F429822

General Info

Members Datasets Scaffolds Average Seq Length
384 207 384 254

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100000048|Ga0070698_10000004821
Length 266
Sequence MASGSVTKMLFPIADENEDRRSTPWVNYTIILINIFVFVFLQGLGSNDRFTYAFSTVPGEIVTGRDLVTPDRIVVEPITGQRVPLPGLQPTPIPVFLTLITSMFMHGGIAHIFGNMLFLWIFGDNIEDRLGHFRYLIFYLVCGVLAGLAHVFATFVFAGDNIASLLVPSLGASGAISGVLGAYILLFPTKRVTVLLSWFITQVPAFVAIGLWFVFQLISGLGMLGGGSQQGGVAYAAHIGGFVAGLALIKIFEIGRPKGNYPGPAY

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
178 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
179 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
180 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
184 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
185 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
186 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
187 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
188 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
189 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
190 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
191 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
192 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
193 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.86
Rhizosphere 96.61
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000412 3300000532 Bacteria 4178
2 JGI24748J21848_1000016 3300002074 Bacteria 134042
3 JGI24034J26672_10000016 3300002239 Bacteria 133802
4 Ga0065714_10002186 3300005288 Bacteria 191932
5 Ga0065704_10003229 3300005289 Bacteria 6476
6 Ga0065712_10000113 3300005290 Bacteria 191931
7 Ga0065712_10030364 3300005290 Bacteria 1376
8 Ga0065715_10090024 3300005293 Bacteria 7832
9 Ga0065715_10116659 3300005293 Bacteria 2325
10 Ga0065715_10183717 3300005293 Bacteria 1458
11 Ga0065715_10199839 3300005293 Bacteria 1366
12 Ga0065715_10378143 3300005293 Unclassified 911
13 Ga0065707_10001531 3300005295 Bacteria 6255
14 Ga0065707_10117348 3300005295 Bacteria 2185
15 Ga0065707_10211839 3300005295 Bacteria 1261
16 Ga0070690_100027893 3300005330 Unclassified 3494
17 Ga0070690_100505604 3300005330 Bacteria 905
18 Ga0068869_100022495 3300005334 Bacteria 4345
19 Ga0068869_100050405 3300005334 Unclassified 3017
20 Ga0068869_100070240 3300005334 Unclassified 2590
21 Ga0068869_100190156 3300005334 Bacteria 1614
22 Ga0068869_100437362 3300005334 Bacteria 1082
23 Ga0070666_10371444 3300005335 Bacteria 1026
24 Ga0070680_100000139 3300005336 Bacteria 44398
25 Ga0070680_100140245 3300005336 Unclassified 2027
26 Ga0070682_100000311 3300005337 Bacteria 33637
27 Ga0070682_100060016 3300005337 Bacteria 2404
28 Ga0068868_100516971 3300005338 Unclassified 1048
29 Ga0070660_100303716 3300005339 Bacteria 1309
30 Ga0070689_100001586 3300005340 Bacteria 14501
31 Ga0070689_100450996 3300005340 Bacteria 1094
32 Ga0070691_10189991 3300005341 Bacteria 1074
33 Ga0070661_100065157 3300005344 Bacteria 2677
34 Ga0070692_10071913 3300005345 Bacteria 1844
35 Ga0070668_100724237 3300005347 Bacteria 879
36 Ga0070669_100242571 3300005353 Bacteria 1432
37 Ga0070675_100061687 3300005354 Bacteria 3096
38 Ga0070671_100017489 3300005355 Bacteria 5808
39 Ga0070671_100042172 3300005355 Unclassified 3793
40 Ga0070673_100020213 3300005364 Unclassified 4799
41 Ga0070688_100303820 3300005365 Bacteria 1154
42 Ga0070659_100002723 3300005366 Bacteria 12570
43 Ga0070667_100074645 3300005367 Bacteria 2893
44 Ga0070667_100104709 3300005367 Unclassified 2448
45 Ga0070700_100071155 3300005441 Bacteria 2220
46 Ga0070700_100239082 3300005441 Unclassified 1297
47 Ga0070694_100005292 3300005444 Bacteria 7804
48 Ga0070694_100033922 3300005444 Bacteria 3363
49 Ga0070694_100286534 3300005444 Bacteria 1257
50 Ga0070708_100328812 3300005445 Bacteria 1440
51 Ga0070681_10000350 3300005458 Bacteria 37194
52 Ga0070681_10063534 3300005458 Bacteria 3664
53 Ga0070681_10075259 3300005458 Bacteria 3336
54 Ga0070681_10586664 3300005458 Bacteria 1029
55 Ga0068867_100141340 3300005459 Bacteria 1882
56 Ga0070685_10031651 3300005466 Bacteria 2957
57 Ga0070706_100000019 3300005467 Bacteria 166483
58 Ga0070706_100001576 3300005467 Bacteria 23790
59 Ga0070706_100098697 3300005467 Bacteria 2714
60 Ga0070706_100508968 3300005467 Bacteria 1120
61 Ga0070707_100000517 3300005468 Bacteria 38472
62 Ga0070707_100161792 3300005468 Bacteria 2181
63 Ga0070707_100423393 3300005468 Bacteria 1292
64 Ga0070707_100518908 3300005468 Unclassified 1153
65 Ga0070707_100780068 3300005468 Unclassified 919
66 Ga0070698_100000048 3300005471 Bacteria 84010
67 Ga0070698_100011152 3300005471 Bacteria 9548
68 Ga0070698_100012329 3300005471 Bacteria 9052
69 Ga0070698_100015935 3300005471 Bacteria 7937
70 Ga0070699_100361576 3300005518 Bacteria 1308
71 Ga0070679_100000059 3300005530 Bacteria 81792
72 Ga0070679_100028390 3300005530 Bacteria 5516
73 Ga0070697_100083361 3300005536 Bacteria 2637
74 Ga0070697_100143262 3300005536 Bacteria 2011
75 Ga0070697_100150408 3300005536 Archaea 1962
76 Ga0070697_100167766 3300005536 Bacteria 1857
77 Ga0070697_100167832 3300005536 Unclassified 1856
78 Ga0070697_100177144 3300005536 Unclassified 1806
79 Ga0070697_100177988 3300005536 Unclassified 1802
80 Ga0070697_100237774 3300005536 Bacteria 1555
81 Ga0068853_100011800 3300005539 Bacteria 7103
82 Ga0070686_100007940 3300005544 Bacteria 5934
83 Ga0070686_100023756 3300005544 Bacteria 3668
84 Ga0070695_100054421 3300005545 Bacteria 2575
85 Ga0070695_100137615 3300005545 Bacteria 1690
86 Ga0070695_100165589 3300005545 Bacteria 1556
87 Ga0070696_100274644 3300005546 Bacteria 1283
88 Ga0070696_100323104 3300005546 Bacteria 1188
89 Ga0070693_100066622 3300005547 Bacteria 2108
90 Ga0070704_100000278 3300005549 Bacteria 22517
91 Ga0070704_100043105 3300005549 Bacteria 3126
92 Ga0070704_100209046 3300005549 Bacteria 1580
93 Ga0070664_100007058 3300005564 Bacteria 9065
94 Ga0070664_100247672 3300005564 Unclassified 1601
95 Ga0070664_100620307 3300005564 Bacteria 1004
96 Ga0068857_100008041 3300005577 Bacteria 9095
97 Ga0068857_100694246 3300005577 Bacteria 967
98 Ga0068854_100038559 3300005578 Bacteria 3361
99 Ga0068854_100084631 3300005578 Bacteria 2347
100 Ga0068854_100265093 3300005578 Bacteria 1377
101 Ga0068852_100153727 3300005616 Bacteria 2142
102 Ga0068859_100087048 3300005617 Unclassified 3171
103 Ga0068859_100100077 3300005617 Bacteria 2954
104 Ga0068859_100195189 3300005617 Bacteria 2108
105 Ga0068859_100196450 3300005617 Bacteria 2102
106 Ga0068859_100272175 3300005617 Bacteria 1786
107 Ga0068859_100307531 3300005617 Bacteria 1678
108 Ga0068864_100006010 3300005618 Bacteria 9965
109 Ga0068864_100024763 3300005618 Bacteria 5049
110 Ga0068864_100189467 3300005618 Bacteria 1885
111 Ga0068864_100228884 3300005618 Bacteria 1718
112 Ga0068866_10008685 3300005718 Bacteria 4294
113 Ga0068861_100087302 3300005719 Bacteria 2454
114 Ga0068870_10337525 3300005840 Bacteria 963
115 Ga0068863_100080143 3300005841 Unclassified 3093
116 Ga0068863_100135311 3300005841 Bacteria 2354
117 Ga0068863_100169528 3300005841 Bacteria 2093
118 Ga0068858_100000041 3300005842 Bacteria 133840
119 Ga0068858_100024283 3300005842 Bacteria 5649
120 Ga0068858_100025920 3300005842 Bacteria 5452
121 Ga0068858_100076240 3300005842 Unclassified 3114
122 Ga0068860_100065793 3300005843 Bacteria 3442
123 Ga0081539_10000669 3300005985 Bacteria 68738
124 Ga0070715_10000004 3300006163 Bacteria 305411
125 Ga0070716_100000001 3300006173 Bacteria 400668
126 Ga0070716_100092996 3300006173 Bacteria 1830
127 Ga0097621_100003835 3300006237 Bacteria 10413
128 Ga0097621_100046762 3300006237 Bacteria 3503
129 Ga0068871_100049542 3300006358 Unclassified 3395
130 Ga0068871_100155654 3300006358 Bacteria 1952
131 Ga0075428_100118306 3300006844 Unclassified 2885
132 Ga0075430_100105683 3300006846 Bacteria 2349
133 Ga0075431_100017703 3300006847 Bacteria 7245
134 Ga0075431_100034025 3300006847 Bacteria 5251
135 Ga0075433_10246015 3300006852 Bacteria 1587
136 Ga0075434_100069301 3300006871 Bacteria 3517
137 Ga0075434_100075114 3300006871 Bacteria 3373
138 Ga0075434_100115770 3300006871 Bacteria 2693
139 Ga0075434_100154292 3300006871 Bacteria 2316
140 Ga0075434_100444780 3300006871 Bacteria 1317
141 Ga0075434_100507119 3300006871 Bacteria 1227
142 Ga0075434_100706786 3300006871 Unclassified 1025
143 Ga0075429_100156019 3300006880 Bacteria 1999
144 Ga0075429_100208648 3300006880 Bacteria 1711
145 Ga0075429_100297308 3300006880 Bacteria 1413
146 Ga0068865_100005713 3300006881 Bacteria 7561
147 Ga0068865_100027544 3300006881 Unclassified 3755
148 Ga0075436_100000176 3300006914 Bacteria 39845
149 Ga0097620_100087046 3300006931 Unclassified 3171
150 Ga0097620_100100075 3300006931 Bacteria 2954
151 Ga0097620_100195186 3300006931 Bacteria 2108
152 Ga0097620_100196457 3300006931 Bacteria 2102
153 Ga0097620_100272144 3300006931 Bacteria 1786
154 Ga0097620_100307522 3300006931 Bacteria 1678
155 Ga0075435_100002076 3300007076 Bacteria 13142
156 Ga0075435_100169585 3300007076 Bacteria 1841
157 Ga0099794_10058843 3300007265 Bacteria 1863
158 Ga0099794_10248569 3300007265 Bacteria 917
159 Ga0105240_10184648 3300009093 Bacteria 2457
160 Ga0111539_10148585 3300009094 Bacteria 2743
161 Ga0111539_10550341 3300009094 Bacteria 1344
162 Ga0105245_10042062 3300009098 Bacteria 4076
163 Ga0105245_10245942 3300009098 Bacteria 1736
164 Ga0105245_11189057 3300009098 Bacteria 810
165 Ga0105247_10000083 3300009101 Bacteria 105622
166 Ga0114129_10010635 3300009147 Bacteria 13125
167 Ga0114129_10042042 3300009147 Bacteria 6436
168 Ga0114129_10573264 3300009147 Bacteria 1465
169 Ga0114129_10650512 3300009147 Bacteria 1360
170 Ga0114129_10917628 3300009147 Bacteria 1109
171 Ga0105243_10026478 3300009148 Bacteria 4439
172 Ga0105243_10037454 3300009148 Unclassified 3770
173 Ga0105243_10408516 3300009148 Bacteria 1263
174 Ga0105241_10010731 3300009174 Bacteria 6724
175 Ga0105241_10128974 3300009174 Bacteria 2045
176 Ga0105241_10438383 3300009174 Bacteria 1153
177 Ga0105242_10350912 3300009176 Bacteria 1362
178 Ga0105242_11011632 3300009176 Bacteria 840
179 Ga0105248_10011605 3300009177 Bacteria 9705
180 Ga0105248_10014958 3300009177 Bacteria 8542
181 Ga0105248_10252151 3300009177 Bacteria 1986
182 Ga0105248_10600722 3300009177 Bacteria 1242
183 Ga0105248_11051092 3300009177 Unclassified 920
184 Ga0105237_10160924 3300009545 Bacteria 2243
185 Ga0105237_10225442 3300009545 Bacteria 1875
186 Ga0105249_10027205 3300009553 Bacteria 5160
187 Ga0099796_10032593 3300010159 Bacteria 1709
188 Ga0105239_10040519 3300010375 Bacteria 5103
189 Ga0105239_10072943 3300010375 Bacteria 3774
190 Ga0105239_10513409 3300010375 Bacteria 1363
191 Ga0157373_10235183 3300013100 Bacteria 1294
192 Ga0157374_10072238 3300013296 Bacteria 3255
193 Ga0157374_10096038 3300013296 Bacteria 2835
194 Ga0157374_10794409 3300013296 Bacteria 962
195 Ga0157378_10012900 3300013297 Bacteria 7316
196 Ga0157378_10015583 3300013297 Bacteria 6656
197 Ga0157378_10055180 3300013297 Bacteria 3539
198 Ga0157378_10061703 3300013297 Bacteria 3347
199 Ga0157378_10065109 3300013297 Bacteria 3262
200 Ga0157378_10166304 3300013297 Unclassified 2066
201 Ga0157378_10265801 3300013297 Bacteria 1648
202 Ga0157378_10343808 3300013297 Bacteria 1455
203 Ga0163162_10019820 3300013306 Bacteria 6604
204 Ga0163162_10030465 3300013306 Bacteria 5345
205 Ga0163162_10576281 3300013306 Bacteria 1253
206 Ga0163162_10725489 3300013306 Bacteria 1114
207 Ga0163162_10933268 3300013306 Bacteria 980
208 Ga0157372_10031443 3300013307 Bacteria 5812
209 Ga0157375_10021791 3300013308 Bacteria 5885
210 Ga0157375_10053540 3300013308 Unclassified 3971
211 Ga0163163_10003037 3300014325 Bacteria 14218
212 Ga0163163_10036214 3300014325 Bacteria 4793
213 Ga0163163_10126421 3300014325 Bacteria 2595
214 Ga0163163_10173285 3300014325 Bacteria 2204
215 Ga0163163_10185263 3300014325 Unclassified 2129
216 Ga0157380_10016677 3300014326 Bacteria 5422
217 Ga0157380_10097825 3300014326 Unclassified 2437
218 Ga0157379_10265095 3300014968 Bacteria 1561
219 Ga0157379_10617757 3300014968 Bacteria 1013
220 Ga0157376_10010240 3300014969 Bacteria 6848
221 Ga0157376_10012094 3300014969 Bacteria 6390
222 Ga0163161_10250177 3300017792 Bacteria 1381
223 Ga0207672_1000016 3300025223 Bacteria 20942
224 Ga0207697_10069557 3300025315 Bacteria 1474
225 Ga0207642_10007081 3300025899 Bacteria 3766
226 Ga0207642_10054521 3300025899 Unclassified 1824
227 Ga0207642_10155078 3300025899 Bacteria 1223
228 Ga0207710_10000001 3300025900 Bacteria 1797433
229 Ga0207688_10101649 3300025901 Bacteria 1661
230 Ga0207680_10325040 3300025903 Bacteria 1076
231 Ga0207685_10000004 3300025905 Bacteria 305368
232 Ga0207643_10076994 3300025908 Bacteria 1928
233 Ga0207643_10177045 3300025908 Bacteria 1289
234 Ga0207684_10000079 3300025910 Bacteria 179842
235 Ga0207684_10003819 3300025910 Bacteria 14513
236 Ga0207684_10028652 3300025910 Bacteria 4745
237 Ga0207684_10295471 3300025910 Bacteria 1397
238 Ga0207684_10471013 3300025910 Bacteria 1078
239 Ga0207654_10019329 3300025911 Bacteria 3594
240 Ga0207707_10000008 3300025912 Bacteria 330313
241 Ga0207660_10004225 3300025917 Bacteria 9357
242 Ga0207660_10627818 3300025917 Bacteria 876
243 Ga0207662_10010572 3300025918 Bacteria 5101
244 Ga0207662_10037773 3300025918 Unclassified 2828
245 Ga0207662_10293122 3300025918 Unclassified 1079
246 Ga0207657_10036482 3300025919 Bacteria 4400
247 Ga0207652_10000085 3300025921 Bacteria 101176
248 Ga0207646_10001517 3300025922 Bacteria 28533
249 Ga0207646_10081792 3300025922 Bacteria 2888
250 Ga0207646_10614152 3300025922 Unclassified 975
251 Ga0207650_10523255 3300025925 Unclassified 993
252 Ga0207659_10118584 3300025926 Bacteria 2024
253 Ga0207659_10145690 3300025926 Bacteria 1844
254 Ga0207644_10044148 3300025931 Bacteria 3165
255 Ga0207644_10302572 3300025931 Unclassified 1289
256 Ga0207690_10178097 3300025932 Bacteria 1598
257 Ga0207706_10293173 3300025933 Unclassified 1418
258 Ga0207686_10002833 3300025934 Bacteria 9368
259 Ga0207686_10493141 3300025934 Unclassified 949
260 Ga0207709_10070671 3300025935 Bacteria 2214
261 Ga0207709_10172385 3300025935 Unclassified 1520
262 Ga0207670_10000612 3300025936 Bacteria 19296
263 Ga0207670_10576083 3300025936 Bacteria 922
264 Ga0207669_10099588 3300025937 Bacteria 1917
265 Ga0207704_10007125 3300025938 Bacteria 5263
266 Ga0207704_10201463 3300025938 Unclassified 1457
267 Ga0207665_10000002 3300025939 Bacteria 267895
268 Ga0207665_10006407 3300025939 Bacteria 7809
269 Ga0207665_10024325 3300025939 Bacteria 3993
270 Ga0207665_10053790 3300025939 Bacteria 2714
271 Ga0207691_10019869 3300025940 Bacteria 6354
272 Ga0207711_10195267 3300025941 Bacteria 1846
273 Ga0207711_10198109 3300025941 Bacteria 1832
274 Ga0207711_10209765 3300025941 Bacteria 1779
275 Ga0207711_10601193 3300025941 Unclassified 1026
276 Ga0207689_10004046 3300025942 Bacteria 13322
277 Ga0207689_10004823 3300025942 Bacteria 12164
278 Ga0207689_10437572 3300025942 Bacteria 1092
279 Ga0207679_10666613 3300025945 Bacteria 942
280 Ga0207651_10009393 3300025960 Bacteria 5351
281 Ga0207651_10268888 3300025960 Unclassified 1403
282 Ga0207712_10112272 3300025961 Bacteria 2046
283 Ga0207640_10118887 3300025981 Bacteria 1889
284 Ga0207677_10442177 3300026023 Unclassified 1112
285 Ga0207703_10000045 3300026035 Bacteria 156669
286 Ga0207703_10062223 3300026035 Unclassified 3058
287 Ga0207703_10226645 3300026035 Bacteria 1673
288 Ga0207639_10029833 3300026041 Bacteria 3997
289 Ga0207708_10071279 3300026075 Bacteria 2662
290 Ga0207708_10096303 3300026075 Unclassified 2287
291 Ga0207702_10107763 3300026078 Bacteria 2471
292 Ga0207641_10090913 3300026088 Bacteria 2670
293 Ga0207641_10584097 3300026088 Bacteria 1092
294 Ga0207648_10245514 3300026089 Bacteria 1595
295 Ga0207676_10002604 3300026095 Bacteria 12861
296 Ga0207676_10024657 3300026095 Bacteria 4454
297 Ga0207676_10561777 3300026095 Bacteria 1091
298 Ga0207674_10004760 3300026116 Bacteria 16272
299 Ga0207674_10067481 3300026116 Bacteria 3601
300 Ga0207675_100000539 3300026118 Bacteria 36903
301 Ga0207675_100020124 3300026118 Bacteria 6224
302 Ga0207428_10013006 3300027907 Bacteria 7289
303 Ga0268265_10682402 3300028380 Bacteria 990
304 Ga0268264_10032969 3300028381 Bacteria 4252
305 Ga0268264_10498623 3300028381 Bacteria 1187
306 Ga0307513_10036448 3300031456 Bacteria 5486
307 Ga0307410_10379873 3300031852 Bacteria 1136
308 Ga0307416_100385110 3300032002 Bacteria 1434
309 Ga0307415_100131156 3300032126 Bacteria 1897
310 Ga0373941_0088315 3300035115 Bacteria 1059
311 Ga0395905_0213869 3300037471 Bacteria 1806
312 Ga0395901_0223692 3300038443 Bacteria 1967
313 Ga0242420_026062 3300038996 Bacteria 1065
314 Ga0436365_0364607 3300039437 Bacteria 5238
315 Ga0451577_0014256 3300042876 Bacteria 7410
316 Ga0451577_0037683 3300042876 Bacteria 4352
317 Ga0453683_0034098 3300044673 Bacteria 3209
318 Ga0453684_0258209 3300044712 Bacteria 1997
319 Ga0466971_0139137 3300044719 Bacteria 1130
320 Ga0466957_0001338 3300044842 Bacteria 12861
321 Ga0451576_0031581 3300045051 Bacteria 5644
322 Ga0451576_0048327 3300045051 Bacteria 4469
323 Ga0451576_0115933 3300045051 Bacteria 2789
324 Ga0495592_0455637 3300046454 Unclassified 801
325 Ga0495580_0073003 3300046472 Bacteria 2396
326 Ga0495632_0012789 3300046519 Bacteria 4817
327 Ga0495663_0000154 3300046525 Bacteria 27993
328 Ga0495668_0077108 3300046616 Bacteria 1830
329 Ga0495658_0215179 3300046683 Unclassified 1202
330 Ga0495669_0247671 3300046684 Bacteria 856
331 Ga0495613_0282566 3300046689 Bacteria 1152
332 Ga0495672_0009111 3300047320 Bacteria 7237
333 Ga0495615_0028134 3300048090 Bacteria 1325
334 Ga0496102_0043354 3300048905 Bacteria 4079
335 Ga0496103_0006385 3300048906 Bacteria 7044
336 Ga0496107_0492036 3300048910 Bacteria 910
337 Ga0496108_0035963 3300048911 Bacteria 4119
338 Ga0496110_0335820 3300048913 Bacteria 1377
339 Ga0496111_0171929 3300048914 Bacteria 1610
340 Ga0496112_0094713 3300048915 Bacteria 2957
341 Ga0496112_0431733 3300048915 Bacteria 1256
342 Ga0496112_0594048 3300048915 Bacteria 1039
343 Ga0496112_0599431 3300048915 Bacteria 1034
344 Ga0496112_0826273 3300048915 Bacteria 851
345 Ga0501290_005822 3300049513 Bacteria 1537
346 Ga0501291_000902 3300049514 Bacteria 3402
347 Ga0501296_000889 3300049519 Bacteria 2937
348 Ga0501299_000266 3300049522 Bacteria 5989
349 Ga0501038_0002878 3300049574 Bacteria 16052
350 Ga0501047_0154493 3300049581 Bacteria 2169
351 Ga0501202_009204 3300049652 Bacteria 1811
352 Ga0501216_001967 3300049660 Bacteria 2853
353 Ga0501217_002116 3300049661 Bacteria 3853
354 Ga0501235_007777 3300049669 Bacteria 2337
355 Ga0501251_009350 3300049681 Bacteria 1127
356 Ga0501253_002201 3300049683 Bacteria 2159
357 Ga0501256_001192 3300049685 Bacteria 1870
358 Ga0501258_005299 3300049687 Bacteria 1247
359 Ga0501273_011239 3300049770 Bacteria 1112
360 Ga0501274_000668 3300049771 Bacteria 2482
361 Ga0501283_002122 3300049779 Bacteria 2570
362 Ga0501035_0118626 3300049822 Bacteria 2315
363 Ga0501044_0029516 3300049823 Bacteria 5782
364 Ga0501045_0512141 3300049824 Unclassified 891
365 nmdc:mga05p37_132496_c1 3300050507 Bacteria 3058
366 nmdc:mga05p37_165511_c1 3300050507 Bacteria 2699
367 nmdc:mga05p37_35677_c1 3300050507 Bacteria 6099
368 nmdc:mga05p37_425648_c1 3300050507 Unclassified 1544
369 nmdc:mga0qj67_40669_c1 3300050509 Bacteria 3654
370 nmdc:mga06r32_6749_c1 3300050510 Bacteria 4430
371 nmdc:mga08y16_137556_c1 3300050511 Bacteria 2539
372 nmdc:mga08y16_9954_c1 3300050511 Bacteria 9981
373 nmdc:mga0n895_1120503_c1 3300050512 Bacteria 764
374 nmdc:mga0n895_196310_c1 3300050512 Archaea 2049
375 nmdc:mga0n895_633830_c1 3300050512 Unclassified 1069
376 nmdc:mga0n895_86666_c1 3300050512 Bacteria 3128
377 nmdc:mga0rr50_248_c1 3300050513 Bacteria 29258
378 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
379 nmdc:mga0a205_58119_c1 3300050515 Bacteria 3735
380 nmdc:mga0a205_62630_c1 3300050515 Bacteria 3594
381 nmdc:mga0a205_83344_c1 3300050515 Bacteria 3088
382 Ga0495601_0111110 3300053077 Bacteria 1775
383 Ga0501082_0670018 3300060353 Unclassified 908
384 Ga0530510_0036538 3300061734 Bacteria 3541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_132496_c1 nmdc:mga05p37_132496_c1_1114_1857 208
2 3300042876 Ga0451577_0014256 Ga0451577_0014256_3758_4438 212
3 3300044712 Ga0453684_0258209 Ga0453684_0258209_44_724 212
4 3300045051 Ga0451576_0031581 Ga0451576_0031581_3248_3928 212
5 3300006880 Ga0075429_100156019 Ga0075429_1001560192 213
6 3300061734 Ga0530510_0036538 Ga0530510_0036538_2859_3503 213
7 3300006847 Ga0075431_100017703 Ga0075431_1000177032 218
8 3300009147 Ga0114129_10042042 Ga0114129_100420423 218
9 3300050510 nmdc:mga06r32_6749_c1 nmdc:mga06r32_6749_c1_1328_2071 218
10 3300049574 Ga0501038_0002878 Ga0501038_0002878_4131_4892 222
11 3300046454 Ga0495592_0455637 Ga0495592_0455637_22_717 224
12 3300046689 Ga0495613_0282566 Ga0495613_0282566_16_711 224
13 3300037471 Ga0395905_0213869 Ga0395905_0213869_150_911 227
14 3300005337 Ga0070682_100060016 Ga0070682_1000600163 232
15 3300006871 Ga0075434_100069301 Ga0075434_1000693012 232
16 3300013307 Ga0157372_10031443 Ga0157372_100314432 232
17 3300049687 Ga0501258_005299 Ga0501258_005299_23_727 232
18 3300050512 nmdc:mga0n895_1120503_c1 nmdc:mga0n895_1120503_c1_25_729 232
19 3300050515 nmdc:mga0a205_62630_c1 nmdc:mga0a205_62630_c1_1365_2069 232
20 3300044719 Ga0466971_0139137 Ga0466971_0139137_27_794 237
21 3300044842 Ga0466957_0001338 Ga0466957_0001338_5734_6501 237
22 3300039437 Ga0436365_0364607 Ga0436365_0364607_4156_4899 242
23 3300046519 Ga0495632_0012789 Ga0495632_0012789_4043_4783 242
24 3300025939 Ga0207665_10053790 Ga0207665_100537902 243
25 3300042876 Ga0451577_0037683 Ga0451577_0037683_1324_2103 243
26 3300005467 Ga0070706_100508968 Ga0070706_1005089682 247
27 3300005549 Ga0070704_100043105 Ga0070704_1000431052 247
28 3300049581 Ga0501047_0154493 Ga0501047_0154493_989_1753 247
29 3300049822 Ga0501035_0118626 Ga0501035_0118626_1458_2222 247
30 3300049823 Ga0501044_0029516 Ga0501044_0029516_3545_4309 247
31 3300005617 Ga0068859_100195189 Ga0068859_1001951892 248
32 3300006931 Ga0097620_100195186 Ga0097620_1001951862 248
33 3300014325 Ga0163163_10126421 Ga0163163_101264212 248
34 3300031456 Ga0307513_10036448 Ga0307513_100364486 248
35 3300035115 Ga0373941_0088315 Ga0373941_0088315_31_783 248
36 3300005544 Ga0070686_100007940 Ga0070686_1000079402 249
37 3300005546 Ga0070696_100323104 Ga0070696_1003231042 249
38 3300005577 Ga0068857_100694246 Ga0068857_1006942462 249
39 3300005617 Ga0068859_100272175 Ga0068859_1002721752 249
40 3300006846 Ga0075430_100105683 Ga0075430_1001056832 249
41 3300006847 Ga0075431_100034025 Ga0075431_1000340254 249
42 3300006880 Ga0075429_100297308 Ga0075429_1002973082 249
43 3300006881 Ga0068865_100005713 Ga0068865_1000057137 249
44 3300006931 Ga0097620_100272144 Ga0097620_1002721442 249
45 3300009147 Ga0114129_10010635 Ga0114129_100106357 249
46 3300013296 Ga0157374_10072238 Ga0157374_100722383 249
47 3300013297 Ga0157378_10061703 Ga0157378_100617031 249
48 3300014326 Ga0157380_10016677 Ga0157380_100166772 249
49 3300025938 Ga0207704_10007125 Ga0207704_100071253 249
50 3300026116 Ga0207674_10067481 Ga0207674_100674813 249
51 3300050509 nmdc:mga0qj67_40669_c1 nmdc:mga0qj67_40669_c1_14_766 249
52 3300053077 Ga0495601_0111110 Ga0495601_0111110_164_1024 249
53 3300005330 Ga0070690_100027893 Ga0070690_1000278932 250
54 3300005364 Ga0070673_100020213 Ga0070673_1000202135 250
55 3300005441 Ga0070700_100071155 Ga0070700_1000711552 250
56 3300005444 Ga0070694_100005292 Ga0070694_1000052926 250
57 3300005445 Ga0070708_100328812 Ga0070708_1003288121 250
58 3300005546 Ga0070696_100274644 Ga0070696_1002746441 250
59 3300005547 Ga0070693_100066622 Ga0070693_1000666222 250
60 3300005578 Ga0068854_100084631 Ga0068854_1000846312 250
61 3300005718 Ga0068866_10008685 Ga0068866_100086854 250
62 3300005842 Ga0068858_100025920 Ga0068858_1000259202 250
63 3300006173 Ga0070716_100092996 Ga0070716_1000929962 250
64 3300006871 Ga0075434_100444780 Ga0075434_1004447802 250
65 3300006871 Ga0075434_100706786 Ga0075434_1007067862 250
66 3300006914 Ga0075436_100000176 Ga0075436_1000001762 250
67 3300007076 Ga0075435_100002076 Ga0075435_1000020762 250
68 3300009147 Ga0114129_10917628 Ga0114129_109176281 250
69 3300009174 Ga0105241_10010731 Ga0105241_100107313 250
70 3300009177 Ga0105248_10600722 Ga0105248_106007222 250
71 3300010159 Ga0099796_10032593 Ga0099796_100325932 250
72 3300013296 Ga0157374_10794409 Ga0157374_107944091 250
73 3300013297 Ga0157378_10055180 Ga0157378_100551803 250
74 3300013297 Ga0157378_10065109 Ga0157378_100651092 250
75 3300013297 Ga0157378_10166304 Ga0157378_101663044 250
76 3300013297 Ga0157378_10343808 Ga0157378_103438081 250
77 3300025899 Ga0207642_10007081 Ga0207642_100070813 250
78 3300025911 Ga0207654_10019329 Ga0207654_100193292 250
79 3300025918 Ga0207662_10037773 Ga0207662_100377735 250
80 3300025937 Ga0207669_10099588 Ga0207669_100995882 250
81 3300025939 Ga0207665_10024325 Ga0207665_100243252 250
82 3300025941 Ga0207711_10601193 Ga0207711_106011931 250
83 3300025960 Ga0207651_10009393 Ga0207651_100093932 250
84 3300025981 Ga0207640_10118887 Ga0207640_101188871 250
85 3300026035 Ga0207703_10226645 Ga0207703_102266452 250
86 3300026075 Ga0207708_10071279 Ga0207708_100712794 250
87 3300050507 nmdc:mga05p37_425648_c1 nmdc:mga05p37_425648_c1_278_1030 250
88 3300050512 nmdc:mga0n895_633830_c1 nmdc:mga0n895_633830_c1_164_937 250
89 3300050513 nmdc:mga0rr50_248_c1 nmdc:mga0rr50_248_c1_28196_28969 250
90 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_176242_177015 250
91 3300005295 Ga0065707_10117348 Ga0065707_101173482 251
92 3300005295 Ga0065707_10211839 Ga0065707_102118392 251
93 3300005334 Ga0068869_100022495 Ga0068869_1000224955 251
94 3300005334 Ga0068869_100190156 Ga0068869_1001901562 251
95 3300005337 Ga0070682_100000311 Ga0070682_10000031128 251
96 3300005341 Ga0070691_10189991 Ga0070691_101899912 251
97 3300005353 Ga0070669_100242571 Ga0070669_1002425712 251
98 3300005444 Ga0070694_100033922 Ga0070694_1000339221 251
99 3300005467 Ga0070706_100001576 Ga0070706_1000015764 251
100 3300005468 Ga0070707_100000517 Ga0070707_1000005174 251
101 3300005468 Ga0070707_100161792 Ga0070707_1001617924 251
102 3300005468 Ga0070707_100518908 Ga0070707_1005189081 251
103 3300005468 Ga0070707_100780068 Ga0070707_1007800681 251
104 3300005471 Ga0070698_100000048 Ga0070698_10000004821 251
105 3300005471 Ga0070698_100012329 Ga0070698_1000123296 251
106 3300005471 Ga0070698_100015935 Ga0070698_1000159357 251
107 3300005536 Ga0070697_100083361 Ga0070697_1000833613 251
108 3300005536 Ga0070697_100143262 Ga0070697_1001432623 251
109 3300005536 Ga0070697_100167766 Ga0070697_1001677663 251
110 3300005536 Ga0070697_100167832 Ga0070697_1001678321 251
111 3300005536 Ga0070697_100177144 Ga0070697_1001771442 251
112 3300005545 Ga0070695_100137615 Ga0070695_1001376151 251
113 3300005545 Ga0070695_100165589 Ga0070695_1001655891 251
114 3300005549 Ga0070704_100000278 Ga0070704_1000002782 251
115 3300005617 Ga0068859_100196450 Ga0068859_1001964502 251
116 3300006163 Ga0070715_10000004 Ga0070715_10000004140 251
117 3300006173 Ga0070716_100000001 Ga0070716_100000001198 251
118 3300006931 Ga0097620_100196457 Ga0097620_1001964572 251
119 3300007265 Ga0099794_10058843 Ga0099794_100588432 251
120 3300009148 Ga0105243_10026478 Ga0105243_100264784 251
121 3300009148 Ga0105243_10408516 Ga0105243_104085161 251
122 3300009177 Ga0105248_10014958 Ga0105248_100149586 251
123 3300013306 Ga0163162_10576281 Ga0163162_105762811 251
124 3300025905 Ga0207685_10000004 Ga0207685_10000004115 251
125 3300025908 Ga0207643_10076994 Ga0207643_100769942 251
126 3300025910 Ga0207684_10003819 Ga0207684_1000381913 251
127 3300025910 Ga0207684_10028652 Ga0207684_100286524 251
128 3300025910 Ga0207684_10295471 Ga0207684_102954711 251
129 3300025910 Ga0207684_10471013 Ga0207684_104710131 251
130 3300025918 Ga0207662_10293122 Ga0207662_102931221 251
131 3300025922 Ga0207646_10001517 Ga0207646_1000151729 251
132 3300025922 Ga0207646_10081792 Ga0207646_100817922 251
133 3300025922 Ga0207646_10614152 Ga0207646_106141521 251
134 3300025934 Ga0207686_10002833 Ga0207686_100028338 251
135 3300025935 Ga0207709_10070671 Ga0207709_100706712 251
136 3300025939 Ga0207665_10000002 Ga0207665_1000000276 251
137 3300025939 Ga0207665_10006407 Ga0207665_100064078 251
138 3300025941 Ga0207711_10209765 Ga0207711_102097652 251
139 3300046525 Ga0495663_0000154 Ga0495663_0000154_18248_19024 251
140 3300046616 Ga0495668_0077108 Ga0495668_0077108_724_1500 251
141 3300047320 Ga0495672_0009111 Ga0495672_0009111_2029_2790 251
142 3300048090 Ga0495615_0028134 Ga0495615_0028134_429_1184 251
143 3300048914 Ga0496111_0171929 Ga0496111_0171929_223_984 251
144 3300048915 Ga0496112_0599431 Ga0496112_0599431_109_867 251
145 3300049513 Ga0501290_005822 Ga0501290_005822_761_1522 251
146 3300049514 Ga0501291_000902 Ga0501291_000902_1693_2454 251
147 3300049519 Ga0501296_000889 Ga0501296_000889_1542_2303 251
148 3300049522 Ga0501299_000266 Ga0501299_000266_2079_2840 251
149 3300049652 Ga0501202_009204 Ga0501202_009204_834_1595 251
150 3300049660 Ga0501216_001967 Ga0501216_001967_1250_2011 251
151 3300049661 Ga0501217_002116 Ga0501217_002116_838_1599 251
152 3300049669 Ga0501235_007777 Ga0501235_007777_647_1411 251
153 3300049681 Ga0501251_009350 Ga0501251_009350_258_1019 251
154 3300049683 Ga0501253_002201 Ga0501253_002201_817_1578 251
155 3300049685 Ga0501256_001192 Ga0501256_001192_1046_1807 251
156 3300049770 Ga0501273_011239 Ga0501273_011239_16_777 251
157 3300049771 Ga0501274_000668 Ga0501274_000668_121_882 251
158 3300049779 Ga0501283_002122 Ga0501283_002122_949_1710 251
159 3300049824 Ga0501045_0512141 Ga0501045_0512141_118_873 251
160 3300050507 nmdc:mga05p37_35677_c1 nmdc:mga05p37_35677_c1_2108_2884 251
161 3300060353 Ga0501082_0670018 Ga0501082_0670018_62_817 251
162 3300002074 JGI24748J21848_1000016 JGI24748J21848_100001692 252
163 3300002239 JGI24034J26672_10000016 JGI24034J26672_1000001691 252
164 3300005289 Ga0065704_10003229 Ga0065704_100032296 252
165 3300005295 Ga0065707_10001531 Ga0065707_100015312 252
166 3300005458 Ga0070681_10063534 Ga0070681_100635342 252
167 3300005467 Ga0070706_100098697 Ga0070706_1000986972 252
168 3300005468 Ga0070707_100423393 Ga0070707_1004233932 252
169 3300005518 Ga0070699_100361576 Ga0070699_1003615762 252
170 3300005536 Ga0070697_100177988 Ga0070697_1001779882 252
171 3300005545 Ga0070695_100054421 Ga0070695_1000544211 252
172 3300005549 Ga0070704_100209046 Ga0070704_1002090462 252
173 3300005578 Ga0068854_100265093 Ga0068854_1002650932 252
174 3300005719 Ga0068861_100087302 Ga0068861_1000873024 252
175 3300005842 Ga0068858_100000041 Ga0068858_10000004193 252
176 3300006871 Ga0075434_100115770 Ga0075434_1001157705 252
177 3300006871 Ga0075434_100154292 Ga0075434_1001542924 252
178 3300007076 Ga0075435_100169585 Ga0075435_1001695852 252
179 3300007265 Ga0099794_10248569 Ga0099794_102485691 252
180 3300009098 Ga0105245_10042062 Ga0105245_100420622 252
181 3300009101 Ga0105247_10000083 Ga0105247_1000008360 252
182 3300009553 Ga0105249_10027205 Ga0105249_100272052 252
183 3300010375 Ga0105239_10072943 Ga0105239_100729436 252
184 3300013297 Ga0157378_10015583 Ga0157378_1001558310 252
185 3300013306 Ga0163162_10019820 Ga0163162_100198206 252
186 3300014968 Ga0157379_10265095 Ga0157379_102650952 252
187 3300025223 Ga0207672_1000016 Ga0207672_10000166 252
188 3300025900 Ga0207710_10000001 Ga0207710_100000011543 252
189 3300025901 Ga0207688_10101649 Ga0207688_101016492 252
190 3300025926 Ga0207659_10145690 Ga0207659_101456902 252
191 3300025942 Ga0207689_10004046 Ga0207689_100040466 252
192 3300025961 Ga0207712_10112272 Ga0207712_101122723 252
193 3300026035 Ga0207703_10000045 Ga0207703_10000045111 252
194 3300026118 Ga0207675_100000539 Ga0207675_10000053914 252
195 3300027907 Ga0207428_10013006 Ga0207428_100130063 252
196 3300031852 Ga0307410_10379873 Ga0307410_103798732 252
197 3300032002 Ga0307416_100385110 Ga0307416_1003851102 252
198 3300032126 Ga0307415_100131156 Ga0307415_1001311562 252
199 3300038443 Ga0395901_0223692 Ga0395901_0223692_549_1307 252
200 3300044673 Ga0453683_0034098 Ga0453683_0034098_168_947 252
201 3300045051 Ga0451576_0048327 Ga0451576_0048327_2647_3426 252
202 3300048915 Ga0496112_0094713 Ga0496112_0094713_1242_2000 252
203 3300050511 nmdc:mga08y16_9954_c1 nmdc:mga08y16_9954_c1_4803_5564 252
204 3300050512 nmdc:mga0n895_86666_c1 nmdc:mga0n895_86666_c1_1484_2263 252
205 3300000532 CNAas_1000412 CNAas_10004122 253
206 3300005288 Ga0065714_10002186 Ga0065714_1000218667 253
207 3300005290 Ga0065712_10000113 Ga0065712_1000011367 253
208 3300005290 Ga0065712_10030364 Ga0065712_100303642 253
209 3300005293 Ga0065715_10090024 Ga0065715_100900247 253
210 3300005293 Ga0065715_10116659 Ga0065715_101166592 253
211 3300005293 Ga0065715_10183717 Ga0065715_101837172 253
212 3300005293 Ga0065715_10199839 Ga0065715_101998392 253
213 3300005293 Ga0065715_10378143 Ga0065715_103781431 253
214 3300005330 Ga0070690_100505604 Ga0070690_1005056041 253
215 3300005334 Ga0068869_100050405 Ga0068869_1000504053 253
216 3300005334 Ga0068869_100070240 Ga0068869_1000702402 253
217 3300005334 Ga0068869_100437362 Ga0068869_1004373621 253
218 3300005335 Ga0070666_10371444 Ga0070666_103714442 253
219 3300005336 Ga0070680_100000139 Ga0070680_10000013932 253
220 3300005336 Ga0070680_100140245 Ga0070680_1001402452 253
221 3300005338 Ga0068868_100516971 Ga0068868_1005169711 253
222 3300005339 Ga0070660_100303716 Ga0070660_1003037162 253
223 3300005340 Ga0070689_100001586 Ga0070689_10000158610 253
224 3300005340 Ga0070689_100450996 Ga0070689_1004509961 253
225 3300005344 Ga0070661_100065157 Ga0070661_1000651573 253
226 3300005345 Ga0070692_10071913 Ga0070692_100719132 253
227 3300005347 Ga0070668_100724237 Ga0070668_1007242371 253
228 3300005354 Ga0070675_100061687 Ga0070675_1000616872 253
229 3300005355 Ga0070671_100017489 Ga0070671_1000174894 253
230 3300005355 Ga0070671_100042172 Ga0070671_1000421721 253
231 3300005365 Ga0070688_100303820 Ga0070688_1003038202 253
232 3300005366 Ga0070659_100002723 Ga0070659_1000027239 253
233 3300005367 Ga0070667_100074645 Ga0070667_1000746451 253
234 3300005367 Ga0070667_100104709 Ga0070667_1001047093 253
235 3300005441 Ga0070700_100239082 Ga0070700_1002390822 253
236 3300005444 Ga0070694_100286534 Ga0070694_1002865341 253
237 3300005458 Ga0070681_10000350 Ga0070681_100003506 253
238 3300005458 Ga0070681_10075259 Ga0070681_100752592 253
239 3300005458 Ga0070681_10586664 Ga0070681_105866641 253
240 3300005459 Ga0068867_100141340 Ga0068867_1001413402 253
241 3300005466 Ga0070685_10031651 Ga0070685_100316514 253
242 3300005467 Ga0070706_100000019 Ga0070706_100000019110 253
243 3300005471 Ga0070698_100011152 Ga0070698_10001115210 253
244 3300005530 Ga0070679_100000059 Ga0070679_10000005930 253
245 3300005530 Ga0070679_100028390 Ga0070679_1000283906 253
246 3300005536 Ga0070697_100150408 Ga0070697_1001504081 253
247 3300005536 Ga0070697_100237774 Ga0070697_1002377741 253
248 3300005539 Ga0068853_100011800 Ga0068853_1000118002 253
249 3300005544 Ga0070686_100023756 Ga0070686_1000237564 253
250 3300005564 Ga0070664_100007058 Ga0070664_1000070583 253
251 3300005564 Ga0070664_100247672 Ga0070664_1002476724 253
252 3300005564 Ga0070664_100620307 Ga0070664_1006203071 253
253 3300005577 Ga0068857_100008041 Ga0068857_1000080414 253
254 3300005578 Ga0068854_100038559 Ga0068854_1000385592 253
255 3300005616 Ga0068852_100153727 Ga0068852_1001537272 253
256 3300005617 Ga0068859_100087048 Ga0068859_1000870482 253
257 3300005617 Ga0068859_100100077 Ga0068859_1001000774 253
258 3300005617 Ga0068859_100307531 Ga0068859_1003075311 253
259 3300005618 Ga0068864_100006010 Ga0068864_1000060102 253
260 3300005618 Ga0068864_100024763 Ga0068864_1000247632 253
261 3300005618 Ga0068864_100189467 Ga0068864_1001894672 253
262 3300005618 Ga0068864_100228884 Ga0068864_1002288843 253
263 3300005840 Ga0068870_10337525 Ga0068870_103375251 253
264 3300005841 Ga0068863_100080143 Ga0068863_1000801433 253
265 3300005841 Ga0068863_100135311 Ga0068863_1001353112 253
266 3300005841 Ga0068863_100169528 Ga0068863_1001695282 253
267 3300005842 Ga0068858_100024283 Ga0068858_1000242836 253
268 3300005842 Ga0068858_100076240 Ga0068858_1000762402 253
269 3300005843 Ga0068860_100065793 Ga0068860_1000657931 253
270 3300005985 Ga0081539_10000669 Ga0081539_1000066946 253
271 3300006237 Ga0097621_100003835 Ga0097621_1000038357 253
272 3300006237 Ga0097621_100046762 Ga0097621_1000467623 253
273 3300006358 Ga0068871_100049542 Ga0068871_1000495423 253
274 3300006358 Ga0068871_100155654 Ga0068871_1001556541 253
275 3300006844 Ga0075428_100118306 Ga0075428_1001183062 253
276 3300006852 Ga0075433_10246015 Ga0075433_102460152 253
277 3300006871 Ga0075434_100075114 Ga0075434_1000751145 253
278 3300006871 Ga0075434_100507119 Ga0075434_1005071192 253
279 3300006880 Ga0075429_100208648 Ga0075429_1002086482 253
280 3300006881 Ga0068865_100027544 Ga0068865_1000275446 253
281 3300006931 Ga0097620_100087046 Ga0097620_1000870462 253
282 3300006931 Ga0097620_100100075 Ga0097620_1001000754 253
283 3300006931 Ga0097620_100307522 Ga0097620_1003075221 253
284 3300009093 Ga0105240_10184648 Ga0105240_101846485 253
285 3300009094 Ga0111539_10148585 Ga0111539_101485854 253
286 3300009094 Ga0111539_10550341 Ga0111539_105503412 253
287 3300009098 Ga0105245_10245942 Ga0105245_102459421 253
288 3300009098 Ga0105245_11189057 Ga0105245_111890571 253
289 3300009147 Ga0114129_10573264 Ga0114129_105732642 253
290 3300009147 Ga0114129_10650512 Ga0114129_106505122 253
291 3300009148 Ga0105243_10037454 Ga0105243_100374544 253
292 3300009174 Ga0105241_10128974 Ga0105241_101289742 253
293 3300009174 Ga0105241_10438383 Ga0105241_104383831 253
294 3300009176 Ga0105242_10350912 Ga0105242_103509121 253
295 3300009176 Ga0105242_11011632 Ga0105242_110116321 253
296 3300009177 Ga0105248_10011605 Ga0105248_100116057 253
297 3300009177 Ga0105248_10252151 Ga0105248_102521512 253
298 3300009177 Ga0105248_11051092 Ga0105248_110510921 253
299 3300009545 Ga0105237_10160924 Ga0105237_101609243 253
300 3300009545 Ga0105237_10225442 Ga0105237_102254421 253
301 3300010375 Ga0105239_10040519 Ga0105239_100405194 253
302 3300010375 Ga0105239_10513409 Ga0105239_105134091 253
303 3300013100 Ga0157373_10235183 Ga0157373_102351831 253
304 3300013296 Ga0157374_10096038 Ga0157374_100960382 253
305 3300013297 Ga0157378_10012900 Ga0157378_100129006 253
306 3300013297 Ga0157378_10265801 Ga0157378_102658012 253
307 3300013306 Ga0163162_10030465 Ga0163162_100304655 253
308 3300013306 Ga0163162_10725489 Ga0163162_107254891 253
309 3300013306 Ga0163162_10933268 Ga0163162_109332682 253
310 3300013308 Ga0157375_10021791 Ga0157375_100217914 253
311 3300013308 Ga0157375_10053540 Ga0157375_100535404 253
312 3300014325 Ga0163163_10003037 Ga0163163_100030378 253
313 3300014325 Ga0163163_10036214 Ga0163163_100362144 253
314 3300014325 Ga0163163_10173285 Ga0163163_101732852 253
315 3300014325 Ga0163163_10185263 Ga0163163_101852633 253
316 3300014326 Ga0157380_10097825 Ga0157380_100978251 253
317 3300014968 Ga0157379_10617757 Ga0157379_106177572 253
318 3300014969 Ga0157376_10010240 Ga0157376_100102404 253
319 3300014969 Ga0157376_10012094 Ga0157376_100120943 253
320 3300017792 Ga0163161_10250177 Ga0163161_102501772 253
321 3300025315 Ga0207697_10069557 Ga0207697_100695573 253
322 3300025899 Ga0207642_10054521 Ga0207642_100545213 253
323 3300025899 Ga0207642_10155078 Ga0207642_101550782 253
324 3300025903 Ga0207680_10325040 Ga0207680_103250402 253
325 3300025908 Ga0207643_10177045 Ga0207643_101770451 253
326 3300025910 Ga0207684_10000079 Ga0207684_10000079120 253
327 3300025912 Ga0207707_10000008 Ga0207707_1000000842 253
328 3300025917 Ga0207660_10004225 Ga0207660_100042254 253
329 3300025917 Ga0207660_10627818 Ga0207660_106278181 253
330 3300025918 Ga0207662_10010572 Ga0207662_100105723 253
331 3300025919 Ga0207657_10036482 Ga0207657_100364822 253
332 3300025921 Ga0207652_10000085 Ga0207652_1000008547 253
333 3300025925 Ga0207650_10523255 Ga0207650_105232551 253
334 3300025926 Ga0207659_10118584 Ga0207659_101185842 253
335 3300025931 Ga0207644_10044148 Ga0207644_100441483 253
336 3300025931 Ga0207644_10302572 Ga0207644_103025722 253
337 3300025932 Ga0207690_10178097 Ga0207690_101780972 253
338 3300025933 Ga0207706_10293173 Ga0207706_102931732 253
339 3300025934 Ga0207686_10493141 Ga0207686_104931411 253
340 3300025935 Ga0207709_10172385 Ga0207709_101723851 253
341 3300025936 Ga0207670_10000612 Ga0207670_1000061210 253
342 3300025936 Ga0207670_10576083 Ga0207670_105760831 253
343 3300025938 Ga0207704_10201463 Ga0207704_102014631 253
344 3300025940 Ga0207691_10019869 Ga0207691_100198696 253
345 3300025941 Ga0207711_10195267 Ga0207711_101952673 253
346 3300025941 Ga0207711_10198109 Ga0207711_101981092 253
347 3300025942 Ga0207689_10004823 Ga0207689_100048237 253
348 3300025942 Ga0207689_10437572 Ga0207689_104375722 253
349 3300025945 Ga0207679_10666613 Ga0207679_106666131 253
350 3300025960 Ga0207651_10268888 Ga0207651_102688882 253
351 3300026023 Ga0207677_10442177 Ga0207677_104421771 253
352 3300026035 Ga0207703_10062223 Ga0207703_100622233 253
353 3300026041 Ga0207639_10029833 Ga0207639_100298331 253
354 3300026075 Ga0207708_10096303 Ga0207708_100963032 253
355 3300026078 Ga0207702_10107763 Ga0207702_101077635 253
356 3300026088 Ga0207641_10090913 Ga0207641_100909132 253
357 3300026088 Ga0207641_10584097 Ga0207641_105840971 253
358 3300026089 Ga0207648_10245514 Ga0207648_102455142 253
359 3300026095 Ga0207676_10002604 Ga0207676_100026047 253
360 3300026095 Ga0207676_10024657 Ga0207676_100246572 253
361 3300026095 Ga0207676_10561777 Ga0207676_105617772 253
362 3300026116 Ga0207674_10004760 Ga0207674_100047606 253
363 3300026118 Ga0207675_100020124 Ga0207675_1000201246 253
364 3300028380 Ga0268265_10682402 Ga0268265_106824021 253
365 3300028381 Ga0268264_10032969 Ga0268264_100329694 253
366 3300028381 Ga0268264_10498623 Ga0268264_104986231 253
367 3300038996 Ga0242420_026062 Ga0242420_026062_68_847 253
368 3300045051 Ga0451576_0115933 Ga0451576_0115933_1250_2014 253
369 3300046472 Ga0495580_0073003 Ga0495580_0073003_194_955 253
370 3300046683 Ga0495658_0215179 Ga0495658_0215179_13_774 253
371 3300046684 Ga0495669_0247671 Ga0495669_0247671_65_829 253
372 3300048905 Ga0496102_0043354 Ga0496102_0043354_2543_3322 253
373 3300048906 Ga0496103_0006385 Ga0496103_0006385_5829_6608 253
374 3300048910 Ga0496107_0492036 Ga0496107_0492036_93_872 253
375 3300048911 Ga0496108_0035963 Ga0496108_0035963_318_1097 253
376 3300048913 Ga0496110_0335820 Ga0496110_0335820_42_809 253
377 3300048915 Ga0496112_0431733 Ga0496112_0431733_380_1147 253
378 3300048915 Ga0496112_0594048 Ga0496112_0594048_42_803 253
379 3300048915 Ga0496112_0826273 Ga0496112_0826273_23_787 253
380 3300050507 nmdc:mga05p37_165511_c1 nmdc:mga05p37_165511_c1_1752_2537 253
381 3300050511 nmdc:mga08y16_137556_c1 nmdc:mga08y16_137556_c1_878_1642 253
382 3300050512 nmdc:mga0n895_196310_c1 nmdc:mga0n895_196310_c1_358_1137 253
383 3300050515 nmdc:mga0a205_58119_c1 nmdc:mga0a205_58119_c1_122_889 253
384 3300050515 nmdc:mga0a205_83344_c1 nmdc:mga0a205_83344_c1_1161_1925 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

95

253

0.89

PF08551

DUF1751

Eukaryotic integral membrane protein (DUF1751)

90

184

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3odj-assembly1.cif.gz_A crystal structure of h. influenzae rhomboid glpg with disordered loop 4, helix 5 and loop 5 0.7448 13 242
6pjr-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7346 14 244
5f5k-assembly1.cif.gz_A e.coli glpg y205f mutant complexed with aldehyde inhibitor in dmpc/chapso bicelle 0.7308 14 244
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7241 14 242
6pjq-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.723 13 246
ID Description Score Start End Superfamily
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8363 12 245 1.20.1540.10
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.823 12 245 1.20.1540.10
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8133 15 239 1.20.1540.10
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8019 15 239 1.20.1540.10
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8001 15 248 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A7W1L2L7-F1-model_v4 Rhomboid family intramembrane serine protease 0.9613 3 142 GO:0004252
GO:0006508
GO:0016020
AF-A0A7W1L2L7-F1-model_v4 Rhomboid family intramembrane serine protease 0.9416 3 142 GO:0004252
GO:0006508
GO:0016020
AF-A0A3C1V434-F1-model_v4 Rhomboid family intramembrane serine protease 0.9381 1 238 GO:0004252
GO:0006508
GO:0016020
AF-A0A1A9I1U6-F1-model_v4 Rhomboid family intramembrane serine protease 0.9346 3 243 GO:0004252
GO:0006508
GO:0016020
AF-A0A3C1V434-F1-model_v4 Rhomboid family intramembrane serine protease 0.9303 1 238 GO:0004252
GO:0006508
GO:0016020

Feature Viewer

pLDDT pTM Quality
86.94 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map