F429809

General Info

Members Datasets Scaffolds Average Seq Length
384 238 768 157

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100031993|Ga0070668_1000319934
Length 178
Sequence MALSANDAFAAGGSVSRRRRRYGRGRRGALSEINVTPLVDVMLVLLIIFMISAPLLTVGVPVELPKTEAGAMEDQSTPLTLSIKADGAIFVTAGDKDRQVAFEQLSPLLTAMADNKTDKPIYVRADGRAPYSIVAQVMASLSVSGFTSINLITDTGGPSSGKTETTTPAPPAAEPPAT

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
190 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
191 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
199 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
201 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
207 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
210 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
214 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
215 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
216 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
217 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
218 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
219 2643221584 Caulobacter sp. Root656 Isolate Unclassified
220 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
221 2643221640 Caulobacter sp. Root342 Isolate Unclassified
222 2643221642 Caulobacter sp. Root343 Isolate Unclassified
223 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
224 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
225 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
226 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
227 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
228 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
229 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
230 2818991435 Caulobacter henricii 536 Isolate Unclassified
231 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
232 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
233 2849560528 Caulobacter zeae 410 Isolate Unclassified
234 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
235 2851153111 Caulobacter radicis 736 Isolate Unclassified
236 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
237 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
238 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.97
Metatranscriptomes 0
Isolates 7.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.83
Nodule 0
Rhizoplane 3.39
Rhizosphere 64.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100031993 3300005347 Bacteria 4003
2 JGI25157J39369_1029700 3300002741 Bacteria 626
3 JGI25153J46596_10000042 3300003215 Bacteria 161788
4 rootH1_10028737 3300003323 Bacteria 2567
5 Ga0055537_1004257 3300003773 Bacteria 4137
6 Ga0055524_1026078 3300003775 Bacteria 1816
7 Ga0055524_1033155 3300003775 Bacteria 1450
8 Ga0055536_1002281 3300003781 Bacteria 10891
9 Ga0055528_1020185 3300003790 Bacteria 2172
10 Ga0055530_10000090 3300003791 Bacteria 78168
11 Ga0055530_10005036 3300003791 Bacteria 6497
12 Ga0055530_10047287 3300003791 Bacteria 1017
13 Ga0055530_10067537 3300003791 Bacteria 779
14 Ga0055531_10000579 3300003794 Bacteria 31922
15 Ga0055531_10001586 3300003794 Bacteria 16590
16 Ga0055531_10003917 3300003794 Bacteria 9272
17 Ga0055531_10030686 3300003794 Bacteria 1797
18 Ga0065165_1002252 3300005262 Bacteria 17063
19 Ga0065165_1003048 3300005262 Bacteria 12575
20 Ga0065165_1038572 3300005262 Bacteria 1439
21 Ga0070658_10527109 3300005327 Bacteria 1022
22 Ga0070658_11220035 3300005327 Bacteria 654
23 Ga0070676_10708362 3300005328 Bacteria 736
24 Ga0070670_100000007 3300005331 Bacteria 318672
25 Ga0068869_100025241 3300005334 Bacteria 4125
26 Ga0070666_10022658 3300005335 Bacteria 4081
27 Ga0068868_100129792 3300005338 Bacteria 2062
28 Ga0070668_100001128 3300005347 Bacteria 18767
29 Ga0070668_100002441 3300005347 Bacteria 13675
30 Ga0070669_100174684 3300005353 Bacteria 1677
31 Ga0070671_100749590 3300005355 Bacteria 849
32 Ga0070674_100876536 3300005356 Bacteria 780
33 Ga0070673_100453639 3300005364 Bacteria 1154
34 Ga0070667_100002530 3300005367 Bacteria 15933
35 Ga0070663_100427161 3300005455 Bacteria 1088
36 Ga0070678_100821723 3300005456 Bacteria 845
37 Ga0070679_100750195 3300005530 Bacteria 919
38 Ga0070684_101394554 3300005535 Bacteria 660
39 Ga0070672_100824295 3300005543 Bacteria 817
40 Ga0070665_100003703 3300005548 Bacteria 16191
41 Ga0070665_100121142 3300005548 Bacteria 2617
42 Ga0068855_100129579 3300005563 Bacteria 2882
43 Ga0068855_100149425 3300005563 Bacteria 2657
44 Ga0068855_100341983 3300005563 Bacteria 1649
45 Ga0070664_100170995 3300005564 Bacteria 1928
46 Ga0068856_100903965 3300005614 Bacteria 902
47 Ga0068852_101664277 3300005616 Bacteria 661
48 Ga0068859_100103499 3300005617 Bacteria 2905
49 Ga0068864_100000093 3300005618 Bacteria 93540
50 Ga0068864_100000095 3300005618 Bacteria 91554
51 Ga0068864_100014083 3300005618 Bacteria 6635
52 Ga0068864_100034218 3300005618 Bacteria 4321
53 Ga0068864_100714483 3300005618 Bacteria 980
54 Ga0068864_101289809 3300005618 Bacteria 730
55 Ga0068863_100000045 3300005841 Bacteria 147269
56 Ga0068863_100003539 3300005841 Bacteria 15412
57 Ga0068863_100469984 3300005841 Bacteria 1236
58 Ga0068863_100559329 3300005841 Bacteria 1130
59 Ga0068863_100590201 3300005841 Bacteria 1099
60 Ga0068858_100003027 3300005842 Bacteria 16847
61 Ga0068858_100010617 3300005842 Bacteria 8716
62 Ga0068858_101314118 3300005842 Bacteria 712
63 Ga0068860_100000037 3300005843 Bacteria 234524
64 Ga0068860_100000204 3300005843 Bacteria 93995
65 Ga0068862_100001565 3300005844 Bacteria 20879
66 Ga0068862_100043001 3300005844 Bacteria 3851
67 Ga0068862_100921631 3300005844 Bacteria 860
68 Ga0075363_100078131 3300006048 Bacteria 1807
69 Ga0097621_100861857 3300006237 Bacteria 842
70 Ga0068871_100876128 3300006358 Bacteria 831
71 Ga0068865_100018105 3300006881 Bacteria 4541
72 Ga0097620_100103498 3300006931 Bacteria 2905
73 Ga0105250_10075440 3300009092 Bacteria 1364
74 Ga0105240_10685754 3300009093 Bacteria 1120
75 Ga0105240_11783067 3300009093 Bacteria 642
76 Ga0105243_10560783 3300009148 Bacteria 1093
77 Ga0105243_11458694 3300009148 Bacteria 707
78 Ga0105241_10197280 3300009174 Bacteria 1679
79 Ga0105248_10043098 3300009177 Bacteria 5061
80 Ga0105248_10164984 3300009177 Bacteria 2497
81 Ga0105248_10204924 3300009177 Bacteria 2223
82 Ga0105238_10029665 3300009551 Bacteria 5572
83 Ga0105238_10398799 3300009551 Bacteria 1369
84 Ga0105238_11090792 3300009551 Bacteria 821
85 Ga0105249_10017474 3300009553 Bacteria 6368
86 Ga0105249_10213867 3300009553 Bacteria 1893
87 Ga0105239_10261276 3300010375 Bacteria 1946
88 Ga0105239_10320624 3300010375 Bacteria 1747
89 Ga0105239_11534358 3300010375 Bacteria 770
90 Ga0157370_10767006 3300013104 Bacteria 878
91 Ga0157378_11317707 3300013297 Bacteria 764
92 Ga0163162_10128321 3300013306 Bacteria 2644
93 Ga0163162_11961982 3300013306 Bacteria 670
94 Ga0157375_10791929 3300013308 Bacteria 1097
95 Ga0163163_10084595 3300014325 Bacteria 3179
96 Ga0163163_10255976 3300014325 Bacteria 1801
97 Ga0163163_10982152 3300014325 Bacteria 908
98 Ga0163163_11448550 3300014325 Bacteria 748
99 Ga0157380_10738221 3300014326 Bacteria 994
100 Ga0182008_10396423 3300014497 Bacteria 741
101 Ga0157379_10019423 3300014968 Bacteria 6001
102 Ga0157379_10908230 3300014968 Bacteria 836
103 Ga0182007_10145159 3300015262 Bacteria 804
104 Ga0163161_10490277 3300017792 Bacteria 999
105 Ga0213872_10029746 3300021361 Bacteria 2505
106 Ga0213874_10056140 3300021377 Bacteria 1222
107 Ga0209026_1006578 3300025250 Bacteria 2810
108 Ga0209565_1000447 3300025263 Bacteria 32315
109 Ga0209673_1001055 3300025273 Bacteria 31608
110 Ga0209675_1042205 3300025291 Bacteria 990
111 Ga0209676_1000163 3300025292 Bacteria 157845
112 Ga0209676_1000188 3300025292 Bacteria 141232
113 Ga0209564_1035146 3300025295 Bacteria 1456
114 Ga0209758_1000110 3300025297 Bacteria 213110
115 Ga0209758_1001620 3300025297 Bacteria 25637
116 Ga0209758_1002131 3300025297 Bacteria 20893
117 Ga0209758_1007595 3300025297 Bacteria 7321
118 Ga0209050_1000095 3300025298 Bacteria 242722
119 Ga0209050_1000769 3300025298 Bacteria 46027
120 Ga0209050_1001497 3300025298 Bacteria 24764
121 Ga0209050_1013428 3300025298 Bacteria 3636
122 Ga0209256_1004418 3300025299 Bacteria 8843
123 Ga0209256_1010303 3300025299 Bacteria 3939
124 Ga0209256_1047277 3300025299 Bacteria 1060
125 Ga0207426_1072106 3300025302 Bacteria 960
126 Ga0209051_1002156 3300025303 Bacteria 14603
127 Ga0209257_1000074 3300025304 Bacteria 325641
128 Ga0209257_1000106 3300025304 Bacteria 242634
129 Ga0209257_1000242 3300025304 Bacteria 126891
130 Ga0209257_1000370 3300025304 Bacteria 90934
131 Ga0209257_1000407 3300025304 Bacteria 83438
132 Ga0209257_1004350 3300025304 Bacteria 11048
133 Ga0209257_1010609 3300025304 Bacteria 4621
134 Ga0209257_1041670 3300025304 Bacteria 1360
135 Ga0207697_10060281 3300025315 Bacteria 1578
136 Ga0207696_1064013 3300025711 Bacteria 1030
137 Ga0207680_10012995 3300025903 Bacteria 4259
138 Ga0207705_10799662 3300025909 Bacteria 732
139 Ga0207695_10007822 3300025913 Bacteria 13524
140 Ga0207695_11151876 3300025913 Bacteria 655
141 Ga0207660_10028167 3300025917 Bacteria 3841
142 Ga0207681_10524483 3300025923 Bacteria 972
143 Ga0207694_10010258 3300025924 Bacteria 7063
144 Ga0207694_10416632 3300025924 Bacteria 1118
145 Ga0207650_10000030 3300025925 Bacteria 235824
146 Ga0207650_10084740 3300025925 Bacteria 2410
147 Ga0207644_10064193 3300025931 Bacteria 2668
148 Ga0207644_10197720 3300025931 Bacteria 1584
149 Ga0207644_10233070 3300025931 Bacteria 1463
150 Ga0207690_10009813 3300025932 Bacteria 5689
151 Ga0207711_10010478 3300025941 Bacteria 7698
152 Ga0207711_10054127 3300025941 Bacteria 3443
153 Ga0207711_10295613 3300025941 Bacteria 1493
154 Ga0207689_10029816 3300025942 Bacteria 4550
155 Ga0207661_10443419 3300025944 Bacteria 1182
156 Ga0207667_10101500 3300025949 Bacteria 2968
157 Ga0207667_10251853 3300025949 Bacteria 1806
158 Ga0207667_10314274 3300025949 Bacteria 1600
159 Ga0207651_10591026 3300025960 Bacteria 969
160 Ga0207712_10078146 3300025961 Bacteria 2400
161 Ga0207668_10000152 3300025972 Bacteria 47686
162 Ga0207668_10075226 3300025972 Bacteria 2427
163 Ga0207668_10087906 3300025972 Bacteria 2274
164 Ga0207658_10000211 3300025986 Bacteria 60993
165 Ga0207677_10326764 3300026023 Bacteria 1277
166 Ga0207703_10000557 3300026035 Bacteria 38274
167 Ga0207703_10003412 3300026035 Bacteria 13335
168 Ga0207639_10024025 3300026041 Bacteria 4406
169 Ga0207678_11095562 3300026067 Bacteria 705
170 Ga0207702_10131013 3300026078 Bacteria 2257
171 Ga0207702_10366817 3300026078 Bacteria 1381
172 Ga0207641_10000011 3300026088 Bacteria 384362
173 Ga0207641_10003236 3300026088 Bacteria 14535
174 Ga0207676_10000095 3300026095 Bacteria 80405
175 Ga0207676_10001230 3300026095 Bacteria 19079
176 Ga0207676_10009994 3300026095 Bacteria 6752
177 Ga0207676_10023837 3300026095 Bacteria 4522
178 Ga0207676_10161072 3300026095 Bacteria 1944
179 Ga0207676_10343617 3300026095 Bacteria 1378
180 Ga0207683_10852012 3300026121 Bacteria 846
181 Ga0207698_11740200 3300026142 Bacteria 639
182 Ga0209999_1002016 3300027543 Bacteria 3543
183 Ga0268266_10003774 3300028379 Bacteria 14841
184 Ga0268266_10110844 3300028379 Bacteria 2431
185 Ga0268266_10115678 3300028379 Bacteria 2381
186 Ga0268265_10009659 3300028380 Bacteria 6513
187 Ga0268265_10144746 3300028380 Bacteria 1995
188 Ga0268265_10240143 3300028380 Bacteria 1598
189 Ga0268265_10252253 3300028380 Bacteria 1563
190 Ga0268265_11347750 3300028380 Bacteria 714
191 Ga0268264_10000002 3300028381 Bacteria 1153045
192 Ga0268264_10000125 3300028381 Bacteria 186416
193 Ga0307517_10009209 3300028786 Bacteria 14036
194 Ga0307517_10026333 3300028786 Bacteria 7055
195 Ga0307517_10085293 3300028786 Bacteria 2647
196 Ga0307515_10037385 3300028794 Bacteria 7810
197 Ga0265338_10135777 3300028800 Bacteria 1934
198 Ga0265327_10050478 3300031251 Bacteria 2176
199 Ga0265316_10655771 3300031344 Bacteria 742
200 Ga0307513_10000203 3300031456 Bacteria 85712
201 Ga0307513_10002433 3300031456 Bacteria 25816
202 Ga0307513_10005843 3300031456 Bacteria 16169
203 Ga0265314_10093782 3300031711 Bacteria 1948
204 Ga0307406_11038392 3300031901 Bacteria 705
205 Ga0307414_10649751 3300032004 Bacteria 951
206 Ga0307414_10903818 3300032004 Bacteria 809
207 Ga0307510_10064185 3300033180 Bacteria 3731
208 Ga0307510_10177209 3300033180 Bacteria 1701
209 Ga0373937_0062232 3300036401 Bacteria 3431
210 Ga0395899_0000223 3300037312 Bacteria 77606
211 Ga0395899_0486534 3300037312 Bacteria 802
212 Ga0395899_0519176 3300037312 Bacteria 770
213 Ga0395900_0000008 3300037418 Bacteria 480459
214 Ga0395898_0204033 3300037466 Bacteria 1886
215 Ga0395898_0683564 3300037466 Bacteria 968
216 Ga0395905_0003857 3300037471 Bacteria 15812
217 Ga0395905_0031910 3300037471 Bacteria 4956
218 Ga0395905_0469683 3300037471 Bacteria 1157
219 Ga0395905_0479091 3300037471 Bacteria 1144
220 Ga0395905_0573018 3300037471 Bacteria 1030
221 Ga0395901_0000008 3300038443 Bacteria 495962
222 Ga0395901_0057954 3300038443 Bacteria 4029
223 Ga0436365_0278030 3300039437 Bacteria 756
224 Ga0436365_1124610 3300039437 Bacteria 961
225 Ga0436361_0628798 3300039447 Bacteria 18139
226 Ga0436361_0871666 3300039447 Bacteria 657
227 Ga0436363_0864594 3300039450 Bacteria 1735
228 Ga0451853_0954181 3300041512 Bacteria 1402
229 Ga0439435_0194169 3300042436 Bacteria 667
230 Ga0450916_007842 3300042530 Bacteria 1289
231 Ga0466965_0238824 3300044683 Bacteria 972
232 Ga0453684_0853393 3300044712 Bacteria 978
233 Ga0495638_0065647 3300046460 Bacteria 2233
234 Ga0495638_0291830 3300046460 Bacteria 882
235 Ga0495638_0295741 3300046460 Bacteria 874
236 Ga0495585_0341264 3300046492 Bacteria 729
237 Ga0495583_0000013 3300046506 Bacteria 323372
238 Ga0495606_0053199 3300046507 Bacteria 2628
239 Ga0495606_0066675 3300046507 Bacteria 2282
240 Ga0495606_0423588 3300046507 Bacteria 688
241 Ga0495610_0001211 3300046512 Bacteria 23221
242 Ga0495620_0123013 3300046515 Bacteria 1021
243 Ga0495632_0071029 3300046519 Bacteria 1673
244 Ga0495643_0047845 3300046522 Bacteria 2314
245 Ga0495643_0276949 3300046522 Bacteria 773
246 Ga0495609_0121985 3300046538 Bacteria 1120
247 Ga0495597_0022380 3300046542 Bacteria 2932
248 Ga0495597_0117569 3300046542 Bacteria 1110
249 Ga0495668_0000317 3300046616 Bacteria 66025
250 Ga0495668_0037091 3300046616 Bacteria 2729
251 Ga0495668_0132656 3300046616 Bacteria 1363
252 Ga0495668_0156214 3300046616 Bacteria 1249
253 Ga0495668_0356586 3300046616 Bacteria 803
254 Ga0495611_0180596 3300046648 Bacteria 986
255 Ga0495625_0023118 3300046660 Bacteria 4752
256 Ga0495625_0059438 3300046660 Bacteria 2712
257 Ga0495625_0081588 3300046660 Bacteria 2250
258 Ga0495625_0126433 3300046660 Bacteria 1735
259 Ga0495669_0000009 3300046684 Bacteria 165516
260 Ga0495669_0020446 3300046684 Bacteria 2866
261 Ga0495669_0043815 3300046684 Bacteria 1993
262 Ga0495613_0000563 3300046689 Bacteria 30509
263 Ga0495589_0041576 3300046794 Bacteria 2293
264 Ga0495600_0270873 3300046809 Bacteria 1077
265 Ga0495672_0032898 3300047320 Bacteria 3218
266 Ga0495683_0137608 3300047323 Bacteria 1147
267 Ga0495673_0000025 3300047469 Bacteria 512352
268 Ga0495686_0007046 3300047472 Bacteria 8481
269 Ga0495593_0019875 3300047673 Bacteria 3763
270 Ga0495615_0033538 3300048090 Bacteria 1244
271 Ga0496100_1003461 3300048903 Bacteria 657
272 Ga0496101_0661522 3300048904 Bacteria 825
273 Ga0496102_0032886 3300048905 Bacteria 4661
274 Ga0496103_0033621 3300048906 Bacteria 3133
275 Ga0496106_0093551 3300048909 Bacteria 2323
276 Ga0496107_0007453 3300048910 Bacteria 7543
277 Ga0496108_0201525 3300048911 Bacteria 1727
278 Ga0496109_0038600 3300048912 Bacteria 4318
279 Ga0496111_0108974 3300048914 Bacteria 2039
280 Ga0496112_1012865 3300048915 Bacteria 750
281 Ga0496113_0063089 3300048916 Bacteria 2800
282 Ga0496115_0009131 3300048918 Bacteria 7359
283 Ga0496115_0566746 3300048918 Bacteria 906
284 Ga0496116_0101231 3300048919 Bacteria 1721
285 Ga0496117_0005164 3300048920 Bacteria 13931
286 Ga0496118_0009368 3300048921 Bacteria 9914
287 Ga0496121_0000442 3300048924 Bacteria 81890
288 Ga0496124_0050661 3300048927 Bacteria 3537
289 Ga0496126_0009077 3300048929 Bacteria 10628
290 Ga0501033_0082834 3300049570 Bacteria 2352
291 Ga0501034_0243025 3300049571 Bacteria 1746
292 Ga0501034_0798238 3300049571 Bacteria 837
293 Ga0501034_1043411 3300049571 Bacteria 700
294 Ga0501036_1038729 3300049572 Bacteria 670
295 Ga0501037_0021582 3300049573 Bacteria 4761
296 Ga0501037_0092293 3300049573 Bacteria 2190
297 Ga0501037_0650529 3300049573 Bacteria 704
298 Ga0501043_0307489 3300049579 Bacteria 1210
299 Ga0501046_0101029 3300049580 Bacteria 2213
300 Ga0501047_0004775 3300049581 Bacteria 12748
301 Ga0501047_0034026 3300049581 Bacteria 4920
302 Ga0501047_0042468 3300049581 Bacteria 4394
303 Ga0501047_0283019 3300049581 Bacteria 1502
304 Ga0501047_0360673 3300049581 Bacteria 1289
305 Ga0501047_0418979 3300049581 Bacteria 1171
306 Ga0501073_0041339 3300049589 Bacteria 3257
307 Ga0501073_0115525 3300049589 Bacteria 1860
308 Ga0501257_019081 3300049686 Bacteria 1602
309 Ga0501079_0799031 3300049741 Bacteria 743
310 Ga0501079_1358718 3300049741 Bacteria 559
311 Ga0501080_0040555 3300049742 Bacteria 4342
312 Ga0501083_0091334 3300049744 Bacteria 2010
313 Ga0501035_0127016 3300049822 Bacteria 2226
314 Ga0501044_0001062 3300049823 Bacteria 33045
315 Ga0501044_0002744 3300049823 Bacteria 20036
316 Ga0501044_0106875 3300049823 Bacteria 2810
317 Ga0501044_0626164 3300049823 Bacteria 967
318 Ga0501044_0654045 3300049823 Bacteria 940
319 Ga0501044_0762018 3300049823 Bacteria 849
320 nmdc:mga03683_39899_c1 3300050489 Bacteria 1923
321 nmdc:mga07m45_201948_c1 3300050496 Bacteria 1156
322 Ga0500646_0009045 3300053090 Bacteria 2551
323 Ga0500651_0284061 3300053093 Bacteria 953
324 Ga0500651_0564075 3300053093 Bacteria 621
325 Ga0500566_0025167 3300053094 Bacteria 3490
326 Ga0500641_0125448 3300053096 Bacteria 1107
327 Ga0500650_0269852 3300053098 Bacteria 759
328 Ga0500555_002139 3300053103 Bacteria 5780
329 Ga0500555_002477 3300053103 Bacteria 5337
330 Ga0500562_002176 3300053108 Bacteria 4898
331 Ga0500562_025976 3300053108 Bacteria 1534
332 Ga0500594_0073029 3300053118 Bacteria 1012
333 Ga0500595_000412 3300053119 Bacteria 27258
334 Ga0500608_096890 3300053122 Bacteria 1371
335 Ga0500614_001345 3300053123 Bacteria 5918
336 Ga0500642_0005867 3300053130 Bacteria 4000
337 Ga0500652_267003 3300053131 Bacteria 672
338 Ga0500658_0021973 3300053134 Bacteria 2420
339 Ga0500658_0295765 3300053134 Bacteria 744
340 Ga0500559_0000060 3300053136 Bacteria 87673
341 Ga0500559_0012138 3300053136 Bacteria 3668
342 Ga0500559_0016458 3300053136 Bacteria 3122
343 Ga0500559_0075506 3300053136 Bacteria 1524
344 Ga0500568_0257886 3300053139 Bacteria 634
345 Ga0500577_0022872 3300053142 Bacteria 2080
346 Ga0500577_0078321 3300053142 Bacteria 1312
347 Ga0500577_0097671 3300053142 Bacteria 1196
348 Ga0500588_0000362 3300053146 Bacteria 6969
349 Ga0500588_0185589 3300053146 Bacteria 766
350 Ga0500590_009973 3300053148 Bacteria 4787
351 Ga0500604_0003157 3300053151 Bacteria 4431
352 Ga0500604_0087583 3300053151 Bacteria 1013
353 Ga0500622_0133672 3300053156 Bacteria 1190
354 Ga0500611_030173 3300053727 Bacteria 1116
355 Ga0501084_0693025 3300054114 Bacteria 859
356 Ga0501082_0338369 3300060353 Bacteria 1311
357 Ga0501082_1613906 3300060353 Bacteria 566
358 2511120249 2510917020 Bacteria 5657507
359 2585151503 2582581280 Bacteria 5994497
360 2585195623 2582581293 Bacteria 5907401
361 2643749329 2643221545 Bacteria 5083237
362 2643783195 2643221552 Bacteria 5708754
363 2643883993 2643221574 Bacteria 2789653
364 2643930861 2643221584 Bacteria 5511711
365 2644001450 2643221598 Bacteria 4578346
366 2644224081 2643221640 Bacteria 5258820
367 2644233067 2643221642 Bacteria 5357871
368 2644343971 2643221661 Bacteria 4267604
369 2644353254 2643221663 Bacteria 3425771
370 2644368550 2643221666 Bacteria 4265935
371 2644508897 2643221691 Bacteria 5093099
372 2644549964 2643221699 Bacteria 5731501
373 2644551266 2643221699 Bacteria 5731501
374 2739790446 2739367756 Bacteria 4553612
375 2792459941 2791355048 Bacteria 5832535
376 2819535615 2818991435 Bacteria 5433759
377 2819644890 2818991454 Bacteria 5563326
378 2843744467 2843744320 Bacteria 5659202
379 2849565050 2849560528 Bacteria 5393480
380 2849575963 2849573788 Bacteria 5421256
381 2851155940 2851153111 Bacteria 5542585
382 2857507883 2857504554 Bacteria 5369913
383 2884965735 2884960567 Bacteria 5437054
384 2898331606 2898329390 Bacteria 5168154
385 Ga0070668_100031993
386 JGI25157J39369_1029700
387 JGI25153J46596_10000042
388 rootH1_10028737
389 Ga0055537_1004257
390 Ga0055524_1026078
391 Ga0055524_1033155
392 Ga0055536_1002281
393 Ga0055528_1020185
394 Ga0055530_10000090
395 Ga0055530_10005036
396 Ga0055530_10047287
397 Ga0055530_10067537
398 Ga0055531_10000579
399 Ga0055531_10001586
400 Ga0055531_10003917
401 Ga0055531_10030686
402 Ga0065165_1002252
403 Ga0065165_1003048
404 Ga0065165_1038572
405 Ga0070658_10527109
406 Ga0070658_11220035
407 Ga0070676_10708362
408 Ga0070670_100000007
409 Ga0068869_100025241
410 Ga0070666_10022658
411 Ga0068868_100129792
412 Ga0070668_100001128
413 Ga0070668_100002441
414 Ga0070669_100174684
415 Ga0070671_100749590
416 Ga0070674_100876536
417 Ga0070673_100453639
418 Ga0070667_100002530
419 Ga0070663_100427161
420 Ga0070678_100821723
421 Ga0070679_100750195
422 Ga0070684_101394554
423 Ga0070672_100824295
424 Ga0070665_100003703
425 Ga0070665_100121142
426 Ga0068855_100129579
427 Ga0068855_100149425
428 Ga0068855_100341983
429 Ga0070664_100170995
430 Ga0068856_100903965
431 Ga0068852_101664277
432 Ga0068859_100103499
433 Ga0068864_100000093
434 Ga0068864_100000095
435 Ga0068864_100014083
436 Ga0068864_100034218
437 Ga0068864_100714483
438 Ga0068864_101289809
439 Ga0068863_100000045
440 Ga0068863_100003539
441 Ga0068863_100469984
442 Ga0068863_100559329
443 Ga0068863_100590201
444 Ga0068858_100003027
445 Ga0068858_100010617
446 Ga0068858_101314118
447 Ga0068860_100000037
448 Ga0068860_100000204
449 Ga0068862_100001565
450 Ga0068862_100043001
451 Ga0068862_100921631
452 Ga0075363_100078131
453 Ga0097621_100861857
454 Ga0068871_100876128
455 Ga0068865_100018105
456 Ga0097620_100103498
457 Ga0105250_10075440
458 Ga0105240_10685754
459 Ga0105240_11783067
460 Ga0105243_10560783
461 Ga0105243_11458694
462 Ga0105241_10197280
463 Ga0105248_10043098
464 Ga0105248_10164984
465 Ga0105248_10204924
466 Ga0105238_10029665
467 Ga0105238_10398799
468 Ga0105238_11090792
469 Ga0105249_10017474
470 Ga0105249_10213867
471 Ga0105239_10261276
472 Ga0105239_10320624
473 Ga0105239_11534358
474 Ga0157370_10767006
475 Ga0157378_11317707
476 Ga0163162_10128321
477 Ga0163162_11961982
478 Ga0157375_10791929
479 Ga0163163_10084595
480 Ga0163163_10255976
481 Ga0163163_10982152
482 Ga0163163_11448550
483 Ga0157380_10738221
484 Ga0182008_10396423
485 Ga0157379_10019423
486 Ga0157379_10908230
487 Ga0182007_10145159
488 Ga0163161_10490277
489 Ga0213872_10029746
490 Ga0213874_10056140
491 Ga0209026_1006578
492 Ga0209565_1000447
493 Ga0209673_1001055
494 Ga0209675_1042205
495 Ga0209676_1000163
496 Ga0209676_1000188
497 Ga0209564_1035146
498 Ga0209758_1000110
499 Ga0209758_1001620
500 Ga0209758_1002131
501 Ga0209758_1007595
502 Ga0209050_1000095
503 Ga0209050_1000769
504 Ga0209050_1001497
505 Ga0209050_1013428
506 Ga0209256_1004418
507 Ga0209256_1010303
508 Ga0209256_1047277
509 Ga0207426_1072106
510 Ga0209051_1002156
511 Ga0209257_1000074
512 Ga0209257_1000106
513 Ga0209257_1000242
514 Ga0209257_1000370
515 Ga0209257_1000407
516 Ga0209257_1004350
517 Ga0209257_1010609
518 Ga0209257_1041670
519 Ga0207697_10060281
520 Ga0207696_1064013
521 Ga0207680_10012995
522 Ga0207705_10799662
523 Ga0207695_10007822
524 Ga0207695_11151876
525 Ga0207660_10028167
526 Ga0207681_10524483
527 Ga0207694_10010258
528 Ga0207694_10416632
529 Ga0207650_10000030
530 Ga0207650_10084740
531 Ga0207644_10064193
532 Ga0207644_10197720
533 Ga0207644_10233070
534 Ga0207690_10009813
535 Ga0207711_10010478
536 Ga0207711_10054127
537 Ga0207711_10295613
538 Ga0207689_10029816
539 Ga0207661_10443419
540 Ga0207667_10101500
541 Ga0207667_10251853
542 Ga0207667_10314274
543 Ga0207651_10591026
544 Ga0207712_10078146
545 Ga0207668_10000152
546 Ga0207668_10075226
547 Ga0207668_10087906
548 Ga0207658_10000211
549 Ga0207677_10326764
550 Ga0207703_10000557
551 Ga0207703_10003412
552 Ga0207639_10024025
553 Ga0207678_11095562
554 Ga0207702_10131013
555 Ga0207702_10366817
556 Ga0207641_10000011
557 Ga0207641_10003236
558 Ga0207676_10000095
559 Ga0207676_10001230
560 Ga0207676_10009994
561 Ga0207676_10023837
562 Ga0207676_10161072
563 Ga0207676_10343617
564 Ga0207683_10852012
565 Ga0207698_11740200
566 Ga0209999_1002016
567 Ga0268266_10003774
568 Ga0268266_10110844
569 Ga0268266_10115678
570 Ga0268265_10009659
571 Ga0268265_10144746
572 Ga0268265_10240143
573 Ga0268265_10252253
574 Ga0268265_11347750
575 Ga0268264_10000002
576 Ga0268264_10000125
577 Ga0307517_10009209
578 Ga0307517_10026333
579 Ga0307517_10085293
580 Ga0307515_10037385
581 Ga0265338_10135777
582 Ga0265327_10050478
583 Ga0265316_10655771
584 Ga0307513_10000203
585 Ga0307513_10002433
586 Ga0307513_10005843
587 Ga0265314_10093782
588 Ga0307406_11038392
589 Ga0307414_10649751
590 Ga0307414_10903818
591 Ga0307510_10064185
592 Ga0307510_10177209
593 Ga0373937_0062232
594 Ga0395899_0000223
595 Ga0395899_0486534
596 Ga0395899_0519176
597 Ga0395900_0000008
598 Ga0395898_0204033
599 Ga0395898_0683564
600 Ga0395905_0003857
601 Ga0395905_0031910
602 Ga0395905_0469683
603 Ga0395905_0479091
604 Ga0395905_0573018
605 Ga0395901_0000008
606 Ga0395901_0057954
607 Ga0436365_0278030
608 Ga0436365_1124610
609 Ga0436361_0628798
610 Ga0436361_0871666
611 Ga0436363_0864594
612 Ga0451853_0954181
613 Ga0439435_0194169
614 Ga0450916_007842
615 Ga0466965_0238824
616 Ga0453684_0853393
617 Ga0495638_0065647
618 Ga0495638_0291830
619 Ga0495638_0295741
620 Ga0495585_0341264
621 Ga0495583_0000013
622 Ga0495606_0053199
623 Ga0495606_0066675
624 Ga0495606_0423588
625 Ga0495610_0001211
626 Ga0495620_0123013
627 Ga0495632_0071029
628 Ga0495643_0047845
629 Ga0495643_0276949
630 Ga0495609_0121985
631 Ga0495597_0022380
632 Ga0495597_0117569
633 Ga0495668_0000317
634 Ga0495668_0037091
635 Ga0495668_0132656
636 Ga0495668_0156214
637 Ga0495668_0356586
638 Ga0495611_0180596
639 Ga0495625_0023118
640 Ga0495625_0059438
641 Ga0495625_0081588
642 Ga0495625_0126433
643 Ga0495669_0000009
644 Ga0495669_0020446
645 Ga0495669_0043815
646 Ga0495613_0000563
647 Ga0495589_0041576
648 Ga0495600_0270873
649 Ga0495672_0032898
650 Ga0495683_0137608
651 Ga0495673_0000025
652 Ga0495686_0007046
653 Ga0495593_0019875
654 Ga0495615_0033538
655 Ga0496100_1003461
656 Ga0496101_0661522
657 Ga0496102_0032886
658 Ga0496103_0033621
659 Ga0496106_0093551
660 Ga0496107_0007453
661 Ga0496108_0201525
662 Ga0496109_0038600
663 Ga0496111_0108974
664 Ga0496112_1012865
665 Ga0496113_0063089
666 Ga0496115_0009131
667 Ga0496115_0566746
668 Ga0496116_0101231
669 Ga0496117_0005164
670 Ga0496118_0009368
671 Ga0496121_0000442
672 Ga0496124_0050661
673 Ga0496126_0009077
674 Ga0501033_0082834
675 Ga0501034_0243025
676 Ga0501034_0798238
677 Ga0501034_1043411
678 Ga0501036_1038729
679 Ga0501037_0021582
680 Ga0501037_0092293
681 Ga0501037_0650529
682 Ga0501043_0307489
683 Ga0501046_0101029
684 Ga0501047_0004775
685 Ga0501047_0034026
686 Ga0501047_0042468
687 Ga0501047_0283019
688 Ga0501047_0360673
689 Ga0501047_0418979
690 Ga0501073_0041339
691 Ga0501073_0115525
692 Ga0501257_019081
693 Ga0501079_0799031
694 Ga0501079_1358718
695 Ga0501080_0040555
696 Ga0501083_0091334
697 Ga0501035_0127016
698 Ga0501044_0001062
699 Ga0501044_0002744
700 Ga0501044_0106875
701 Ga0501044_0626164
702 Ga0501044_0654045
703 Ga0501044_0762018
704 nmdc:mga03683_39899_c1
705 nmdc:mga07m45_201948_c1
706 Ga0500646_0009045
707 Ga0500651_0284061
708 Ga0500651_0564075
709 Ga0500566_0025167
710 Ga0500641_0125448
711 Ga0500650_0269852
712 Ga0500555_002139
713 Ga0500555_002477
714 Ga0500562_002176
715 Ga0500562_025976
716 Ga0500594_0073029
717 Ga0500595_000412
718 Ga0500608_096890
719 Ga0500614_001345
720 Ga0500642_0005867
721 Ga0500652_267003
722 Ga0500658_0021973
723 Ga0500658_0295765
724 Ga0500559_0000060
725 Ga0500559_0012138
726 Ga0500559_0016458
727 Ga0500559_0075506
728 Ga0500568_0257886
729 Ga0500577_0022872
730 Ga0500577_0078321
731 Ga0500577_0097671
732 Ga0500588_0000362
733 Ga0500588_0185589
734 Ga0500590_009973
735 Ga0500604_0003157
736 Ga0500604_0087583
737 Ga0500622_0133672
738 Ga0500611_030173
739 Ga0501084_0693025
740 Ga0501082_0338369
741 Ga0501082_1613906
742 2511120249
743 2585151503
744 2585195623
745 2643749329
746 2643783195
747 2643883993
748 2643930861
749 2644001450
750 2644224081
751 2644233067
752 2644343971
753 2644353254
754 2644368550
755 2644508897
756 2644549964
757 2644551266
758 2739790446
759 2792459941
760 2819535615
761 2819644890
762 2843744467
763 2849565050
764 2849575963
765 2851155940
766 2857507883
767 2884965735
768 2898331606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

26

156

0.93

Map