F429781

General Info

Members Datasets Scaffolds Average Seq Length
384 278 276 327

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1000352|JGI25159J45721_10003529
Length 383
Sequence MNTVWHRSSNAFVYCRLLSYSYVTQLRSWSFAIGLSALWAAGSALAIFITNGDIFMRHHAFGRTPFIVTDVGFGAWQIGGAWGDVSEADGRAALNAALDAGMTFIDTADVYGDGRSEKIIADVLKARGGTRPMVATKAGRRLNPHVADGYNKANLEGFIDRSLKNLGVDSLDLVQLHCPPTEVLYRPEVFAGLDELQKAGKIKGYGVSVSNVEEALKAIEYPGVLSIQIIYNIFRQRPDHLFFKEAKRRQVAVIARVPLASGLLSGKITRDTQFASDDHRNFNRHGEAFDVGETFAGVPFDVGLQAVEEVRKLVPAGASMAAFALRWILMNEAVTVVIPGARNAEQAKANAAAADLAPLSVDVMSATREIYERLIAPHVHHRW

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
7 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
8 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
9 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
10 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
11 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
12 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
13 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
14 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
15 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
16 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
17 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
18 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
19 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
20 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
21 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
22 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
23 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
24 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
25 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
26 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
27 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
28 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
29 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
30 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
31 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
32 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
33 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
34 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
35 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
36 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
37 2643221599 Rhizobium sp. Root708 Isolate Unclassified
38 2643221616 Leifsonia sp. Root227 Isolate Unclassified
39 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
40 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
41 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
42 2643221719 Rhizobium sp. Root274 Isolate Unclassified
43 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
44 2738541293 Rhizobium sp. GV031 Isolate Unclassified
45 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
46 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
47 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
48 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
49 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
50 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
51 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
52 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
53 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
54 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
55 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
56 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
57 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
58 2838061910 Rhizobium phaseoli L15 Isolate Nodule
59 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
60 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
61 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
62 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
63 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
64 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
65 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
66 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
67 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
68 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
69 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
70 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
71 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
72 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
73 2865014394 Pantoea sp. R-71966 Isolate Unclassified
74 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
75 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
76 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
77 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
78 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
79 2909042592 Labrys sp. LIt4 Isolate Nodule
80 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
81 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
82 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
83 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
84 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
85 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
86 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
87 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
88 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
89 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
90 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
91 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
92 2996887358 Rhizobium sp. R711 Isolate Nodule
93 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
94 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
95 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
96 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
97 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
98 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
99 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
100 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
101 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
102 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
103 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
104 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
105 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
106 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
107 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
108 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
109 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
110 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
111 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
112 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
113 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
114 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
115 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
116 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
117 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
118 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
119 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
120 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
121 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
122 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
123 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
124 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
125 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
126 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
127 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
128 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
129 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
132 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
133 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
134 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
135 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
136 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
152 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
158 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
159 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
205 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
206 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
207 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
208 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
256 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
269 8005258706 Rhizobium sp. R693 Isolate Nodule
270 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
271 8005321885 Rhizobium sp. R72 Isolate Nodule
272 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
273 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
274 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
275 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
276 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
277 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
278 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.57
Metatranscriptomes 1.3
Isolates 28.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.78
Nodule 8.33
Rhizoplane 1.82
Rhizosphere 40.36
Stem 0
Stem Tuber 0
Unclassified 23.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004261 3300001979 Bacteria 6166
2 JGI24735J21928_10003838 3300002067 Bacteria 5087
3 JGI25155J39150_1000019 3300002704 Bacteria 155636
4 JGI25156J39149_1000020 3300002705 Bacteria 156628
5 JGI25162J39368_1000362 3300002737 Bacteria 38716
6 JGI25162J39368_1000480 3300002737 Bacteria 30622
7 JGI25154J39366_1000102 3300002738 Bacteria 76188
8 JGI25158J39367_1000394 3300002739 Bacteria 9200
9 JGI25157J39369_1000070 3300002741 Bacteria 92090
10 JGI25152J39213_1001290 3300002773 Bacteria 11230
11 JGI25152J39213_1002006 3300002773 Bacteria 8023
12 JGI25152J39213_1003101 3300002773 Bacteria 5809
13 JGI25152J39213_1004791 3300002773 Bacteria 4151
14 JGI25152J39213_1010280 3300002773 Bacteria 2156
15 JGI25150J39212_1000043 3300002774 Bacteria 84082
16 JGI25150J39212_1006123 3300002774 Bacteria 2511
17 JGI25159J45721_1000221 3300002987 Bacteria 26974
18 JGI25159J45721_1000352 3300002987 Bacteria 21241
19 JGI25151J46595_10000371 3300003187 Bacteria 47027
20 JGI25151J46595_10004286 3300003187 Bacteria 7582
21 JGI25165J46597_1000817 3300003214 Bacteria 23407
22 JGI25165J46597_1001629 3300003214 Bacteria 10550
23 JGI25153J46596_10005345 3300003215 Bacteria 6744
24 JGI25153J46596_10010602 3300003215 Bacteria 4151
25 JGI25153J46596_10016066 3300003215 Bacteria 3019
26 JGI25153J46596_10024788 3300003215 Bacteria 2156
27 rootH1_10051441 3300003316 Bacteria 4541
28 rootL2_10003150 3300003322 Bacteria 24160
29 JGI25160J50197_1000015 3300003354 Bacteria 250902
30 JGI25161J50226_1000005 3300003374 Bacteria 292548
31 JGI25161J50226_1000314 3300003374 Bacteria 26620
32 Ga0055526_1001050 3300003771 Bacteria 20158
33 Ga0055524_1000134 3300003775 Bacteria 87367
34 Ga0055524_1005169 3300003775 Bacteria 5881
35 Ga0055528_1006331 3300003790 Bacteria 5381
36 Ga0055528_1009522 3300003790 Bacteria 4047
37 Ga0055540_1012179 3300003792 Bacteria 2718
38 Ga0055540_1019106 3300003792 Bacteria 1857
39 Ga0055531_10001965 3300003794 Bacteria 14344
40 Ga0058692_1011314 3300003856 Bacteria 2163
41 Ga0058692_1017623 3300003856 Bacteria 1564
42 Ga0055543_1000012 3300004625 Bacteria 186581
43 Ga0055543_1000525 3300004625 Bacteria 21838
44 Ga0065165_1012357 3300005262 Bacteria 3483
45 Ga0070668_100349614 3300005347 Bacteria 1251
46 Ga0070669_100096540 3300005353 Bacteria 2224
47 Ga0070671_100054396 3300005355 Bacteria 3328
48 Ga0070710_10005288 3300005437 Bacteria 6121
49 Ga0070662_100000338 3300005457 Bacteria 28051
50 Ga0068853_100146433 3300005539 Bacteria 2123
51 Ga0070665_100007335 3300005548 Bacteria 11217
52 Ga0070665_100087864 3300005548 Bacteria 3114
53 Ga0068855_100000036 3300005563 Bacteria 162849
54 Ga0068856_100029438 3300005614 Bacteria 5364
55 Ga0068866_10067263 3300005718 Bacteria 1880
56 Ga0081455_10056282 3300005937 Bacteria 3340
57 Ga0081455_10192867 3300005937 Bacteria 1532
58 Ga0075365_10038463 3300006038 Bacteria 3110
59 Ga0075363_100215744 3300006048 Bacteria 1099
60 Ga0075367_10004677 3300006178 Bacteria 6718
61 Ga0105251_10013525 3300009011 Bacteria 4561
62 Ga0105251_10031811 3300009011 Bacteria 2636
63 Ga0105247_10115096 3300009101 Bacteria 1735
64 Ga0105237_10004692 3300009545 Bacteria 15730
65 Ga0105237_10026072 3300009545 Bacteria 5974
66 Ga0105246_10002013 3300011119 Bacteria 12279
67 Ga0157373_10092330 3300013100 Bacteria 2132
68 Ga0157371_10089360 3300013102 Bacteria 2182
69 Ga0157370_10011166 3300013104 Bacteria 9416
70 Ga0157369_10002666 3300013105 Bacteria 21298
71 Ga0157372_10033066 3300013307 Bacteria 5677
72 Ga0182008_10047741 3300014497 Bacteria 2127
73 Ga0182006_1012747 3300015261 Bacteria 3672
74 Ga0182007_10007837 3300015262 Bacteria 4440
75 Ga0182007_10017197 3300015262 Bacteria 2649
76 Ga0182005_1003803 3300015265 Bacteria 5014
77 Ga0209435_100024 3300025206 Bacteria 199665
78 Ga0209760_103846 3300025207 Bacteria 1316
79 Ga0209436_100872 3300025208 Bacteria 12064
80 Ga0209436_108189 3300025208 Bacteria 2104
81 Ga0209672_102880 3300025228 Bacteria 3863
82 Ga0209437_100033 3300025233 Bacteria 512520
83 Ga0209437_100075 3300025233 Bacteria 297202
84 Ga0209437_100136 3300025233 Bacteria 176190
85 Ga0207425_1000010 3300025245 Bacteria 572898
86 Ga0207425_1002019 3300025245 Bacteria 7563
87 Ga0209646_1000064 3300025246 Bacteria 246524
88 Ga0209646_1002737 3300025246 Bacteria 3746
89 Ga0209026_1000053 3300025250 Bacteria 246524
90 Ga0209677_100427 3300025253 Bacteria 24843
91 Ga0209759_1000042 3300025256 Bacteria 246524
92 Ga0209129_1000034 3300025258 Bacteria 330950
93 Ga0209129_1000551 3300025258 Bacteria 25967
94 Ga0209129_1000680 3300025258 Bacteria 22439
95 Ga0209129_1001666 3300025258 Bacteria 12027
96 Ga0209129_1004043 3300025258 Bacteria 5986
97 Ga0209233_1000064 3300025261 Bacteria 392156
98 Ga0209233_1000223 3300025261 Bacteria 103765
99 Ga0209233_1000318 3300025261 Bacteria 53563
100 Ga0209565_1003376 3300025263 Bacteria 5201
101 Ga0209673_1000041 3300025273 Bacteria 307397
102 Ga0209673_1002512 3300025273 Bacteria 12595
103 Ga0209673_1008920 3300025273 Bacteria 4409
104 Ga0209673_1011617 3300025273 Bacteria 3616
105 Ga0209130_1000006 3300025284 Bacteria 596528
106 Ga0209130_1000018 3300025284 Bacteria 388301
107 Ga0209025_1000022 3300025294 Bacteria 574487
108 Ga0209025_1001237 3300025294 Bacteria 35478
109 Ga0209025_1003582 3300025294 Bacteria 14516
110 Ga0209025_1007887 3300025294 Bacteria 7807
111 Ga0209025_1016884 3300025294 Bacteria 4261
112 Ga0209025_1035237 3300025294 Bacteria 2265
113 Ga0209564_1001524 3300025295 Bacteria 23030
114 Ga0209758_1000574 3300025297 Bacteria 57479
115 Ga0209758_1000584 3300025297 Bacteria 56878
116 Ga0209758_1002529 3300025297 Bacteria 18472
117 Ga0209758_1004868 3300025297 Bacteria 10818
118 Ga0209758_1011488 3300025297 Bacteria 5118
119 Ga0209050_1013200 3300025298 Bacteria 3695
120 Ga0209256_1000005 3300025299 Bacteria 1315082
121 Ga0209256_1000404 3300025299 Bacteria 68364
122 Ga0209256_1006911 3300025299 Bacteria 5808
123 Ga0209256_1014084 3300025299 Bacteria 2910
124 Ga0207426_1000044 3300025302 Bacteria 428043
125 Ga0207426_1000231 3300025302 Bacteria 128171
126 Ga0207426_1000894 3300025302 Bacteria 30172
127 Ga0209051_1001436 3300025303 Bacteria 20324
128 Ga0209051_1012915 3300025303 Bacteria 4009
129 Ga0209257_1010952 3300025304 Bacteria 4469
130 Ga0207696_1001032 3300025711 Bacteria 16600
131 Ga0207655_1001569 3300025728 Bacteria 20562
132 Ga0207713_1000043 3300025735 Bacteria 241808
133 Ga0207671_10000125 3300025914 Bacteria 119263
134 Ga0207671_10023454 3300025914 Bacteria 4653
135 Ga0207644_10050530 3300025931 Bacteria 2981
136 Ga0207689_10084357 3300025942 Bacteria 2611
137 Ga0207667_10000007 3300025949 Bacteria 630590
138 Ga0207668_10043463 3300025972 Bacteria 3049
139 Ga0207639_10103365 3300026041 Bacteria 2308
140 Ga0207675_100024447 3300026118 Bacteria 5617
141 Ga0207698_10054132 3300026142 Bacteria 3086
142 Ga0209371_1000420 3300027312 Bacteria 43659
143 Ga0209371_1000491 3300027312 Bacteria 38538
144 Ga0209371_1004524 3300027312 Bacteria 5980
145 Ga0268266_10004566 3300028379 Bacteria 13232
146 Ga0268266_10087814 3300028379 Bacteria 2721
147 Ga0268266_10162150 3300028379 Bacteria 2024
148 Ga0268256_1000408 3300030500 Bacteria 39051
149 Ga0268256_1000415 3300030500 Bacteria 38538
150 Ga0268256_1002736 3300030500 Bacteria 8617
151 Ga0265340_10000328 3300031247 Bacteria 25179
152 Ga0307513_10026062 3300031456 Bacteria 6751
153 Ga0265314_10004941 3300031711 Bacteria 12173
154 Ga0307405_10004781 3300031731 Bacteria 6458
155 Ga0307406_10223494 3300031901 Bacteria 1401
156 Ga0307412_10006042 3300031911 Bacteria 6817
157 Ga0307510_10088838 3300033180 Bacteria 2947
158 Ga0373960_0017862 3300035121 Bacteria 1843
159 Ga0373927_0000330 3300035695 Bacteria 37192
160 Ga0373925_0000612 3300037068 Bacteria 34051
161 Ga0436360_0132815 3300039438 Bacteria 3113
162 Ga0439439_0004630 3300041406 Bacteria 3110
163 Ga0439447_003022 3300041407 Bacteria 6020
164 Ga0439466_0000011 3300041411 Bacteria 221134
165 Ga0439432_012361 3300042006 Bacteria 2923
166 Ga0439449_0038708 3300042007 Bacteria 1773
167 Ga0439457_000484 3300042014 Bacteria 11509
168 Ga0450894_000017 3300042131 Bacteria 23709
169 Ga0450896_003660 3300042133 Bacteria 2056
170 Ga0450906_000651 3300042145 Bacteria 7431
171 Ga0450907_000007 3300042146 Bacteria 111445
172 Ga0466969_0019884 3300044656 Bacteria 3482
173 Ga0466972_0003134 3300044658 Bacteria 8212
174 Ga0466961_0040435 3300044693 Bacteria 2990
175 Ga0466968_0025215 3300044735 Bacteria 2434
176 Ga0466970_0002529 3300044765 Bacteria 8823
177 Ga0466959_0192132 3300045049 Bacteria 1424
178 Ga0451576_0002427 3300045051 Bacteria 27898
179 Ga0466967_0000815 3300045976 Bacteria 16361
180 Ga0495591_011811 3300046458 Bacteria 3285
181 Ga0495629_0003725 3300046459 Bacteria 11490
182 Ga0495585_0007039 3300046492 Bacteria 6921
183 Ga0495583_0004899 3300046506 Bacteria 9319
184 Ga0495606_0078078 3300046507 Bacteria 2066
185 Ga0495610_0005030 3300046512 Bacteria 9554
186 Ga0495610_0078579 3300046512 Bacteria 1521
187 Ga0495632_0005238 3300046519 Bacteria 8629
188 Ga0495648_0001492 3300046524 Bacteria 22900
189 Ga0495656_0006735 3300046615 Bacteria 4035
190 Ga0495625_0002763 3300046660 Bacteria 18534
191 Ga0495670_0059769 3300046691 Bacteria 1914
192 Ga0495660_0007047 3300046810 Bacteria 6625
193 Ga0495660_0133763 3300046810 Bacteria 1241
194 Ga0495604_0002436 3300047317 Bacteria 14887
195 Ga0495672_0000014 3300047320 Bacteria 505636
196 Ga0495672_0000040 3300047320 Bacteria 268573
197 Ga0495679_007014 3300047446 Bacteria 4762
198 Ga0495681_0030286 3300047470 Bacteria 2758
199 Ga0496102_0006448 3300048905 Bacteria 10006
200 Ga0496102_0030202 3300048905 Bacteria 4850
201 Ga0496102_0390098 3300048905 Bacteria 1310
202 Ga0496103_0175100 3300048906 Bacteria 1378
203 Ga0496105_0176226 3300048908 Bacteria 1751
204 Ga0496116_0014859 3300048919 Bacteria 6186
205 Ga0496116_0022182 3300048919 Bacteria 4765
206 Ga0496116_0027511 3300048919 Bacteria 4139
207 Ga0496116_0037247 3300048919 Bacteria 3394
208 Ga0496116_0043128 3300048919 Bacteria 3076
209 Ga0496117_0000092 3300048920 Bacteria 202608
210 Ga0496117_0001422 3300048920 Bacteria 34682
211 Ga0496117_0003267 3300048920 Bacteria 19056
212 Ga0496118_0000053 3300048921 Bacteria 235810
213 Ga0496118_0000684 3300048921 Bacteria 55100
214 Ga0496118_0001643 3300048921 Bacteria 32954
215 Ga0496118_0014029 3300048921 Bacteria 7525
216 Ga0496119_0000581 3300048922 Bacteria 49342
217 Ga0496119_0000925 3300048922 Bacteria 37980
218 Ga0496119_0010990 3300048922 Bacteria 7557
219 Ga0496119_0042885 3300048922 Bacteria 2864
220 Ga0496120_0000548 3300048923 Bacteria 57387
221 Ga0496120_0001005 3300048923 Bacteria 37980
222 Ga0496120_0030377 3300048923 Bacteria 3285
223 Ga0496120_0075411 3300048923 Bacteria 1841
224 Ga0496121_0000114 3300048924 Bacteria 179427
225 Ga0496121_0000304 3300048924 Bacteria 102259
226 Ga0496121_0010958 3300048924 Bacteria 10125
227 Ga0496121_0023553 3300048924 Bacteria 5923
228 Ga0496121_0044597 3300048924 Bacteria 3823
229 Ga0496122_0003926 3300048925 Bacteria 19018
230 Ga0496122_0024723 3300048925 Bacteria 5247
231 Ga0496122_0032002 3300048925 Bacteria 4359
232 Ga0496123_0005600 3300048926 Bacteria 12556
233 Ga0496123_0010020 3300048926 Bacteria 8442
234 Ga0496123_0015511 3300048926 Bacteria 6244
235 Ga0496123_0061452 3300048926 Bacteria 2413
236 Ga0496124_0000251 3300048927 Bacteria 103690
237 Ga0496124_0016418 3300048927 Bacteria 7040
238 Ga0496124_0036255 3300048927 Bacteria 4304
239 Ga0496124_0042415 3300048927 Bacteria 3918
240 Ga0496124_0075651 3300048927 Bacteria 2781
241 Ga0496124_0097813 3300048927 Bacteria 2382
242 Ga0496125_0006731 3300048928 Bacteria 12351
243 Ga0496125_0036695 3300048928 Bacteria 4273
244 Ga0496126_0042983 3300048929 Bacteria 4171
245 Ga0496126_0085013 3300048929 Bacteria 2789
246 Ga0496126_0125019 3300048929 Bacteria 2227
247 Ga0501034_0023868 3300049571 Bacteria 6227
248 Ga0501039_0127431 3300049575 Bacteria 1997
249 Ga0501072_0203837 3300049588 Bacteria 1577
250 Ga0501083_0012314 3300049744 Bacteria 5986
251 Ga0501083_0016076 3300049744 Bacteria 5240
252 Ga0501083_0016994 3300049744 Bacteria 5079
253 Ga0501083_0054158 3300049744 Bacteria 2692
254 nmdc:mga0yw44_8208_c1 3300050492 Bacteria 5188
255 Ga0500618_004661 3300053125 Bacteria 4320
256 Ga0500559_0000052 3300053136 Bacteria 91218
257 Ga0500568_0013377 3300053139 Bacteria 3742
258 Ga0500568_0035959 3300053139 Bacteria 2018
259 Ga0500573_0000031 3300053140 Bacteria 134098
260 Ga0500573_0000316 3300053140 Bacteria 20485
261 Ga0500573_0034306 3300053140 Bacteria 2927
262 Ga0500573_0083996 3300053140 Bacteria 1807
263 Ga0500573_0126367 3300053140 Bacteria 1419
264 Ga0500590_000598 3300053148 Bacteria 12803
265 Ga0500616_0000116 3300053153 Bacteria 145790
266 Ga0500616_0000297 3300053153 Bacteria 72449
267 Ga0500622_0004153 3300053156 Bacteria 9268
268 Ga0501084_0018697 3300054114 Bacteria 5769
269 Ga0587106_007402 3300059605 Bacteria 1331
270 Ga0587072_008100 3300059643 Bacteria 1655
271 Ga0587076_004365 3300059645 Bacteria 1760
272 Ga0587079_014852 3300059647 Bacteria 1313
273 Ga0587114_006474 3300059655 Bacteria 1311
274 Ga0501082_0108406 3300060353 Bacteria 2403
275 Ga0466962_0078951 3300061719 Bacteria 1573
276 Ga0530510_0179367 3300061734 Bacteria 1570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035121 Ga0373960_0017862 Ga0373960_0017862_513_1484 302
2 3300035695 Ga0373927_0000330 Ga0373927_0000330_12605_13576 302
3 3300037068 Ga0373925_0000612 Ga0373925_0000612_1999_2970 302
4 3300031711 Ga0265314_10004941 Ga0265314_100049412 304
5 3300044656 Ga0466969_0019884 Ga0466969_0019884_2410_3393 309
6 3300044658 Ga0466972_0003134 Ga0466972_0003134_557_1540 310
7 3300044693 Ga0466961_0040435 Ga0466961_0040435_903_1886 310
8 3300044735 Ga0466968_0025215 Ga0466968_0025215_1245_2228 310
9 3300045049 Ga0466959_0192132 Ga0466959_0192132_80_1063 310
10 3300061719 Ga0466962_0078951 Ga0466962_0078951_245_1228 310
11 3300031456 Ga0307513_10026062 Ga0307513_100260622 313
12 3300049575 Ga0501039_0127431 Ga0501039_0127431_142_1095 313
13 3300049588 Ga0501072_0203837 Ga0501072_0203837_337_1290 313
14 3300061734 Ga0530510_0179367 Ga0530510_0179367_21_974 313
15 3300042007 Ga0439449_0038708 Ga0439449_0038708_667_1659 316
16 3300048905 Ga0496102_0390098 Ga0496102_0390098_330_1283 316
17 3300005539 Ga0068853_100146433 Ga0068853_1001464332 321
18 3300026041 Ga0207639_10103365 Ga0207639_101033652 321
19 3300045976 Ga0466967_0000815 Ga0466967_0000815_15130_16101 323
20 iso_pu_bacteria 2643221616 2644096738 323
21 iso_pu_bacteria 2784746763 2785339133 323
22 iso_pu_bacteria 2862382967 2862389757 323
23 iso_pu_bacteria 2863404153 2863410787 323
24 iso_pu_bacteria 2891048133 2891052202 323
25 iso_pu_bacteria 2923556063 2923560766 323
26 iso_pu_bacteria 2990059506 2990066893 323
27 iso_pu_bacteria 8008558824 8008564837 323
28 iso_pu_bacteria 8048406513 8048407550 323
29 iso_pu_bacteria 2510461069 2510841673 324
30 iso_pu_bacteria 2510917022 2511133335 324
31 iso_pu_bacteria 2510917026 2511169113 324
32 iso_pu_bacteria 2510917028 2511183299 324
33 iso_pu_bacteria 2510917030 2511197051 324
34 iso_pu_bacteria 2513237088 2513599812 324
35 iso_pu_bacteria 2513237138 2513866810 324
36 iso_pu_bacteria 2513237144 2513908775 324
37 iso_pu_bacteria 2513237146 2513925835 324
38 iso_pu_bacteria 2523231067 2523467385 324
39 iso_pu_bacteria 2524023209 2524461421 324
40 iso_pu_bacteria 2534681796 2535515917 324
41 iso_pu_bacteria 2582581294 2585199665 324
42 iso_pu_bacteria 2582581298 2585221223 324
43 iso_pu_bacteria 2582581299 2585231259 324
44 iso_pu_bacteria 2582581304 2585254134 324
45 iso_pu_bacteria 2582581307 2585273129 324
46 iso_pu_bacteria 2582581308 2585279034 324
47 iso_pu_bacteria 2582581315 2585325346 324
48 iso_pu_bacteria 2582581316 2585329427 324
49 iso_pu_bacteria 2582581867 2585400442 324
50 iso_pu_bacteria 2585427527 2585530830 324
51 iso_pu_bacteria 2585427529 2585549425 324
52 iso_pu_bacteria 2585427530 2585555011 324
53 iso_pu_bacteria 2585427531 2585559572 324
54 iso_pu_bacteria 2585427590 2585824451 324
55 iso_pu_bacteria 2585427608 2585902241 324
56 iso_pu_bacteria 2585427609 2585905052 324
57 iso_pu_bacteria 2585427633 2585995251 324
58 iso_pu_bacteria 2585427634 2585999804 324
59 iso_pu_bacteria 2585428125 2587979833 324
60 iso_pu_bacteria 2599185170 2599418457 324
61 iso_pu_bacteria 2608642108 2608671627 324
62 iso_pu_bacteria 2615840626 2616305694 324
63 iso_pu_bacteria 2615840698 2616554071 324
64 iso_pu_bacteria 2617270742 2617384258 324
65 iso_pu_bacteria 2643221599 2644006106 324
66 iso_pu_bacteria 2643221634 2644191349 324
67 iso_pu_bacteria 2643221643 2644238841 324
68 iso_pu_bacteria 2643221653 2644296700 324
69 iso_pu_bacteria 2643221719 2644654954 324
70 iso_pu_bacteria 2667528174 2671114900 324
71 iso_pu_bacteria 2738541293 2738799554 324
72 iso_pu_bacteria 2738541317 2738946411 324
73 iso_pu_bacteria 2738543031 2739347823 324
74 iso_pu_bacteria 2775507266 2778177613 324
75 iso_pu_bacteria 2808606386 2808981833 324
76 iso_pu_bacteria 2808606415 2809131461 324
77 iso_pu_bacteria 2808606419 2809151083 324
78 iso_pu_bacteria 2818991272 2819242397 324
79 iso_pu_bacteria 2818991448 2819611464 324
80 iso_pu_bacteria 2818991449 2819614069 324
81 iso_pu_bacteria 2818991453 2819639121 324
82 iso_pu_bacteria 2838029111 2838035298 324
83 iso_pu_bacteria 2838035591 2838037850 324
84 iso_pu_bacteria 2838061910 2838063480 324
85 iso_pu_bacteria 2838661181 2838662849 324
86 iso_pu_bacteria 2842298080 2842302740 324
87 iso_pu_bacteria 2842357229 2842361279 324
88 iso_pu_bacteria 2842447887 2842452700 324
89 iso_pu_bacteria 2842475841 2842482038 324
90 iso_pu_bacteria 2842482326 2842482976 324
91 iso_pu_bacteria 2842502639 2842508905 324
92 iso_pu_bacteria 2842509118 2842509848 324
93 iso_pu_bacteria 2844528606 2844532346 324
94 iso_pu_bacteria 2852387548 2852389225 324
95 iso_pu_bacteria 2852618963 2852622637 324
96 iso_pu_bacteria 2854916844 2854922056 324
97 iso_pu_bacteria 2865014394 2865014942 324
98 iso_pu_bacteria 2895498888 2895500584 324
99 iso_pu_bacteria 2895522137 2895523536 324
100 iso_pu_bacteria 2899275550 2899277706 324
101 iso_pu_bacteria 2899803654 2899803917 324
102 iso_pu_bacteria 2909042592 2909043282 324
103 iso_pu_bacteria 2913308742 2913310825 324
104 iso_pu_bacteria 2919100787 2919103985 324
105 iso_pu_bacteria 2919171160 2919171280 324
106 iso_pu_bacteria 2919408235 2919409438 324
107 iso_pu_bacteria 2933016740 2933020448 324
108 iso_pu_bacteria 2945951305 2945955200 324
109 iso_pu_bacteria 2978975091 2978977678 324
110 iso_pu_bacteria 2989349275 2989354013 324
111 iso_pu_bacteria 2989771324 2989772274 324
112 iso_pu_bacteria 2989776772 2989778322 324
113 iso_pu_bacteria 2996887358 2996888892 324
114 iso_pu_bacteria 3003930520 3003932835 324
115 iso_pu_bacteria 3005409236 3005412587 324
116 iso_pu_bacteria 3005416602 3005419596 324
117 iso_pu_bacteria 3005445848 3005446893 324
118 iso_pu_bacteria 3005452660 3005453687 324
119 iso_pu_bacteria 8005246636 8005251174 324
120 iso_pu_bacteria 8005258706 8005260163 324
121 iso_pu_bacteria 8005314921 8005317632 324
122 iso_pu_bacteria 8005321885 8005323419 324
123 iso_pu_bacteria 8005542996 8005544555 324
124 iso_pu_bacteria 8005645114 8005649980 324
125 iso_pu_bacteria 8005682033 8005686706 324
126 iso_pu_bacteria 8024486573 8024489613 324
127 iso_pu_bacteria 8056875544 8056879458 324
128 3300005437 Ga0070710_10005288 Ga0070710_100052887 327
129 3300005937 Ga0081455_10056282 Ga0081455_100562823 327
130 3300039438 Ga0436360_0132815 Ga0436360_0132815_1796_2779 327
131 3300041406 Ga0439439_0004630 Ga0439439_0004630_53_1036 327
132 3300042014 Ga0439457_000484 Ga0439457_000484_6203_7186 327
133 3300042131 Ga0450894_000017 Ga0450894_000017_17025_18008 327
134 3300042133 Ga0450896_003660 Ga0450896_003660_790_1773 327
135 3300042145 Ga0450906_000651 Ga0450906_000651_5557_6540 327
136 3300044765 Ga0466970_0002529 Ga0466970_0002529_3372_4355 327
137 3300049744 Ga0501083_0054158 Ga0501083_0054158_530_1513 327
138 3300053136 Ga0500559_0000052 Ga0500559_0000052_15840_16826 327
139 3300053140 Ga0500573_0000031 Ga0500573_0000031_100364_101350 327
140 3300053140 Ga0500573_0034306 Ga0500573_0034306_1261_2247 327
141 3300053140 Ga0500573_0083996 Ga0500573_0083996_315_1301 327
142 3300053140 Ga0500573_0126367 Ga0500573_0126367_188_1174 327
143 3300001979 JGI24740J21852_10004261 JGI24740J21852_100042613 328
144 3300002067 JGI24735J21928_10003838 JGI24735J21928_100038381 328
145 3300002704 JGI25155J39150_1000019 JGI25155J39150_100001979 328
146 3300002705 JGI25156J39149_1000020 JGI25156J39149_100002092 328
147 3300002737 JGI25162J39368_1000362 JGI25162J39368_100036212 328
148 3300002737 JGI25162J39368_1000480 JGI25162J39368_100048011 328
149 3300002738 JGI25154J39366_1000102 JGI25154J39366_100010279 328
150 3300002739 JGI25158J39367_1000394 JGI25158J39367_10003942 328
151 3300002741 JGI25157J39369_1000070 JGI25157J39369_100007079 328
152 3300002773 JGI25152J39213_1001290 JGI25152J39213_100129013 328
153 3300002773 JGI25152J39213_1002006 JGI25152J39213_10020062 328
154 3300002773 JGI25152J39213_1003101 JGI25152J39213_10031014 328
155 3300002773 JGI25152J39213_1004791 JGI25152J39213_10047914 328
156 3300002773 JGI25152J39213_1010280 JGI25152J39213_10102802 328
157 3300002774 JGI25150J39212_1000043 JGI25150J39212_100004348 328
158 3300002774 JGI25150J39212_1006123 JGI25150J39212_10061232 328
159 3300002987 JGI25159J45721_1000221 JGI25159J45721_10002212 328
160 3300002987 JGI25159J45721_1000352 JGI25159J45721_10003529 328
161 3300003187 JGI25151J46595_10000371 JGI25151J46595_1000037140 328
162 3300003187 JGI25151J46595_10004286 JGI25151J46595_1000428612 328
163 3300003214 JGI25165J46597_1000817 JGI25165J46597_100081711 328
164 3300003214 JGI25165J46597_1001629 JGI25165J46597_10016295 328
165 3300003215 JGI25153J46596_10005345 JGI25153J46596_100053455 328
166 3300003215 JGI25153J46596_10010602 JGI25153J46596_100106024 328
167 3300003215 JGI25153J46596_10016066 JGI25153J46596_100160663 328
168 3300003215 JGI25153J46596_10024788 JGI25153J46596_100247882 328
169 3300003316 rootH1_10051441 rootH1_100514413 328
170 3300003322 rootL2_10003150 rootL2_1000315015 328
171 3300003354 JGI25160J50197_1000015 JGI25160J50197_1000015138 328
172 3300003374 JGI25161J50226_1000005 JGI25161J50226_1000005102 328
173 3300003374 JGI25161J50226_1000314 JGI25161J50226_100031415 328
174 3300003771 Ga0055526_1001050 Ga0055526_100105016 328
175 3300003775 Ga0055524_1000134 Ga0055524_100013477 328
176 3300003775 Ga0055524_1005169 Ga0055524_10051693 328
177 3300003790 Ga0055528_1006331 Ga0055528_10063317 328
178 3300003790 Ga0055528_1009522 Ga0055528_10095224 328
179 3300003792 Ga0055540_1012179 Ga0055540_10121792 328
180 3300003792 Ga0055540_1019106 Ga0055540_10191062 328
181 3300003794 Ga0055531_10001965 Ga0055531_1000196510 328
182 3300003856 Ga0058692_1011314 Ga0058692_10113141 328
183 3300003856 Ga0058692_1017623 Ga0058692_10176232 328
184 3300004625 Ga0055543_1000012 Ga0055543_1000012139 328
185 3300004625 Ga0055543_1000525 Ga0055543_10005254 328
186 3300005262 Ga0065165_1012357 Ga0065165_10123574 328
187 3300005347 Ga0070668_100349614 Ga0070668_1003496141 328
188 3300005353 Ga0070669_100096540 Ga0070669_1000965402 328
189 3300005355 Ga0070671_100054396 Ga0070671_1000543962 328
190 3300005457 Ga0070662_100000338 Ga0070662_10000033814 328
191 3300005548 Ga0070665_100007335 Ga0070665_1000073359 328
192 3300005548 Ga0070665_100087864 Ga0070665_1000878644 328
193 3300005563 Ga0068855_100000036 Ga0068855_100000036122 328
194 3300005614 Ga0068856_100029438 Ga0068856_1000294385 328
195 3300005718 Ga0068866_10067263 Ga0068866_100672633 328
196 3300005937 Ga0081455_10192867 Ga0081455_101928671 328
197 3300006038 Ga0075365_10038463 Ga0075365_100384631 328
198 3300006048 Ga0075363_100215744 Ga0075363_1002157441 328
199 3300006178 Ga0075367_10004677 Ga0075367_100046774 328
200 3300009011 Ga0105251_10013525 Ga0105251_100135256 328
201 3300009011 Ga0105251_10031811 Ga0105251_100318112 328
202 3300009101 Ga0105247_10115096 Ga0105247_101150962 328
203 3300009545 Ga0105237_10004692 Ga0105237_100046924 328
204 3300009545 Ga0105237_10026072 Ga0105237_100260722 328
205 3300011119 Ga0105246_10002013 Ga0105246_1000201312 328
206 3300013100 Ga0157373_10092330 Ga0157373_100923302 328
207 3300013102 Ga0157371_10089360 Ga0157371_100893603 328
208 3300013104 Ga0157370_10011166 Ga0157370_100111665 328
209 3300013105 Ga0157369_10002666 Ga0157369_1000266619 328
210 3300013307 Ga0157372_10033066 Ga0157372_100330666 328
211 3300014497 Ga0182008_10047741 Ga0182008_100477412 328
212 3300015261 Ga0182006_1012747 Ga0182006_10127473 328
213 3300015262 Ga0182007_10007837 Ga0182007_100078375 328
214 3300015262 Ga0182007_10017197 Ga0182007_100171972 328
215 3300015265 Ga0182005_1003803 Ga0182005_10038034 328
216 3300025206 Ga0209435_100024 Ga0209435_10002477 328
217 3300025207 Ga0209760_103846 Ga0209760_1038462 328
218 3300025208 Ga0209436_100872 Ga0209436_1008728 328
219 3300025208 Ga0209436_108189 Ga0209436_1081891 328
220 3300025228 Ga0209672_102880 Ga0209672_1028804 328
221 3300025233 Ga0209437_100033 Ga0209437_100033403 328
222 3300025233 Ga0209437_100075 Ga0209437_10007595 328
223 3300025233 Ga0209437_100136 Ga0209437_10013623 328
224 3300025245 Ga0207425_1000010 Ga0207425_100001050 328
225 3300025245 Ga0207425_1002019 Ga0207425_10020194 328
226 3300025246 Ga0209646_1000064 Ga0209646_100006477 328
227 3300025246 Ga0209646_1002737 Ga0209646_10027373 328
228 3300025250 Ga0209026_1000053 Ga0209026_100005377 328
229 3300025253 Ga0209677_100427 Ga0209677_1004277 328
230 3300025256 Ga0209759_1000042 Ga0209759_100004277 328
231 3300025258 Ga0209129_1000034 Ga0209129_1000034292 328
232 3300025258 Ga0209129_1000551 Ga0209129_100055117 328
233 3300025258 Ga0209129_1000680 Ga0209129_100068016 328
234 3300025258 Ga0209129_1001666 Ga0209129_100166613 328
235 3300025258 Ga0209129_1004043 Ga0209129_10040435 328
236 3300025261 Ga0209233_1000064 Ga0209233_100006419 328
237 3300025261 Ga0209233_1000223 Ga0209233_100022381 328
238 3300025261 Ga0209233_1000318 Ga0209233_100031830 328
239 3300025263 Ga0209565_1003376 Ga0209565_10033762 328
240 3300025273 Ga0209673_1000041 Ga0209673_1000041230 328
241 3300025273 Ga0209673_1002512 Ga0209673_100251212 328
242 3300025273 Ga0209673_1008920 Ga0209673_10089202 328
243 3300025273 Ga0209673_1011617 Ga0209673_10116173 328
244 3300025284 Ga0209130_1000006 Ga0209130_1000006387 328
245 3300025284 Ga0209130_1000018 Ga0209130_1000018133 328
246 3300025294 Ga0209025_1000022 Ga0209025_1000022532 328
247 3300025294 Ga0209025_1001237 Ga0209025_100123717 328
248 3300025294 Ga0209025_1003582 Ga0209025_10035826 328
249 3300025294 Ga0209025_1007887 Ga0209025_10078876 328
250 3300025294 Ga0209025_1016884 Ga0209025_10168843 328
251 3300025294 Ga0209025_1035237 Ga0209025_10352372 328
252 3300025295 Ga0209564_1001524 Ga0209564_100152420 328
253 3300025297 Ga0209758_1000574 Ga0209758_100057418 328
254 3300025297 Ga0209758_1000584 Ga0209758_100058450 328
255 3300025297 Ga0209758_1002529 Ga0209758_100252913 328
256 3300025297 Ga0209758_1004868 Ga0209758_10048688 328
257 3300025297 Ga0209758_1011488 Ga0209758_10114886 328
258 3300025298 Ga0209050_1013200 Ga0209050_10132002 328
259 3300025299 Ga0209256_1000005 Ga0209256_1000005629 328
260 3300025299 Ga0209256_1000404 Ga0209256_100040437 328
261 3300025299 Ga0209256_1006911 Ga0209256_10069117 328
262 3300025299 Ga0209256_1014084 Ga0209256_10140843 328
263 3300025302 Ga0207426_1000044 Ga0207426_1000044256 328
264 3300025302 Ga0207426_1000231 Ga0207426_100023135 328
265 3300025302 Ga0207426_1000894 Ga0207426_100089421 328
266 3300025303 Ga0209051_1001436 Ga0209051_10014362 328
267 3300025303 Ga0209051_1012915 Ga0209051_10129152 328
268 3300025304 Ga0209257_1010952 Ga0209257_10109523 328
269 3300025711 Ga0207696_1001032 Ga0207696_100103215 328
270 3300025728 Ga0207655_1001569 Ga0207655_10015697 328
271 3300025735 Ga0207713_1000043 Ga0207713_1000043155 328
272 3300025914 Ga0207671_10000125 Ga0207671_1000012510 328
273 3300025914 Ga0207671_10023454 Ga0207671_100234542 328
274 3300025931 Ga0207644_10050530 Ga0207644_100505302 328
275 3300025942 Ga0207689_10084357 Ga0207689_100843572 328
276 3300025949 Ga0207667_10000007 Ga0207667_10000007367 328
277 3300025972 Ga0207668_10043463 Ga0207668_100434632 328
278 3300026118 Ga0207675_100024447 Ga0207675_1000244473 328
279 3300026142 Ga0207698_10054132 Ga0207698_100541323 328
280 3300027312 Ga0209371_1000420 Ga0209371_100042025 328
281 3300027312 Ga0209371_1000491 Ga0209371_10004913 328
282 3300027312 Ga0209371_1004524 Ga0209371_10045246 328
283 3300028379 Ga0268266_10004566 Ga0268266_100045669 328
284 3300028379 Ga0268266_10087814 Ga0268266_100878144 328
285 3300028379 Ga0268266_10162150 Ga0268266_101621502 328
286 3300030500 Ga0268256_1000408 Ga0268256_100040819 328
287 3300030500 Ga0268256_1000415 Ga0268256_100041534 328
288 3300030500 Ga0268256_1002736 Ga0268256_10027368 328
289 3300031247 Ga0265340_10000328 Ga0265340_100003285 328
290 3300031731 Ga0307405_10004781 Ga0307405_100047812 328
291 3300031901 Ga0307406_10223494 Ga0307406_102234942 328
292 3300031911 Ga0307412_10006042 Ga0307412_100060425 328
293 3300033180 Ga0307510_10088838 Ga0307510_100888381 328
294 3300041407 Ga0439447_003022 Ga0439447_003022_2617_3603 328
295 3300041411 Ga0439466_0000011 Ga0439466_0000011_35909_36895 328
296 3300042006 Ga0439432_012361 Ga0439432_012361_1906_2892 328
297 3300042146 Ga0450907_000007 Ga0450907_000007_80612_81598 328
298 3300045051 Ga0451576_0002427 Ga0451576_0002427_10328_11314 328
299 3300046458 Ga0495591_011811 Ga0495591_011811_949_1935 328
300 3300046459 Ga0495629_0003725 Ga0495629_0003725_975_1961 328
301 3300046492 Ga0495585_0007039 Ga0495585_0007039_284_1270 328
302 3300046506 Ga0495583_0004899 Ga0495583_0004899_3846_4832 328
303 3300046507 Ga0495606_0078078 Ga0495606_0078078_246_1232 328
304 3300046512 Ga0495610_0005030 Ga0495610_0005030_4520_5506 328
305 3300046512 Ga0495610_0078579 Ga0495610_0078579_46_1032 328
306 3300046519 Ga0495632_0005238 Ga0495632_0005238_4444_5430 328
307 3300046524 Ga0495648_0001492 Ga0495648_0001492_11478_12464 328
308 3300046615 Ga0495656_0006735 Ga0495656_0006735_2446_3432 328
309 3300046660 Ga0495625_0002763 Ga0495625_0002763_355_1362 328
310 3300046691 Ga0495670_0059769 Ga0495670_0059769_98_1084 328
311 3300046810 Ga0495660_0007047 Ga0495660_0007047_4831_5817 328
312 3300046810 Ga0495660_0133763 Ga0495660_0133763_154_1140 328
313 3300047317 Ga0495604_0002436 Ga0495604_0002436_4096_5082 328
314 3300047320 Ga0495672_0000014 Ga0495672_0000014_178374_179360 328
315 3300047320 Ga0495672_0000040 Ga0495672_0000040_185353_186339 328
316 3300047446 Ga0495679_007014 Ga0495679_007014_1639_2625 328
317 3300047470 Ga0495681_0030286 Ga0495681_0030286_1190_2176 328
318 3300048905 Ga0496102_0006448 Ga0496102_0006448_425_1411 328
319 3300048905 Ga0496102_0030202 Ga0496102_0030202_937_1923 328
320 3300048906 Ga0496103_0175100 Ga0496103_0175100_128_1114 328
321 3300048908 Ga0496105_0176226 Ga0496105_0176226_749_1735 328
322 3300048919 Ga0496116_0014859 Ga0496116_0014859_4927_5913 328
323 3300048919 Ga0496116_0022182 Ga0496116_0022182_1539_2525 328
324 3300048919 Ga0496116_0027511 Ga0496116_0027511_566_1552 328
325 3300048919 Ga0496116_0037247 Ga0496116_0037247_597_1583 328
326 3300048919 Ga0496116_0043128 Ga0496116_0043128_764_1750 328
327 3300048920 Ga0496117_0000092 Ga0496117_0000092_85285_86271 328
328 3300048920 Ga0496117_0001422 Ga0496117_0001422_31932_32918 328
329 3300048920 Ga0496117_0003267 Ga0496117_0003267_2966_3952 328
330 3300048921 Ga0496118_0000053 Ga0496118_0000053_149540_150526 328
331 3300048921 Ga0496118_0000684 Ga0496118_0000684_26324_27310 328
332 3300048921 Ga0496118_0001643 Ga0496118_0001643_30204_31190 328
333 3300048921 Ga0496118_0014029 Ga0496118_0014029_6220_7206 328
334 3300048922 Ga0496119_0000581 Ga0496119_0000581_46877_47863 328
335 3300048922 Ga0496119_0000925 Ga0496119_0000925_35513_36499 328
336 3300048922 Ga0496119_0010990 Ga0496119_0010990_4363_5460 328
337 3300048922 Ga0496119_0042885 Ga0496119_0042885_115_1101 328
338 3300048923 Ga0496120_0000548 Ga0496120_0000548_54922_55908 328
339 3300048923 Ga0496120_0001005 Ga0496120_0001005_1482_2468 328
340 3300048923 Ga0496120_0030377 Ga0496120_0030377_1455_2441 328
341 3300048923 Ga0496120_0075411 Ga0496120_0075411_181_1167 328
342 3300048924 Ga0496121_0000114 Ga0496121_0000114_109913_110899 328
343 3300048924 Ga0496121_0000304 Ga0496121_0000304_54288_55274 328
344 3300048924 Ga0496121_0010958 Ga0496121_0010958_2897_3883 328
345 3300048924 Ga0496121_0023553 Ga0496121_0023553_2588_3574 328
346 3300048924 Ga0496121_0044597 Ga0496121_0044597_2489_3475 328
347 3300048925 Ga0496122_0003926 Ga0496122_0003926_16450_17436 328
348 3300048925 Ga0496122_0024723 Ga0496122_0024723_603_1700 328
349 3300048925 Ga0496122_0032002 Ga0496122_0032002_978_1964 328
350 3300048926 Ga0496123_0005600 Ga0496123_0005600_7474_8460 328
351 3300048926 Ga0496123_0010020 Ga0496123_0010020_5375_6361 328
352 3300048926 Ga0496123_0015511 Ga0496123_0015511_3553_4650 328
353 3300048926 Ga0496123_0061452 Ga0496123_0061452_819_1805 328
354 3300048927 Ga0496124_0000251 Ga0496124_0000251_13603_14589 328
355 3300048927 Ga0496124_0016418 Ga0496124_0016418_1977_2963 328
356 3300048927 Ga0496124_0036255 Ga0496124_0036255_1314_2300 328
357 3300048927 Ga0496124_0042415 Ga0496124_0042415_2088_3074 328
358 3300048927 Ga0496124_0075651 Ga0496124_0075651_1775_2761 328
359 3300048927 Ga0496124_0097813 Ga0496124_0097813_881_1867 328
360 3300048928 Ga0496125_0006731 Ga0496125_0006731_9470_10456 328
361 3300048928 Ga0496125_0036695 Ga0496125_0036695_1047_2033 328
362 3300048929 Ga0496126_0042983 Ga0496126_0042983_221_1207 328
363 3300048929 Ga0496126_0085013 Ga0496126_0085013_39_1025 328
364 3300048929 Ga0496126_0125019 Ga0496126_0125019_83_1069 328
365 3300049571 Ga0501034_0023868 Ga0501034_0023868_1294_2280 328
366 3300049744 Ga0501083_0012314 Ga0501083_0012314_2683_3669 328
367 3300049744 Ga0501083_0016076 Ga0501083_0016076_2101_3087 328
368 3300049744 Ga0501083_0016994 Ga0501083_0016994_3810_4796 328
369 3300050492 nmdc:mga0yw44_8208_c1 nmdc:mga0yw44_8208_c1_114_1100 328
370 3300053125 Ga0500618_004661 Ga0500618_004661_566_1552 328
371 3300053139 Ga0500568_0013377 Ga0500568_0013377_2011_3003 328
372 3300053139 Ga0500568_0035959 Ga0500568_0035959_325_1317 328
373 3300053140 Ga0500573_0000316 Ga0500573_0000316_8667_9653 328
374 3300053148 Ga0500590_000598 Ga0500590_000598_10954_11940 328
375 3300053153 Ga0500616_0000116 Ga0500616_0000116_7751_8737 328
376 3300053153 Ga0500616_0000297 Ga0500616_0000297_4426_5412 328
377 3300053156 Ga0500622_0004153 Ga0500622_0004153_2015_3007 328
378 3300054114 Ga0501084_0018697 Ga0501084_0018697_4069_5055 328
379 3300059605 Ga0587106_007402 Ga0587106_007402_267_1253 328
380 3300059643 Ga0587072_008100 Ga0587072_008100_175_1161 328
381 3300059645 Ga0587076_004365 Ga0587076_004365_475_1461 328
382 3300059647 Ga0587079_014852 Ga0587079_014852_138_1124 328
383 3300059655 Ga0587114_006474 Ga0587114_006474_184_1170 328
384 3300060353 Ga0501082_0108406 Ga0501082_0108406_740_1726 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

70

372

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ynq-assembly2.cif.gz_B aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.8676 1 315
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8548 1 319
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.8507 1 316
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.8455 12 316
7lh6-assembly1.cif.gz_A the structure of bacteroides plebeius l-galactose dehydrogenase 0.8443 1 324
ID Description Score Start End Superfamily
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8744 2 84 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8591 1 315 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8504 2 316 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8479 1 315 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8452 2 316 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A6B3I9M6-F1-model_v4 Aldo/keto reductase 0.9918 95 196 GO:0016491
AF-A0A7W9BV42-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9761 1 328
AF-A0A7C1SX38-F1-model_v4 Aldo/keto reductase 0.9748 1 131 GO:0005829
AF-A0A7W9BV42-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9732 1 328
AF-A0A6B3I9M6-F1-model_v4 Aldo/keto reductase 0.9728 95 196 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.57 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map