062560 2802429635 Bacteria 7650140
274 2806070902 2802429636 Bacteria 7597525
275 2806076290 2802429637 Bacteria 7067217
276 2819688121 2818991461 Bacteria 7026071
277 2821128897 2821123053 Bacteria 7836056
278 2838033488 2838029111 Bacteria 6603031
279 2838034520 2838029111 Bacteria 6603031
280 2838042541 2838035591 Bacteria 7166484
281 2838080831 2838074704 Bacteria 6785777
282 2838668385 2838661181 Bacteria 7385261
283 2838691060 2838686498 Bacteria 7807632
284 2841856376 2841851746 Bacteria 7532261
285 2842083227 2842077413 Bacteria 6508645
286 2842117298 2842110456 Bacteria 7656360
287 2842202712 2842198810 Bacteria 6608673
288 2842275535 2842271015 Bacteria 7807131
289 2842290221 2842285085 Bacteria 6011953
290 2842302335 2842298080 Bacteria 6123127
291 2842303816 2842298080 Bacteria 6123127
292 2842324047 2842317721 Bacteria 6793725
293 2842363293 2842357229 Bacteria 6485165
294 2842402003 2842395702 Bacteria 6780583
295 2842407955 2842402390 Bacteria 6681310
296 2842408271 2842402390 Bacteria 6681310
297 2842414542 2842409023 Bacteria 6687331
298 2842414633 2842409023 Bacteria 6687331
299 2842421022 2842415677 Bacteria 6596907
300 2842421612 2842415677 Bacteria 6596907
301 2842480241 2842475841 Bacteria 6603183
302 2842481267 2842475841 Bacteria 6603183
303 2842488245 2842482326 Bacteria 7212537
304 2842488554 2842482326 Bacteria 7212537
305 2842494733 2842489311 Bacteria 6620893
306 2842507653 2842502639 Bacteria 6604161
307 2842508148 2842502639 Bacteria 6604161
308 2842513971 2842509118 Bacteria 6850950
309 2842514813 2842509118 Bacteria 6850950
310 2842524146 2842521101 Bacteria 6569494
311 2842526946 2842521101 Bacteria 6569494
312 2844461925 2844454524 Bacteria 7952546
313 2844462251 2844454524 Bacteria 7952546
314 2847421863 2847417321 Bacteria 6913799
315 2848996636 2848992105 Bacteria 6810864
316 2850083351 2850079185 Bacteria 6848280
317 2854911457 2854911287 Bacteria 5582813
318 2855876216 2855872281 Bacteria 6964271
319 2857524276 2857516855 Bacteria 7787325
320 2857537245 2857531043 Bacteria 6754041
321 2888387960 2888378607 Bacteria 9652610
322 2903776791 2903768456 Bacteria 9749579
323 2913298781 2913295892 Bacteria 6333755
324 2915986714 2915980308 Bacteria 6624279
325 2916064163 2916061851 Bacteria 6737736
326 2916072060 2916068649 Bacteria 6943657
327 2919107361 2919100787 Bacteria 7710546
328 2920762320 2920760137 Bacteria 7427611
329 2921254081 2921250672 Bacteria 6677771
330 2921296164 2921289301 Bacteria 7316391
331 2924171041 2924165586 Bacteria 7260590
332 2924226706 2924221636 Bacteria 7113495
333 2933023043 2933016740 Bacteria 6355406
334 2933590020 2933586486 Bacteria 7667493
335 2935713072 2935703347 Bacteria 10242284
336 2936001783 2935992306 Bacteria 9802711
337 2937035492 2937029754 Bacteria 6424026
338 2937039919 2937036028 Bacteria 6846469
339 2937078943 2937078374 Bacteria 6610289
340 2937087478 2937084907 Bacteria 6618516
341 2957376333 2957375807 Bacteria 6425588
342 2957429311 2957422303 Bacteria 7172205
343 2957440506 2957437181 Bacteria 6568994
344 2960597371 2960591022 Bacteria 6622873
345 2960636564 2960631154 Bacteria 6732508
346 2960651024 2960645483 Bacteria 7211087
347 2960686075 2960680706 Bacteria 6624464
348 2960695818 2960693952 Bacteria 6749742
349 2967690986 2967686174 Bacteria 6678622
350 2967713035 2967706974 Bacteria 7186053
351 2967733693 2967728569 Bacteria 6641507
352 2970029035 2970026789 Bacteria 6785236
353 2970125129 2970122695 Bacteria 6625855
354 2970141385 2970136068 Bacteria 7207982
355 2970148076 2970143518 Bacteria 6446480
356 2977533377 2977530762 Bacteria 6951399
357 2977548866 2977544691 Bacteria 6875412
358 2989780900 2989776772 Bacteria 4843317
359 2996889810 2996887358 Bacteria 5795980
360 3005410234 3005409236 Bacteria 7188837
361 639651344 639633055 Bacteria 7751309
362 643692049 643692032 Bacteria 6891900
363 8003574978 8003570095 Bacteria 5747666
364 8003575139 8003570095 Bacteria 5747666
365 8003999213 8003992118 Bacteria 7266902
366 8004005294 8003999396 Bacteria 7063185
367 8005301748 8005301065 Bacteria 6614431
368 8005324337 8005321885 Bacteria 5795980
369 8005402179 8005395548 Bacteria 6806915
370 8005465961 8005460587 Bacteria 7157962
371 8005488248 8005484373 Bacteria 6297373
372 8005549966 8005542996 Bacteria 7077758
373 8005693072 8005688590 Bacteria 6610080
374 8018153807 8018150411 Bacteria 5549903
375 8018179067 8018176218 Bacteria 6896178
376 8019586544 8019576017 Bacteria 10049540
377 8019597528 8019586578 Bacteria 10212056
378 8019607726 8019597564 Bacteria 10041141
379 8019619096 8019608314 Bacteria 10042931
380 8046767824 8046767195 Bacteria 7547379
381 8046770035 8046767195 Bacteria 7547379
382 8057581437 8057575449 Bacteria 7367519
383 8057880205 8057874678 Bacteria 7494653
384 JGI25158J39367_1000766
385 JGI25150J39212_1000058
386 JGI25150J39212_1011267
387 JGI25159J45721_1000109
388 JGI25159J45721_1001093
389 JGI25151J46595_10000241
390 rootH1_10002814
391 rootH2_10029723
392 rootL2_10010387
393 rootH1_10025473
394 rootH1_10215341
395 JGI25160J50197_1000103
396 JGI25160J50197_1003054
397 JGI25161J50226_1000090
398 JGI25161J50226_1000106
399 Ga0055524_1002811
400 Ga0055524_1043969
401 Ga0055528_1003238
402 Ga0055540_1000113
403 Ga0058692_1000019
404 Ga0055543_1000087
405 Ga0055543_1000169
406 Ga0065165_1000900
407 Ga0065165_1004719
408 Ga0070665_100114371
409 Ga0075363_100137033
410 Ga0075364_10070942
411 Ga0075367_10006329
412 Ga0123341_1008486
413 Ga0123341_1008780
414 Ga0123341_1018325
415 Ga0123342_1007895
416 Ga0123342_1008640
417 Ga0123342_1015871
418 Ga0182008_10181268
419 Ga0214544_1000584
420 Ga0214543_1003317
421 Ga0214543_1015702
422 Ga0228710_1011825
423 Ga0209436_100001
424 Ga0207425_1000083
425 Ga0207425_1000808
426 Ga0209129_1000098
427 Ga0209129_1011551
428 Ga0209565_1031997
429 Ga0209673_1000845
430 Ga0209130_1000049
431 Ga0209130_1000098
432 Ga0209025_1000142
433 Ga0209564_1000354
434 Ga0209758_1000300
435 Ga0209758_1003216
436 Ga0209758_1008866
437 Ga0209758_1014459
438 Ga0209758_1027231
439 Ga0209256_1023094
440 Ga0209256_1029354
441 Ga0207426_1000043
442 Ga0207426_1000069
443 Ga0207426_1000283
444 Ga0209051_1000287
445 Ga0209257_1008940
446 Ga0209371_1000107
447 Ga0268266_10048274
448 Ga0268266_10142723
449 Ga0268256_1000093
450 Ga0395905_0004538
451 Ga0451833_0152513
452 Ga0451835_0471770
453 Ga0451839_0363184
454 Ga0451841_0555957
455 Ga0451845_0312366
456 Ga0451849_0565515
457 Ga0451851_0193482
458 Ga0451843_1389179
459 Ga0451853_0193996
460 Ga0495617_017166
461 Ga0495627_008644
462 Ga0495638_0000077
463 Ga0495638_0000181
464 Ga0495585_0021531
465 Ga0495583_0013284
466 Ga0495610_0026075
467 Ga0495610_0067422
468 Ga0495616_0024044
469 Ga0495616_0187727
470 Ga0495620_0000107
471 Ga0495632_0000423
472 Ga0495637_0004274
473 Ga0495643_0003673
474 Ga0495643_0121772
475 Ga0495648_0120692
476 Ga0495663_0003852
477 Ga0495663_0009772
478 Ga0495654_0004327
479 Ga0495609_0014495
480 Ga0495622_0068553
481 Ga0495611_0000364
482 Ga0495625_0028159
483 Ga0495625_0161271
484 Ga0495661_0040836
485 Ga0495661_0049400
486 Ga0495588_0091270
487 Ga0495613_0004078
488 Ga0495670_0000149
489 Ga0495671_0001235
490 Ga0495649_0039528
491 Ga0495660_0080913
492 Ga0495687_000105
493 Ga0495679_048198
494 Ga0495681_0000657
495 Ga0495681_0057836
496 Ga0495686_0000500
497 Ga0495686_0159413
498 Ga0496116_0001726
499 Ga0496116_0089808
500 Ga0496117_0002417
501 Ga0496118_0080657
502 Ga0496119_0000569
503 Ga0496119_0069751
504 Ga0496120_0027180
505 Ga0496121_0000115
506 Ga0496121_0027857
507 Ga0496121_0061435
508 Ga0496121_0068952
509 Ga0496122_0037955
510 Ga0496123_0002390
511 Ga0496123_0049818
512 Ga0496123_0140316
513 Ga0496124_0104332
514 Ga0496125_0000182
515 Ga0496125_0015573
516 Ga0496125_0134597
517 Ga0496125_0227215
518 Ga0496126_0000471
519 Ga0496126_0069235
520 Ga0495678_000295
521 Ga0495682_0003871
522 Ga0501033_0000630
523 Ga0501036_0028684
524 Ga0501038_0006644
525 Ga0501035_0000231
526 Ga0501035_0000730
527 Ga0501035_0247257
528 Ga0501044_0001034
529 Ga0500610_0062327
530 Ga0500583_0001023
531 Ga0500555_002431
532 Ga0500560_079762
533 Ga0500597_103961
534 Ga0500608_000646
535 Ga0500618_000097
536 Ga0500618_000242
537 Ga0500618_000952
538 Ga0500618_036446
539 Ga0500652_117080
540 Ga0500561_0002629
541 Ga0500564_001819
542 Ga0500573_0003603
543 Ga0500574_000032
544 Ga0500619_002958
545 Ga0500622_0000278
546 Ga0500624_000353
547 Ga0500634_0097539
548 Ga0500638_000138
549 Ga0500636_0000121
550 Ga0500636_0030622
551 2841870175
552 2509111908
553 2509378646
554 2512531270
555 2512975104
556 2513573048
557 2513580873
558 2513586404
559 2513600618
560 2513605140
561 2513706779
562 2513869314
563 2513869944
564 2513881842
565 2513885919
566 2513914242
567 2513930108
568 2513988055
569 2513989295
570 2513998921
571 2514001283
572 2514002647
573 2514007829
574 2515109927
575 2515611280
576 2515611853
577 2516210365
578 2517567748
579 2524451574
580 2524460893
581 2524462822
582 2524462871
583 2535521026
584 2551699249
585 2558864271
586 2558867016
587 2558867707
588 2585205206
589 2585258064
590 2585268304
591 2585275731
592 2585281744
593 2585334818
594 2585391201
595 2585534392
596 2585553936
597 2585563678
598 2585897380
599 2585908929
600 2585994093
601 2587984252
602 2599413972
603 2599723324
604 2616310042
605 2616311766
606 2616551458
607 2643810872
608 2643858398
609 2643918127
610 2644147392
611 2644192468
612 2644200553
613 2644208162
614 2644238393
615 2644300760
616 2644651920
617 2644658982
618 2657686637
619 2692320941
620 2720617067
621 2725949143
622 2738805200
623 2738805876
624 2753459421
625 2776268190
626 2776283970
627 2778176768
628 2778179991
629 2778180297
630 2792623752
631 2792624680
632 2792630015
633 2792630800
634 2792641093
635 2792642041
636 2793283262
637 2793298071
638 2793343376
639 2793343567
640 2793363138
641 2793363446
642 2793364261
643 2802721037
644 2802728125
645 2802733591
646 2802736664
647 2802746732
648 2802749771
649 2804750496
650 2805931154
651 2805936956
652 2805937706
653 2806048257
654 2806055725
655 2806062560
656 2806070902
657 2806076290
658 2819688121
659 2821128897
660 2838033488
661 2838034520
662 2838042541
663 2838080831
664 2838668385
665 2838691060
666 2841856376
667 2842083227
668 2842117298
669 2842202712
670 2842275535
671 2842290221
672 2842302335
673 2842303816
674 2842324047
675 2842363293
676 2842402003
677 2842407955
678 2842408271
679 2842414542
680 2842414633
681 2842421022
682 2842421612
683 2842480241
684 2842481267
685 2842488245
686 2842488554
687 2842494733
688 2842507653
689 2842508148
690 2842513971
691 2842514813
692 2842524146
693 2842526946
694 2844461925
695 2844462251
696 2847421863
697 2848996636
698 2850083351
699 2854911457
700 2855876216
701 2857524276
702 2857537245
703 2888387960
704 2903776791
705 2913298781
706 2915986714
707 2916064163
708 2916072060
709 2919107361
710 2920762320
711 2921254081
712 2921296164
713 2924171041
714 2924226706
715 2933023043
716 2933590020
717 2935713072
718 2936001783
719 2937035492
720 2937039919
721 2937078943
722 2937087478
723 2957376333
724 2957429311
725 2957440506
726 2960597371
727 2960636564
728 2960651024
729 2960686075
730 2960695818
731 2967690986
732 2967713035
733 2967733693
734 2970029035
735 2970125129
736 2970141385
737 2970148076
738 2977533377
739 2977548866
740 2989780900
741 2996889810
742 3005410234
743 639651344
744 643692049
745 8003574978
746 8003575139
747 8003999213
748 8004005294
749 8005301748
750 8005324337
751 8005402179
752 8005465961
753 8005488248
754 8005549966
755 8005693072
756 8018153807
757 8018179067
758 8019586544
759 8019597528
760 8019607726
761 8019619096
762 8046767824
763 8046770035
764 8057581437
765 8057880205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map