F429873

General Info

Members Datasets Scaffolds Average Seq Length
384 170 768 110

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10332049|Ga0105240_103320492
Length 127
Sequence VEVPLFCVNKQILLIVDITLNEAQQQVDEWIKTVGVRYFNELTNLGILMEETGELARIMVRKYGEQSYKESDKGKDLADEMADVLWVLICLANQTGVNLSEALVKNFQKKNIRDAERHKNNNKLSNK

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
137 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
138 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
139 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
140 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
162 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
163 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
164 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
168 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
169 2914759650 Rhizosphaericola mali Isolate Rhizosphere
170 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 0.52
Rhizosphere 92.71
Stem 0
Stem Tuber 0
Unclassified 10.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10332049 3300009093 Bacteria 1730
2 rootH1_10128454 3300003316 Bacteria 2715
3 rootL2_10115267 3300003322 Bacteria 3166
4 rootL2_10257335 3300003322 Bacteria 2679
5 rootH1_10172628 3300003323 Bacteria 4482
6 Ga0065714_10319726 3300005288 Bacteria 670
7 Ga0070658_10007960 3300005327 Bacteria 8530
8 Ga0070658_10233153 3300005327 Bacteria 1559
9 Ga0070658_10628397 3300005327 Bacteria 931
10 Ga0070683_100273143 3300005329 Bacteria 1608
11 Ga0070670_100093583 3300005331 Bacteria 2585
12 Ga0070670_100465023 3300005331 Unclassified 1122
13 Ga0070670_100476173 3300005331 Bacteria 1108
14 Ga0070677_10510162 3300005333 Bacteria 653
15 Ga0068869_100033352 3300005334 Bacteria 3634
16 Ga0070666_10000185 3300005335 Bacteria 42683
17 Ga0070680_100161259 3300005336 Unclassified 1884
18 Ga0070682_100054851 3300005337 Bacteria 2502
19 Ga0068868_100008330 3300005338 Bacteria 7419
20 Ga0068868_100046016 3300005338 Bacteria 3415
21 Ga0068868_100629863 3300005338 Unclassified 953
22 Ga0068868_100965038 3300005338 Bacteria 778
23 Ga0070660_100001278 3300005339 Bacteria 17159
24 Ga0070660_100208131 3300005339 Bacteria 1587
25 Ga0070660_100235517 3300005339 Bacteria 1490
26 Ga0070660_100406690 3300005339 Unclassified 1126
27 Ga0070689_100047723 3300005340 Unclassified 3302
28 Ga0070668_100181505 3300005347 Bacteria 1719
29 Ga0070671_100030861 3300005355 Bacteria 4424
30 Ga0070671_100451441 3300005355 Bacteria 1103
31 Ga0070671_100800868 3300005355 Bacteria 820
32 Ga0070673_100074029 3300005364 Bacteria 2743
33 Ga0070673_101294387 3300005364 Bacteria 684
34 Ga0070659_100005677 3300005366 Bacteria 8974
35 Ga0070659_100023428 3300005366 Bacteria 4724
36 Ga0070659_100046666 3300005366 Bacteria 3395
37 Ga0070659_100248510 3300005366 Bacteria 1474
38 Ga0070659_102149496 3300005366 Unclassified 502
39 Ga0070667_100032870 3300005367 Bacteria 4329
40 Ga0070667_100036888 3300005367 Bacteria 4098
41 Ga0070667_100521019 3300005367 Unclassified 1091
42 Ga0070667_100713779 3300005367 Bacteria 928
43 Ga0070667_101585807 3300005367 Bacteria 615
44 Ga0070667_101751811 3300005367 Unclassified 584
45 Ga0070714_100399853 3300005435 Bacteria 1298
46 Ga0070701_10681571 3300005438 Bacteria 689
47 Ga0070700_100249129 3300005441 Bacteria 1273
48 Ga0070663_100083136 3300005455 Bacteria 2357
49 Ga0070663_100879813 3300005455 Bacteria 772
50 Ga0070663_100881534 3300005455 Bacteria 772
51 Ga0070678_100160261 3300005456 Bacteria 1822
52 Ga0070678_101490180 3300005456 Bacteria 633
53 Ga0070678_101737926 3300005456 Bacteria 587
54 Ga0070681_10234153 3300005458 Bacteria 1751
55 Ga0068867_101742573 3300005459 Bacteria 585
56 Ga0070685_10179304 3300005466 Unclassified 1362
57 Ga0070679_100001044 3300005530 Bacteria 24138
58 Ga0070679_100477003 3300005530 Unclassified 1192
59 Ga0070679_100585752 3300005530 Bacteria 1059
60 Ga0068853_100176381 3300005539 Bacteria 1936
61 Ga0068853_100183827 3300005539 Bacteria 1896
62 Ga0068853_100503028 3300005539 Bacteria 1144
63 Ga0068853_100771527 3300005539 Bacteria 919
64 Ga0068853_101279114 3300005539 Bacteria 709
65 Ga0068853_101312636 3300005539 Bacteria 699
66 Ga0070672_100094126 3300005543 Bacteria 2421
67 Ga0070672_100149720 3300005543 Bacteria 1930
68 Ga0070672_100307793 3300005543 Bacteria 1344
69 Ga0070672_100507325 3300005543 Bacteria 1044
70 Ga0070672_100557949 3300005543 Bacteria 995
71 Ga0070672_100601524 3300005543 Unclassified 958
72 Ga0070672_101953593 3300005543 Unclassified 528
73 Ga0070672_101953972 3300005543 Bacteria 528
74 Ga0070665_100001804 3300005548 Bacteria 24284
75 Ga0070665_100850761 3300005548 Bacteria 925
76 Ga0068855_100000329 3300005563 Bacteria 58994
77 Ga0068855_100039749 3300005563 Bacteria 5584
78 Ga0068855_100115174 3300005563 Bacteria 3082
79 Ga0068855_100118645 3300005563 Bacteria 3030
80 Ga0068855_100324965 3300005563 Bacteria 1699
81 Ga0068855_102217208 3300005563 Bacteria 551
82 Ga0068857_100099252 3300005577 Bacteria 2612
83 Ga0068857_100108702 3300005577 Bacteria 2491
84 Ga0068854_100227681 3300005578 Bacteria 1478
85 Ga0068854_101023914 3300005578 Bacteria 732
86 Ga0068854_101061694 3300005578 Bacteria 720
87 Ga0068852_100218430 3300005616 Bacteria 1812
88 Ga0068852_100371988 3300005616 Bacteria 1400
89 Ga0068852_102216262 3300005616 Bacteria 571
90 Ga0068859_100000013 3300005617 Bacteria 291126
91 Ga0068859_100125822 3300005617 Bacteria 2632
92 Ga0068864_100000725 3300005618 Bacteria 27569
93 Ga0068864_100217079 3300005618 Bacteria 1763
94 Ga0068864_101680253 3300005618 Bacteria 639
95 Ga0068861_101130536 3300005719 Unclassified 754
96 Ga0068861_101463097 3300005719 Bacteria 669
97 Ga0068861_102404788 3300005719 Unclassified 530
98 Ga0068851_10026422 3300005834 Bacteria 2852
99 Ga0068851_10075552 3300005834 Bacteria 1751
100 Ga0068851_10514027 3300005834 Bacteria 720
101 Ga0068863_100005541 3300005841 Bacteria 12414
102 Ga0068863_100029373 3300005841 Bacteria 5247
103 Ga0068863_100720366 3300005841 Unclassified 992
104 Ga0068858_100021930 3300005842 Bacteria 5964
105 Ga0068860_100000443 3300005843 Bacteria 52294
106 Ga0068860_100003642 3300005843 Bacteria 15852
107 Ga0068860_100078793 3300005843 Bacteria 3133
108 Ga0097621_100002810 3300006237 Bacteria 11927
109 Ga0097621_100170174 3300006237 Bacteria 1877
110 Ga0097621_100941890 3300006237 Bacteria 806
111 Ga0097621_102119387 3300006237 Bacteria 538
112 Ga0068871_100086241 3300006358 Bacteria 2608
113 Ga0068871_100373403 3300006358 Bacteria 1265
114 Ga0068871_101176499 3300006358 Bacteria 719
115 Ga0068865_100026463 3300006881 Bacteria 3825
116 Ga0068865_100956801 3300006881 Bacteria 748
117 Ga0097620_100000013 3300006931 Bacteria 291126
118 Ga0097620_100125823 3300006931 Bacteria 2632
119 Ga0105240_11155046 3300009093 Bacteria 822
120 Ga0111539_12242563 3300009094 Bacteria 633
121 Ga0105245_10152749 3300009098 Bacteria 2184
122 Ga0105245_10531630 3300009098 Bacteria 1196
123 Ga0105247_10033422 3300009101 Unclassified 3128
124 Ga0105241_10003984 3300009174 Bacteria 10917
125 Ga0105241_10029762 3300009174 Bacteria 4076
126 Ga0105241_10845255 3300009174 Bacteria 846
127 Ga0105242_11180241 3300009176 Bacteria 784
128 Ga0105237_10001928 3300009545 Bacteria 26472
129 Ga0105237_10014223 3300009545 Bacteria 8332
130 Ga0105237_10063410 3300009545 Bacteria 3693
131 Ga0105237_10222575 3300009545 Bacteria 1887
132 Ga0105237_10602275 3300009545 Unclassified 1106
133 Ga0105238_12820663 3300009551 Unclassified 522
134 Ga0105249_10000813 3300009553 Bacteria 28112
135 Ga0105239_10000518 3300010375 Bacteria 55657
136 Ga0105239_10028606 3300010375 Bacteria 6128
137 Ga0105239_10040634 3300010375 Bacteria 5096
138 Ga0105239_10192706 3300010375 Unclassified 2282
139 Ga0105246_10156544 3300011119 Unclassified 1731
140 Ga0157373_10006646 3300013100 Bacteria 8614
141 Ga0157373_10021753 3300013100 Bacteria 4654
142 Ga0157373_10109944 3300013100 Bacteria 1938
143 Ga0157371_10000651 3300013102 Bacteria 41136
144 Ga0157371_10000874 3300013102 Bacteria 34176
145 Ga0157371_10001360 3300013102 Bacteria 25648
146 Ga0157371_10001871 3300013102 Bacteria 21063
147 Ga0157371_10015432 3300013102 Bacteria 5729
148 Ga0157371_10059688 3300013102 Bacteria 2704
149 Ga0157371_10060038 3300013102 Bacteria 2696
150 Ga0157371_10159657 3300013102 Unclassified 1610
151 Ga0157370_10000408 3300013104 Bacteria 54355
152 Ga0157370_10019741 3300013104 Bacteria 6747
153 Ga0157370_10408224 3300013104 Bacteria 1250
154 Ga0157370_10435576 3300013104 Bacteria 1206
155 Ga0157370_10682637 3300013104 Bacteria 938
156 Ga0157370_11895210 3300013104 Bacteria 535
157 Ga0157369_10032836 3300013105 Bacteria 5704
158 Ga0157369_10509062 3300013105 Bacteria 1245
159 Ga0157369_12301801 3300013105 Bacteria 546
160 Ga0157374_10102207 3300013296 Bacteria 2749
161 Ga0157374_10831346 3300013296 Bacteria 940
162 Ga0157378_10010383 3300013297 Bacteria 8130
163 Ga0157378_10220505 3300013297 Bacteria 1803
164 Ga0157378_10279468 3300013297 Bacteria 1609
165 Ga0157378_10843633 3300013297 Bacteria 944
166 Ga0157378_10945789 3300013297 Bacteria 894
167 Ga0157378_11176444 3300013297 Bacteria 806
168 Ga0163162_10014317 3300013306 Bacteria 7749
169 Ga0163162_10120248 3300013306 Bacteria 2730
170 Ga0163162_10127721 3300013306 Unclassified 2650
171 Ga0157372_10028183 3300013307 Bacteria 6128
172 Ga0157372_10072360 3300013307 Bacteria 3885
173 Ga0157372_10102770 3300013307 Bacteria 3265
174 Ga0157372_10239290 3300013307 Bacteria 2106
175 Ga0157372_10675612 3300013307 Unclassified 1202
176 Ga0157372_10760616 3300013307 Unclassified 1126
177 Ga0157372_11651659 3300013307 Bacteria 737
178 Ga0157372_11755196 3300013307 Bacteria 714
179 Ga0157375_10061002 3300013308 Bacteria 3742
180 Ga0157375_10387722 3300013308 Bacteria 1564
181 Ga0157375_10965033 3300013308 Bacteria 993
182 Ga0157375_12256363 3300013308 Bacteria 649
183 Ga0163163_10147810 3300014325 Bacteria 2394
184 Ga0163163_11031172 3300014325 Bacteria 886
185 Ga0157380_10001024 3300014326 Bacteria 17823
186 Ga0157380_10061428 3300014326 Bacteria 3007
187 Ga0157380_10175109 3300014326 Bacteria 1879
188 Ga0157380_11773524 3300014326 Bacteria 676
189 Ga0157379_10804570 3300014968 Bacteria 887
190 Ga0157376_10256571 3300014969 Bacteria 1636
191 Ga0163161_10154264 3300017792 Bacteria 1747
192 Ga0163161_10653389 3300017792 Bacteria 871
193 Ga0163161_11280601 3300017792 Bacteria 637
194 Ga0213876_10098602 3300021384 Bacteria 1549
195 Ga0213876_10176995 3300021384 Bacteria 1135
196 Ga0209436_118276 3300025208 Bacteria 1000
197 Ga0207666_1032937 3300025271 Bacteria 798
198 Ga0207426_1000189 3300025302 Bacteria 153457
199 Ga0207656_10038587 3300025321 Unclassified 2016
200 Ga0207656_10086117 3300025321 Bacteria 1419
201 Ga0207682_10342533 3300025893 Bacteria 704
202 Ga0207682_10394246 3300025893 Bacteria 654
203 Ga0207710_10390493 3300025900 Bacteria 713
204 Ga0207680_10000083 3300025903 Bacteria 42904
205 Ga0207647_10009770 3300025904 Bacteria 6806
206 Ga0207647_10051478 3300025904 Unclassified 2545
207 Ga0207647_10092502 3300025904 Bacteria 1803
208 Ga0207705_10124925 3300025909 Bacteria 1911
209 Ga0207705_10355094 3300025909 Bacteria 1130
210 Ga0207654_10000674 3300025911 Bacteria 19192
211 Ga0207654_10083020 3300025911 Bacteria 1933
212 Ga0207707_10151302 3300025912 Bacteria 2029
213 Ga0207707_10223027 3300025912 Bacteria 1641
214 Ga0207707_10999166 3300025912 Bacteria 687
215 Ga0207695_10000064 3300025913 Bacteria 346010
216 Ga0207695_10018066 3300025913 Bacteria 8164
217 Ga0207695_11263521 3300025913 Bacteria 619
218 Ga0207671_10000030 3300025914 Bacteria 248197
219 Ga0207671_10002635 3300025914 Bacteria 18872
220 Ga0207671_10423632 3300025914 Bacteria 1059
221 Ga0207660_10018449 3300025917 Bacteria 4651
222 Ga0207660_10408333 3300025917 Bacteria 1094
223 Ga0207657_10002529 3300025919 Bacteria 19785
224 Ga0207657_10054475 3300025919 Bacteria 3459
225 Ga0207657_10224834 3300025919 Bacteria 1502
226 Ga0207657_10228404 3300025919 Bacteria 1489
227 Ga0207657_10543620 3300025919 Unclassified 908
228 Ga0207657_11111957 3300025919 Bacteria 603
229 Ga0207652_10000051 3300025921 Bacteria 120327
230 Ga0207652_10012329 3300025921 Bacteria 6907
231 Ga0207652_10615841 3300025921 Bacteria 973
232 Ga0207652_10980533 3300025921 Unclassified 744
233 Ga0207681_10732792 3300025923 Bacteria 823
234 Ga0207681_11440245 3300025923 Bacteria 578
235 Ga0207694_11601669 3300025924 Bacteria 549
236 Ga0207650_10015889 3300025925 Bacteria 5252
237 Ga0207650_10077070 3300025925 Bacteria 2520
238 Ga0207650_10168579 3300025925 Unclassified 1739
239 Ga0207687_10340202 3300025927 Bacteria 1220
240 Ga0207644_10024964 3300025931 Bacteria 4106
241 Ga0207644_10327839 3300025931 Bacteria 1239
242 Ga0207644_10413768 3300025931 Bacteria 1104
243 Ga0207644_10597445 3300025931 Bacteria 916
244 Ga0207690_10007904 3300025932 Bacteria 6320
245 Ga0207690_10009784 3300025932 Bacteria 5698
246 Ga0207690_10086326 3300025932 Bacteria 2205
247 Ga0207669_10409825 3300025937 Bacteria 1064
248 Ga0207669_10465058 3300025937 Bacteria 1005
249 Ga0207704_10072720 3300025938 Bacteria 2187
250 Ga0207691_10078579 3300025940 Bacteria 2970
251 Ga0207691_10362191 3300025940 Bacteria 1240
252 Ga0207691_10472360 3300025940 Bacteria 1066
253 Ga0207691_11005288 3300025940 Bacteria 696
254 Ga0207689_10001316 3300025942 Bacteria 23936
255 Ga0207667_10022073 3300025949 Bacteria 7042
256 Ga0207667_10142394 3300025949 Bacteria 2469
257 Ga0207667_10240239 3300025949 Bacteria 1854
258 Ga0207667_10446123 3300025949 Bacteria 1315
259 Ga0207667_11644340 3300025949 Bacteria 610
260 Ga0207667_11644676 3300025949 Bacteria 610
261 Ga0207651_10101591 3300025960 Bacteria 2135
262 Ga0207651_10351137 3300025960 Bacteria 1242
263 Ga0207651_11671242 3300025960 Bacteria 574
264 Ga0207712_10014343 3300025961 Bacteria 5097
265 Ga0207712_12004655 3300025961 Bacteria 518
266 Ga0207668_10077256 3300025972 Bacteria 2400
267 Ga0207640_10199316 3300025981 Bacteria 1516
268 Ga0207640_11703923 3300025981 Bacteria 569
269 Ga0207658_10127330 3300025986 Bacteria 2040
270 Ga0207658_10188732 3300025986 Bacteria 1711
271 Ga0207658_10743604 3300025986 Bacteria 888
272 Ga0207677_10039745 3300026023 Bacteria 3095
273 Ga0207677_10593297 3300026023 Unclassified 971
274 Ga0207703_10000790 3300026035 Bacteria 31144
275 Ga0207639_10024302 3300026041 Bacteria 4384
276 Ga0207639_10142414 3300026041 Bacteria 1999
277 Ga0207639_10162720 3300026041 Bacteria 1882
278 Ga0207639_11203906 3300026041 Bacteria 711
279 Ga0207639_11361666 3300026041 Bacteria 666
280 Ga0207678_10065877 3300026067 Bacteria 3110
281 Ga0207702_11860474 3300026078 Unclassified 593
282 Ga0207641_10000159 3300026088 Bacteria 96072
283 Ga0207641_10241183 3300026088 Bacteria 1684
284 Ga0207641_11484481 3300026088 Unclassified 679
285 Ga0207648_10541264 3300026089 Bacteria 1069
286 Ga0207648_10553517 3300026089 Unclassified 1057
287 Ga0207648_11285262 3300026089 Bacteria 687
288 Ga0207676_10006685 3300026095 Bacteria 8158
289 Ga0207676_10257268 3300026095 Bacteria 1574
290 Ga0207676_10615123 3300026095 Bacteria 1045
291 Ga0207674_10112961 3300026116 Bacteria 2690
292 Ga0207674_10427733 3300026116 Bacteria 1279
293 Ga0207675_102181636 3300026118 Unclassified 569
294 Ga0207683_11559379 3300026121 Bacteria 609
295 Ga0207683_11962012 3300026121 Unclassified 534
296 Ga0207698_10023802 3300026142 Bacteria 4286
297 Ga0207698_10302372 3300026142 Bacteria 1490
298 Ga0207698_10920045 3300026142 Bacteria 882
299 Ga0207698_11205795 3300026142 Unclassified 771
300 Ga0268266_10010369 3300028379 Bacteria 8146
301 Ga0268264_10000507 3300028381 Bacteria 50105
302 Ga0268264_10006176 3300028381 Bacteria 10119
303 Ga0268264_10127774 3300028381 Bacteria 2249
304 Ga0307515_10000001 3300028794 Bacteria 4259510
305 Ga0307515_10000021 3300028794 Bacteria 406008
306 Ga0265324_10042974 3300029957 Unclassified 1561
307 Ga0265327_10000048 3300031251 Bacteria 269173
308 Ga0265327_10000059 3300031251 Bacteria 236935
309 Ga0265327_10015820 3300031251 Bacteria 4839
310 Ga0265327_10143666 3300031251 Bacteria 1113
311 Ga0307509_10188076 3300031507 Bacteria 1920
312 Ga0265314_10211498 3300031711 Bacteria 1138
313 Ga0307413_11288233 3300031824 Bacteria 639
314 Ga0307414_10291375 3300032004 Bacteria 1376
315 Ga0395899_0075320 3300037312 Bacteria 2464
316 Ga0395899_0231954 3300037312 Bacteria 1274
317 Ga0395899_0326969 3300037312 Bacteria 1031
318 Ga0395899_0582964 3300037312 Bacteria 714
319 Ga0395900_0011050 3300037418 Bacteria 9226
320 Ga0395900_0063591 3300037418 Bacteria 3793
321 Ga0395900_0103546 3300037418 Bacteria 2923
322 Ga0395900_0114671 3300037418 Bacteria 2765
323 Ga0395900_0180787 3300037418 Bacteria 2143
324 Ga0395900_0665796 3300037418 Unclassified 977
325 Ga0395898_0001697 3300037466 Bacteria 29404
326 Ga0395898_0030774 3300037466 Bacteria 5369
327 Ga0395898_0417677 3300037466 Bacteria 1278
328 Ga0395898_0481232 3300037466 Bacteria 1181
329 Ga0395898_1339546 3300037466 Bacteria 644
330 Ga0395905_0062288 3300037471 Bacteria 3489
331 Ga0395905_0073488 3300037471 Bacteria 3205
332 Ga0395905_0194264 3300037471 Bacteria 1903
333 Ga0395905_0762223 3300037471 Bacteria 870
334 Ga0395901_0020105 3300038443 Bacteria 6832
335 Ga0395901_0121789 3300038443 Bacteria 2741
336 Ga0395901_0328534 3300038443 Bacteria 1581
337 Ga0395901_0544442 3300038443 Bacteria 1177
338 Ga0436365_0067036 3300039437 Bacteria 1254
339 Ga0436365_1026026 3300039437 Bacteria 2684
340 Ga0436365_1701335 3300039437 Bacteria 2694
341 Ga0439439_0068982 3300041406 Bacteria 945
342 Ga0451802_1126504 3300041460 Bacteria 545
343 Ga0451807_2250322 3300041486 Bacteria 569
344 Ga0451845_0966510 3300041501 Bacteria 633
345 Ga0451849_1404828 3300041505 Bacteria 561
346 Ga0451851_1008111 3300041507 Bacteria 828
347 Ga0439433_0003701 3300041999 Bacteria 3286
348 Ga0439442_121275 3300042002 Bacteria 572
349 Ga0439449_0005924 3300042007 Bacteria 4668
350 Ga0439434_0068683 3300042435 Bacteria 1114
351 Ga0451577_0085815 3300042876 Bacteria 2809
352 Ga0453683_0074079 3300044673 Bacteria 2131
353 Ga0453683_0873336 3300044673 Bacteria 594
354 Ga0466966_0975992 3300044684 Bacteria 511
355 Ga0453684_0009825 3300044712 Bacteria 16578
356 Ga0453684_0078449 3300044712 Bacteria 4132
357 Ga0466957_1316327 3300044842 Bacteria 525
358 Ga0451576_1247022 3300045051 Bacteria 776
359 Ga0495668_0000449 3300046616 Bacteria 52562
360 Ga0495661_0621341 3300046665 Bacteria 507
361 Ga0495670_0501437 3300046691 Bacteria 659
362 Ga0495636_0000008 3300047318 Bacteria 102958
363 Ga0495672_0099025 3300047320 Bacteria 1585
364 Ga0495686_0000335 3300047472 Bacteria 77634
365 Ga0495686_0196884 3300047472 Unclassified 1158
366 Ga0501034_0000002 3300049571 Bacteria 565510
367 Ga0501034_0013249 3300049571 Bacteria 8495
368 Ga0501034_0276604 3300049571 Bacteria 1619
369 Ga0501269_054492 3300049766 Bacteria 556
370 Ga0501035_0463182 3300049822 Bacteria 1047
371 Ga0501044_0048620 3300049823 Bacteria 4380
372 Ga0501044_0208271 3300049823 Bacteria 1911
373 nmdc:mga08y16_789268_c1 3300050511 Bacteria 943
374 Ga0500641_0255040 3300053096 Bacteria 734
375 Ga0500562_020854 3300053108 Bacteria 1702
376 Ga0500572_201050 3300053111 Bacteria 653
377 Ga0500592_005597 3300053116 Bacteria 2001
378 Ga0500628_189539 3300053129 Bacteria 590
379 Ga0500559_0020975 3300053136 Bacteria 2766
380 Ga0500616_0008706 3300053153 Bacteria 6264
381 Ga0500627_0006426 3300053158 Unclassified 4004
382 2881955814 2881955468 Bacteria 3545609
383 2914760378 2914759650 Bacteria 4701441
384 2929158591 2929154850 Bacteria 6753285
385 Ga0105240_10332049
386 rootH1_10128454
387 rootL2_10115267
388 rootL2_10257335
389 rootH1_10172628
390 Ga0065714_10319726
391 Ga0070658_10007960
392 Ga0070658_10233153
393 Ga0070658_10628397
394 Ga0070683_100273143
395 Ga0070670_100093583
396 Ga0070670_100465023
397 Ga0070670_100476173
398 Ga0070677_10510162
399 Ga0068869_100033352
400 Ga0070666_10000185
401 Ga0070680_100161259
402 Ga0070682_100054851
403 Ga0068868_100008330
404 Ga0068868_100046016
405 Ga0068868_100629863
406 Ga0068868_100965038
407 Ga0070660_100001278
408 Ga0070660_100208131
409 Ga0070660_100235517
410 Ga0070660_100406690
411 Ga0070689_100047723
412 Ga0070668_100181505
413 Ga0070671_100030861
414 Ga0070671_100451441
415 Ga0070671_100800868
416 Ga0070673_100074029
417 Ga0070673_101294387
418 Ga0070659_100005677
419 Ga0070659_100023428
420 Ga0070659_100046666
421 Ga0070659_100248510
422 Ga0070659_102149496
423 Ga0070667_100032870
424 Ga0070667_100036888
425 Ga0070667_100521019
426 Ga0070667_100713779
427 Ga0070667_101585807
428 Ga0070667_101751811
429 Ga0070714_100399853
430 Ga0070701_10681571
431 Ga0070700_100249129
432 Ga0070663_100083136
433 Ga0070663_100879813
434 Ga0070663_100881534
435 Ga0070678_100160261
436 Ga0070678_101490180
437 Ga0070678_101737926
438 Ga0070681_10234153
439 Ga0068867_101742573
440 Ga0070685_10179304
441 Ga0070679_100001044
442 Ga0070679_100477003
443 Ga0070679_100585752
444 Ga0068853_100176381
445 Ga0068853_100183827
446 Ga0068853_100503028
447 Ga0068853_100771527
448 Ga0068853_101279114
449 Ga0068853_101312636
450 Ga0070672_100094126
451 Ga0070672_100149720
452 Ga0070672_100307793
453 Ga0070672_100507325
454 Ga0070672_100557949
455 Ga0070672_100601524
456 Ga0070672_101953593
457 Ga0070672_101953972
458 Ga0070665_100001804
459 Ga0070665_100850761
460 Ga0068855_100000329
461 Ga0068855_100039749
462 Ga0068855_100115174
463 Ga0068855_100118645
464 Ga0068855_100324965
465 Ga0068855_102217208
466 Ga0068857_100099252
467 Ga0068857_100108702
468 Ga0068854_100227681
469 Ga0068854_101023914
470 Ga0068854_101061694
471 Ga0068852_100218430
472 Ga0068852_100371988
473 Ga0068852_102216262
474 Ga0068859_100000013
475 Ga0068859_100125822
476 Ga0068864_100000725
477 Ga0068864_100217079
478 Ga0068864_101680253
479 Ga0068861_101130536
480 Ga0068861_101463097
481 Ga0068861_102404788
482 Ga0068851_10026422
483 Ga0068851_10075552
484 Ga0068851_10514027
485 Ga0068863_100005541
486 Ga0068863_100029373
487 Ga0068863_100720366
488 Ga0068858_100021930
489 Ga0068860_100000443
490 Ga0068860_100003642
491 Ga0068860_100078793
492 Ga0097621_100002810
493 Ga0097621_100170174
494 Ga0097621_100941890
495 Ga0097621_102119387
496 Ga0068871_100086241
497 Ga0068871_100373403
498 Ga0068871_101176499
499 Ga0068865_100026463
500 Ga0068865_100956801
501 Ga0097620_100000013
502 Ga0097620_100125823
503 Ga0105240_11155046
504 Ga0111539_12242563
505 Ga0105245_10152749
506 Ga0105245_10531630
507 Ga0105247_10033422
508 Ga0105241_10003984
509 Ga0105241_10029762
510 Ga0105241_10845255
511 Ga0105242_11180241
512 Ga0105237_10001928
513 Ga0105237_10014223
514 Ga0105237_10063410
515 Ga0105237_10222575
516 Ga0105237_10602275
517 Ga0105238_12820663
518 Ga0105249_10000813
519 Ga0105239_10000518
520 Ga0105239_10028606
521 Ga0105239_10040634
522 Ga0105239_10192706
523 Ga0105246_10156544
524 Ga0157373_10006646
525 Ga0157373_10021753
526 Ga0157373_10109944
527 Ga0157371_10000651
528 Ga0157371_10000874
529 Ga0157371_10001360
530 Ga0157371_10001871
531 Ga0157371_10015432
532 Ga0157371_10059688
533 Ga0157371_10060038
534 Ga0157371_10159657
535 Ga0157370_10000408
536 Ga0157370_10019741
537 Ga0157370_10408224
538 Ga0157370_10435576
539 Ga0157370_10682637
540 Ga0157370_11895210
541 Ga0157369_10032836
542 Ga0157369_10509062
543 Ga0157369_12301801
544 Ga0157374_10102207
545 Ga0157374_10831346
546 Ga0157378_10010383
547 Ga0157378_10220505
548 Ga0157378_10279468
549 Ga0157378_10843633
550 Ga0157378_10945789
551 Ga0157378_11176444
552 Ga0163162_10014317
553 Ga0163162_10120248
554 Ga0163162_10127721
555 Ga0157372_10028183
556 Ga0157372_10072360
557 Ga0157372_10102770
558 Ga0157372_10239290
559 Ga0157372_10675612
560 Ga0157372_10760616
561 Ga0157372_11651659
562 Ga0157372_11755196
563 Ga0157375_10061002
564 Ga0157375_10387722
565 Ga0157375_10965033
566 Ga0157375_12256363
567 Ga0163163_10147810
568 Ga0163163_11031172
569 Ga0157380_10001024
570 Ga0157380_10061428
571 Ga0157380_10175109
572 Ga0157380_11773524
573 Ga0157379_10804570
574 Ga0157376_10256571
575 Ga0163161_10154264
576 Ga0163161_10653389
577 Ga0163161_11280601
578 Ga0213876_10098602
579 Ga0213876_10176995
580 Ga0209436_118276
581 Ga0207666_1032937
582 Ga0207426_1000189
583 Ga0207656_10038587
584 Ga0207656_10086117
585 Ga0207682_10342533
586 Ga0207682_10394246
587 Ga0207710_10390493
588 Ga0207680_10000083
589 Ga0207647_10009770
590 Ga0207647_10051478
591 Ga0207647_10092502
592 Ga0207705_10124925
593 Ga0207705_10355094
594 Ga0207654_10000674
595 Ga0207654_10083020
596 Ga0207707_10151302
597 Ga0207707_10223027
598 Ga0207707_10999166
599 Ga0207695_10000064
600 Ga0207695_10018066
601 Ga0207695_11263521
602 Ga0207671_10000030
603 Ga0207671_10002635
604 Ga0207671_10423632
605 Ga0207660_10018449
606 Ga0207660_10408333
607 Ga0207657_10002529
608 Ga0207657_10054475
609 Ga0207657_10224834
610 Ga0207657_10228404
611 Ga0207657_10543620
612 Ga0207657_11111957
613 Ga0207652_10000051
614 Ga0207652_10012329
615 Ga0207652_10615841
616 Ga0207652_10980533
617 Ga0207681_10732792
618 Ga0207681_11440245
619 Ga0207694_11601669
620 Ga0207650_10015889
621 Ga0207650_10077070
622 Ga0207650_10168579
623 Ga0207687_10340202
624 Ga0207644_10024964
625 Ga0207644_10327839
626 Ga0207644_10413768
627 Ga0207644_10597445
628 Ga0207690_10007904
629 Ga0207690_10009784
630 Ga0207690_10086326
631 Ga0207669_10409825
632 Ga0207669_10465058
633 Ga0207704_10072720
634 Ga0207691_10078579
635 Ga0207691_10362191
636 Ga0207691_10472360
637 Ga0207691_11005288
638 Ga0207689_10001316
639 Ga0207667_10022073
640 Ga0207667_10142394
641 Ga0207667_10240239
642 Ga0207667_10446123
643 Ga0207667_11644340
644 Ga0207667_11644676
645 Ga0207651_10101591
646 Ga0207651_10351137
647 Ga0207651_11671242
648 Ga0207712_10014343
649 Ga0207712_12004655
650 Ga0207668_10077256
651 Ga0207640_10199316
652 Ga0207640_11703923
653 Ga0207658_10127330
654 Ga0207658_10188732
655 Ga0207658_10743604
656 Ga0207677_10039745
657 Ga0207677_10593297
658 Ga0207703_10000790
659 Ga0207639_10024302
660 Ga0207639_10142414
661 Ga0207639_10162720
662 Ga0207639_11203906
663 Ga0207639_11361666
664 Ga0207678_10065877
665 Ga0207702_11860474
666 Ga0207641_10000159
667 Ga0207641_10241183
668 Ga0207641_11484481
669 Ga0207648_10541264
670 Ga0207648_10553517
671 Ga0207648_11285262
672 Ga0207676_10006685
673 Ga0207676_10257268
674 Ga0207676_10615123
675 Ga0207674_10112961
676 Ga0207674_10427733
677 Ga0207675_102181636
678 Ga0207683_11559379
679 Ga0207683_11962012
680 Ga0207698_10023802
681 Ga0207698_10302372
682 Ga0207698_10920045
683 Ga0207698_11205795
684 Ga0268266_10010369
685 Ga0268264_10000507
686 Ga0268264_10006176
687 Ga0268264_10127774
688 Ga0307515_10000001
689 Ga0307515_10000021
690 Ga0265324_10042974
691 Ga0265327_10000048
692 Ga0265327_10000059
693 Ga0265327_10015820
694 Ga0265327_10143666
695 Ga0307509_10188076
696 Ga0265314_10211498
697 Ga0307413_11288233
698 Ga0307414_10291375
699 Ga0395899_0075320
700 Ga0395899_0231954
701 Ga0395899_0326969
702 Ga0395899_0582964
703 Ga0395900_0011050
704 Ga0395900_0063591
705 Ga0395900_0103546
706 Ga0395900_0114671
707 Ga0395900_0180787
708 Ga0395900_0665796
709 Ga0395898_0001697
710 Ga0395898_0030774
711 Ga0395898_0417677
712 Ga0395898_0481232
713 Ga0395898_1339546
714 Ga0395905_0062288
715 Ga0395905_0073488
716 Ga0395905_0194264
717 Ga0395905_0762223
718 Ga0395901_0020105
719 Ga0395901_0121789
720 Ga0395901_0328534
721 Ga0395901_0544442
722 Ga0436365_0067036
723 Ga0436365_1026026
724 Ga0436365_1701335
725 Ga0439439_0068982
726 Ga0451802_1126504
727 Ga0451807_2250322
728 Ga0451845_0966510
729 Ga0451849_1404828
730 Ga0451851_1008111
731 Ga0439433_0003701
732 Ga0439442_121275
733 Ga0439449_0005924
734 Ga0439434_0068683
735 Ga0451577_0085815
736 Ga0453683_0074079
737 Ga0453683_0873336
738 Ga0466966_0975992
739 Ga0453684_0009825
740 Ga0453684_0078449
741 Ga0466957_1316327
742 Ga0451576_1247022
743 Ga0495668_0000449
744 Ga0495661_0621341
745 Ga0495670_0501437
746 Ga0495636_0000008
747 Ga0495672_0099025
748 Ga0495686_0000335
749 Ga0495686_0196884
750 Ga0501034_0000002
751 Ga0501034_0013249
752 Ga0501034_0276604
753 Ga0501269_054492
754 Ga0501035_0463182
755 Ga0501044_0048620
756 Ga0501044_0208271
757 nmdc:mga08y16_789268_c1
758 Ga0500641_0255040
759 Ga0500562_020854
760 Ga0500572_201050
761 Ga0500592_005597
762 Ga0500628_189539
763 Ga0500559_0020975
764 Ga0500616_0008706
765 Ga0500627_0006426
766 2881955814
767 2914760378
768 2929158591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

39

118

0.88

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

20

111

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ie9-assembly1.cif.gz_D crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase 0.9242 1 92
2gta-assembly1.cif.gz_C crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428. 0.919 1 94
5ie9-assembly1.cif.gz_B crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase 0.9186 1 92
5ie9-assembly1.cif.gz_C crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase 0.9181 1 92
2gta-assembly1.cif.gz_B crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428. 0.8921 1 96
ID Description Score Start End Superfamily
5ie9D00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9242 1 92 1.10.287.1080
5ie9B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9186 1 92 1.10.287.1080
5ie9C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9181 1 92 1.10.287.1080
2gtaB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8627 1 88 1.10.287.1080
2gtaA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8512 1 91 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A4Q5S7D8-F1-model_v4 Pyrophosphatase 0.9801 1 104
AF-A0A4U1CZT7-F1-model_v4 Pyrophosphatase 0.9717 1 107
AF-A0A7K3XJI7-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9717 1 97 GO:0016787
AF-A0A7D5RRJ8-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9675 1 99 GO:0016787
AF-A0A142Y7J8-F1-model_v4 MazG nucleotide pyrophosphohydrolase domain protein 0.9669 1 107 GO:0016787

Map