F429893

General Info

Members Datasets Scaffolds Average Seq Length
384 177 768 303

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10004344|Ga0157371_100043449
Length 349
Sequence LFYYLSIQNEKPFIRISSLNLLQQIVLHFQKNHHNFSSQKSIDMELTRRKFLVNSSMALAGTMLLPDFIFAHKKASDHILGIQLYSVRDDMKKDPLGTLKQLSAMGYKNVEHANYIDRKFYGYSAKDFKKVLDDLGLNMPSGHTVMSGADWDSSKNDFTDKWKQTVEDAATVGEMYVISPWLDESLRQNYDELVKFLDVFNKSGELCKKSGLKFGYHNHDFEFKYSLNGKQIYDIILEKTDPDLVLQQIDIGNMYGAGGRALEIVKKHPGRFQSMHVKDEIKATKTGEMGDGYESTVLGKGILPVKEIVDVFQQKGGTTEFIIEQESYQGKSPLDCSKDDLQVMRKWGF

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
174 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
175 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
176 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
177 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 0.26
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 13.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10004344 3300013102 Bacteria 12418
2 JGI24740J21852_10000312 3300001979 Bacteria 20702
3 JGI24739J22299_10010107 3300001989 Bacteria 3507
4 JGI24739J22299_10041138 3300001989 Unclassified 1540
5 JGI25154J39366_1000016 3300002738 Bacteria 255057
6 JGI25157J39369_1002846 3300002741 Bacteria 3907
7 JGI25406J46586_10011756 3300003203 Bacteria 3823
8 rootH1_10125285 3300003316 Bacteria 3581
9 rootH2_10018538 3300003320 Bacteria 11760
10 rootL2_10018192 3300003322 Bacteria 10483
11 rootH1_10032098 3300003323 Bacteria 8504
12 JGI25160J50197_1001334 3300003354 Bacteria 12455
13 JGI25160J50197_1003921 3300003354 Bacteria 6511
14 JGI25160J50197_1004084 3300003354 Bacteria 6356
15 JGI25160J50197_1005112 3300003354 Bacteria 5523
16 Ga0065165_1021969 3300005262 Bacteria 2201
17 Ga0065714_10005259 3300005288 Bacteria 4031
18 Ga0065704_10128320 3300005289 Bacteria 1664
19 Ga0070658_10047699 3300005327 Bacteria 3466
20 Ga0070658_10047756 3300005327 Bacteria 3464
21 Ga0070658_10282697 3300005327 Bacteria 1412
22 Ga0070670_100054188 3300005331 Bacteria 3443
23 Ga0068869_100083795 3300005334 Bacteria 2385
24 Ga0068869_100122376 3300005334 Bacteria 1991
25 Ga0068869_100259347 3300005334 Bacteria 1391
26 Ga0068869_100285369 3300005334 Bacteria 1329
27 Ga0070666_10000152 3300005335 Bacteria 47539
28 Ga0070666_10011721 3300005335 Bacteria 5512
29 Ga0070666_10242180 3300005335 Bacteria 1276
30 Ga0070680_100015020 3300005336 Bacteria 6062
31 Ga0068868_100023561 3300005338 Unclassified 4660
32 Ga0068868_100027930 3300005338 Bacteria 4308
33 Ga0070660_100001201 3300005339 Bacteria 17564
34 Ga0070660_100002765 3300005339 Bacteria 12054
35 Ga0070660_100020641 3300005339 Bacteria 4846
36 Ga0070660_100153650 3300005339 Unclassified 1852
37 Ga0070692_10018053 3300005345 Bacteria 3385
38 Ga0070668_100037517 3300005347 Bacteria 3700
39 Ga0070668_100126829 3300005347 Unclassified 2045
40 Ga0070675_100270634 3300005354 Bacteria 1491
41 Ga0070671_100049503 3300005355 Bacteria 3495
42 Ga0070671_100157516 3300005355 Unclassified 1919
43 Ga0070674_100090577 3300005356 Bacteria 2206
44 Ga0070673_100016646 3300005364 Bacteria 5206
45 Ga0070673_100273782 3300005364 Bacteria 1478
46 Ga0070659_100079156 3300005366 Unclassified 2623
47 Ga0070667_100007255 3300005367 Bacteria 9210
48 Ga0070667_100012206 3300005367 Bacteria 7108
49 Ga0070667_100047439 3300005367 Bacteria 3614
50 Ga0070667_100051154 3300005367 Bacteria 3483
51 Ga0070667_100220423 3300005367 Bacteria 1688
52 Ga0070667_100290958 3300005367 Unclassified 1469
53 Ga0070663_100009188 3300005455 Bacteria 6112
54 Ga0070678_100025666 3300005456 Bacteria 3970
55 Ga0070678_100173863 3300005456 Bacteria 1757
56 Ga0070681_10008321 3300005458 Bacteria 10161
57 Ga0068867_100223440 3300005459 Bacteria 1519
58 Ga0070679_100023038 3300005530 Bacteria 6092
59 Ga0070679_100023837 3300005530 Bacteria 5996
60 Ga0070679_100266919 3300005530 Bacteria 1666
61 Ga0070684_100014079 3300005535 Bacteria 6469
62 Ga0068853_100047925 3300005539 Unclassified 3668
63 Ga0068853_100051932 3300005539 Bacteria 3530
64 Ga0070672_100057218 3300005543 Bacteria 3060
65 Ga0070672_100249178 3300005543 Unclassified 1496
66 Ga0070665_100000009 3300005548 Bacteria 562640
67 Ga0068855_100001370 3300005563 Bacteria 30171
68 Ga0068855_100006679 3300005563 Bacteria 14007
69 Ga0068855_100708612 3300005563 Bacteria 1076
70 Ga0070664_100257679 3300005564 Bacteria 1569
71 Ga0068857_100269273 3300005577 Bacteria 1565
72 Ga0068854_100088298 3300005578 Bacteria 2302
73 Ga0068854_100267469 3300005578 Bacteria 1371
74 Ga0068856_100005474 3300005614 Bacteria 12510
75 Ga0068852_100011190 3300005616 Bacteria 6741
76 Ga0068852_100012762 3300005616 Bacteria 6398
77 Ga0068852_100029207 3300005616 Unclassified 4526
78 Ga0068852_100118070 3300005616 Bacteria 2423
79 Ga0068852_100163884 3300005616 Bacteria 2078
80 Ga0068852_100170299 3300005616 Bacteria 2041
81 Ga0068852_100407560 3300005616 Unclassified 1338
82 Ga0068859_100000026 3300005617 Bacteria 188742
83 Ga0068859_100037401 3300005617 Unclassified 4871
84 Ga0068859_100055156 3300005617 Bacteria 3999
85 Ga0068859_100065816 3300005617 Bacteria 3658
86 Ga0068864_100003051 3300005618 Bacteria 13829
87 Ga0068864_100059456 3300005618 Bacteria 3307
88 Ga0068866_10032993 3300005718 Bacteria 2507
89 Ga0068861_100067355 3300005719 Bacteria 2763
90 Ga0068861_100404944 3300005719 Bacteria 1212
91 Ga0068851_10025961 3300005834 Bacteria 2876
92 Ga0068870_10254507 3300005840 Unclassified 1090
93 Ga0068863_100009621 3300005841 Bacteria 9428
94 Ga0068863_100015580 3300005841 Bacteria 7305
95 Ga0068863_100052396 3300005841 Bacteria 3868
96 Ga0068858_100004620 3300005842 Bacteria 13478
97 Ga0068860_100003506 3300005843 Bacteria 16150
98 Ga0068860_100003692 3300005843 Bacteria 15765
99 Ga0068860_100005422 3300005843 Bacteria 12937
100 Ga0068860_100010007 3300005843 Bacteria 9401
101 Ga0068860_100024010 3300005843 Bacteria 5894
102 Ga0068860_100110388 3300005843 Bacteria 2629
103 Ga0068860_100493940 3300005843 Bacteria 1221
104 Ga0068862_100038073 3300005844 Unclassified 4078
105 Ga0081539_10000935 3300005985 Bacteria 54736
106 Ga0097621_100000018 3300006237 Bacteria 88867
107 Ga0097621_100013966 3300006237 Bacteria 5999
108 Ga0097621_100020490 3300006237 Bacteria 5094
109 Ga0068871_100000275 3300006358 Bacteria 35449
110 Ga0068871_100006329 3300006358 Bacteria 8365
111 Ga0068871_100153505 3300006358 Unclassified 1965
112 Ga0068871_100421517 3300006358 Unclassified 1192
113 Ga0075431_100000866 3300006847 Bacteria 26579
114 Ga0075429_100009709 3300006880 Bacteria 8341
115 Ga0068865_100019239 3300006881 Bacteria 4418
116 Ga0068865_100244173 3300006881 Bacteria 1414
117 Ga0097620_100000026 3300006931 Bacteria 188742
118 Ga0097620_100037401 3300006931 Unclassified 4871
119 Ga0097620_100055155 3300006931 Bacteria 3999
120 Ga0097620_100065813 3300006931 Bacteria 3658
121 Ga0105240_10002649 3300009093 Bacteria 28486
122 Ga0105240_10010818 3300009093 Bacteria 12778
123 Ga0105240_10017519 3300009093 Bacteria 9651
124 Ga0105240_10192865 3300009093 Bacteria 2394
125 Ga0105240_10398377 3300009093 Bacteria 1551
126 Ga0111539_10049532 3300009094 Bacteria 5008
127 Ga0111539_10262126 3300009094 Bacteria 2012
128 Ga0111539_10525628 3300009094 Unclassified 1378
129 Ga0105245_10086825 3300009098 Bacteria 2870
130 Ga0114129_10001572 3300009147 Bacteria 31003
131 Ga0105241_10002882 3300009174 Bacteria 12852
132 Ga0105241_10021586 3300009174 Bacteria 4761
133 Ga0105241_10152041 3300009174 Bacteria 1894
134 Ga0105242_10040708 3300009176 Unclassified 3745
135 Ga0105242_10146483 3300009176 Bacteria 2055
136 Ga0105242_10441637 3300009176 Bacteria 1224
137 Ga0105248_10125639 3300009177 Bacteria 2894
138 Ga0105237_10007466 3300009545 Bacteria 11960
139 Ga0105237_10013943 3300009545 Bacteria 8410
140 Ga0105237_10019609 3300009545 Bacteria 6984
141 Ga0105237_10042630 3300009545 Bacteria 4575
142 Ga0105238_10006264 3300009551 Bacteria 11822
143 Ga0105238_10170528 3300009551 Bacteria 2152
144 Ga0105249_10000882 3300009553 Bacteria 26651
145 Ga0105239_10007420 3300010375 Bacteria 12578
146 Ga0105239_10058740 3300010375 Bacteria 4221
147 Ga0105239_10311360 3300010375 Unclassified 1775
148 Ga0105239_10701298 3300010375 Unclassified 1157
149 Ga0105246_10084761 3300011119 Bacteria 2268
150 Ga0157373_10009386 3300013100 Bacteria 7225
151 Ga0157373_10062724 3300013100 Unclassified 2632
152 Ga0157373_10163444 3300013100 Bacteria 1566
153 Ga0157371_10001463 3300013102 Bacteria 24493
154 Ga0157371_10002753 3300013102 Bacteria 16525
155 Ga0157371_10003752 3300013102 Bacteria 13602
156 Ga0157371_10030737 3300013102 Bacteria 3872
157 Ga0157371_10049663 3300013102 Bacteria 2980
158 Ga0157371_10064314 3300013102 Bacteria 2599
159 Ga0157371_10151572 3300013102 Bacteria 1654
160 Ga0157371_10155066 3300013102 Bacteria 1634
161 Ga0157371_10292675 3300013102 Bacteria 1178
162 Ga0157370_10000716 3300013104 Bacteria 41551
163 Ga0157370_10002309 3300013104 Bacteria 23081
164 Ga0157370_10033932 3300013104 Unclassified 4972
165 Ga0157370_10051288 3300013104 Bacteria 3941
166 Ga0157370_10261607 3300013104 Bacteria 1599
167 Ga0157369_10007187 3300013105 Bacteria 12832
168 Ga0157369_10022689 3300013105 Bacteria 7000
169 Ga0157369_10031302 3300013105 Bacteria 5859
170 Ga0157369_10054343 3300013105 Bacteria 4325
171 Ga0157369_10218756 3300013105 Unclassified 1994
172 Ga0157374_10344929 3300013296 Bacteria 1479
173 Ga0157378_10012965 3300013297 Bacteria 7292
174 Ga0157378_10067440 3300013297 Bacteria 3206
175 Ga0157378_10185775 3300013297 Bacteria 1958
176 Ga0157378_10222906 3300013297 Bacteria 1793
177 Ga0157378_10478366 3300013297 Unclassified 1241
178 Ga0163162_10000728 3300013306 Bacteria 30520
179 Ga0163162_10003091 3300013306 Bacteria 15896
180 Ga0163162_10003695 3300013306 Bacteria 14672
181 Ga0163162_10026074 3300013306 Bacteria 5777
182 Ga0163162_10051073 3300013306 Bacteria 4147
183 Ga0163162_10095899 3300013306 Bacteria 3054
184 Ga0163162_10173620 3300013306 Bacteria 2280
185 Ga0163162_10351036 3300013306 Unclassified 1608
186 Ga0157372_10000573 3300013307 Bacteria 40317
187 Ga0157372_10007880 3300013307 Bacteria 11320
188 Ga0157372_10018412 3300013307 Bacteria 7507
189 Ga0157372_10023196 3300013307 Bacteria 6726
190 Ga0157372_10037120 3300013307 Bacteria 5371
191 Ga0157372_10054230 3300013307 Bacteria 4471
192 Ga0157372_10055114 3300013307 Unclassified 4438
193 Ga0157372_10102333 3300013307 Bacteria 3272
194 Ga0157372_10332838 3300013307 Bacteria 1768
195 Ga0157372_10388521 3300013307 Bacteria 1626
196 Ga0157375_10034613 3300013308 Bacteria 4813
197 Ga0157375_10139406 3300013308 Bacteria 2551
198 Ga0157375_10145028 3300013308 Bacteria 2504
199 Ga0157375_10210804 3300013308 Unclassified 2100
200 Ga0157375_10495804 3300013308 Bacteria 1386
201 Ga0163163_10395244 3300014325 Bacteria 1440
202 Ga0157380_10005484 3300014326 Bacteria 8863
203 Ga0157379_10019249 3300014968 Bacteria 6029
204 Ga0157376_10000076 3300014969 Bacteria 75313
205 Ga0157376_10156986 3300014969 Bacteria 2058
206 Ga0157376_10598266 3300014969 Bacteria 1097
207 Ga0163161_10004225 3300017792 Bacteria 10024
208 Ga0163161_10191938 3300017792 Bacteria 1571
209 Ga0209646_1000003 3300025246 Bacteria 1160860
210 Ga0209026_1000333 3300025250 Bacteria 45722
211 Ga0209129_1008402 3300025258 Bacteria 2877
212 Ga0207426_1000132 3300025302 Bacteria 209623
213 Ga0207426_1000277 3300025302 Bacteria 106036
214 Ga0207426_1000392 3300025302 Bacteria 74841
215 Ga0207656_10136885 3300025321 Bacteria 1152
216 Ga0207642_10114074 3300025899 Bacteria 1381
217 Ga0207688_10048560 3300025901 Bacteria 2371
218 Ga0207680_10002441 3300025903 Bacteria 8663
219 Ga0207680_10271765 3300025903 Unclassified 1176
220 Ga0207680_10356462 3300025903 Bacteria 1028
221 Ga0207647_10013261 3300025904 Bacteria 5720
222 Ga0207647_10143241 3300025904 Bacteria 1400
223 Ga0207645_10000693 3300025907 Bacteria 27991
224 Ga0207643_10013579 3300025908 Bacteria 4413
225 Ga0207705_10002684 3300025909 Bacteria 13616
226 Ga0207705_10056512 3300025909 Bacteria 2830
227 Ga0207654_10002690 3300025911 Bacteria 9027
228 Ga0207654_10013730 3300025911 Bacteria 4172
229 Ga0207654_10028496 3300025911 Bacteria 3044
230 Ga0207654_10264477 3300025911 Bacteria 1158
231 Ga0207707_10003340 3300025912 Bacteria 14244
232 Ga0207707_10038286 3300025912 Bacteria 4191
233 Ga0207707_10047856 3300025912 Bacteria 3724
234 Ga0207707_10326783 3300025912 Bacteria 1323
235 Ga0207695_10000128 3300025913 Bacteria 226098
236 Ga0207695_10001712 3300025913 Bacteria 35115
237 Ga0207695_10003683 3300025913 Bacteria 21346
238 Ga0207695_10348026 3300025913 Bacteria 1369
239 Ga0207695_10354230 3300025913 Bacteria 1354
240 Ga0207695_10369964 3300025913 Bacteria 1319
241 Ga0207671_10001027 3300025914 Bacteria 33973
242 Ga0207671_10005214 3300025914 Bacteria 12082
243 Ga0207671_10018101 3300025914 Bacteria 5413
244 Ga0207660_10004403 3300025917 Bacteria 9182
245 Ga0207660_10165806 3300025917 Bacteria 1707
246 Ga0207657_10006445 3300025919 Bacteria 12161
247 Ga0207657_10007951 3300025919 Bacteria 10815
248 Ga0207657_10070608 3300025919 Bacteria 2960
249 Ga0207657_10185754 3300025919 Bacteria 1679
250 Ga0207652_10000546 3300025921 Bacteria 38083
251 Ga0207652_10001149 3300025921 Bacteria 23813
252 Ga0207652_10012635 3300025921 Bacteria 6826
253 Ga0207652_10036266 3300025921 Bacteria 4169
254 Ga0207652_10049897 3300025921 Bacteria 3584
255 Ga0207681_10010297 3300025923 Bacteria 5719
256 Ga0207694_10013834 3300025924 Bacteria 6083
257 Ga0207694_10014121 3300025924 Bacteria 6021
258 Ga0207694_10083020 3300025924 Bacteria 2519
259 Ga0207650_10101911 3300025925 Bacteria 2211
260 Ga0207650_10221490 3300025925 Bacteria 1523
261 Ga0207659_10028420 3300025926 Bacteria 3801
262 Ga0207644_10012160 3300025931 Bacteria 5712
263 Ga0207644_10103486 3300025931 Unclassified 2143
264 Ga0207704_10192987 3300025938 Bacteria 1483
265 Ga0207704_10437549 3300025938 Bacteria 1041
266 Ga0207711_10095542 3300025941 Bacteria 2622
267 Ga0207689_10011065 3300025942 Bacteria 7754
268 Ga0207689_10031331 3300025942 Bacteria 4428
269 Ga0207689_10088520 3300025942 Bacteria 2543
270 Ga0207689_10374858 3300025942 Bacteria 1184
271 Ga0207661_10016451 3300025944 Bacteria 5457
272 Ga0207661_10362468 3300025944 Unclassified 1309
273 Ga0207679_10199141 3300025945 Bacteria 1672
274 Ga0207667_10000610 3300025949 Bacteria 46234
275 Ga0207667_10001143 3300025949 Bacteria 33339
276 Ga0207667_10001317 3300025949 Bacteria 31149
277 Ga0207667_10020059 3300025949 Bacteria 7443
278 Ga0207651_10211673 3300025960 Unclassified 1561
279 Ga0207712_10006001 3300025961 Bacteria 7665
280 Ga0207668_10389747 3300025972 Bacteria 1175
281 Ga0207668_10414880 3300025972 Bacteria 1141
282 Ga0207640_10119236 3300025981 Bacteria 1887
283 Ga0207640_10123583 3300025981 Bacteria 1859
284 Ga0207658_10040251 3300025986 Bacteria 3377
285 Ga0207658_10064057 3300025986 Bacteria 2756
286 Ga0207677_10007100 3300026023 Bacteria 6166
287 Ga0207677_10287461 3300026023 Bacteria 1353
288 Ga0207677_10343340 3300026023 Bacteria 1248
289 Ga0207703_10016603 3300026035 Bacteria 5742
290 Ga0207678_10012570 3300026067 Bacteria 7439
291 Ga0207702_10007728 3300026078 Bacteria 9130
292 Ga0207702_10317284 3300026078 Bacteria 1483
293 Ga0207641_10000215 3300026088 Bacteria 74812
294 Ga0207641_10051999 3300026088 Bacteria 3469
295 Ga0207641_10142545 3300026088 Bacteria 2164
296 Ga0207641_10207516 3300026088 Unclassified 1810
297 Ga0207648_10001098 3300026089 Bacteria 30333
298 Ga0207648_10101786 3300026089 Bacteria 2517
299 Ga0207676_10004945 3300026095 Bacteria 9447
300 Ga0207676_10185310 3300026095 Bacteria 1826
301 Ga0207674_10007729 3300026116 Bacteria 12515
302 Ga0207674_10046895 3300026116 Bacteria 4434
303 Ga0207675_100069989 3300026118 Bacteria 3279
304 Ga0207683_10000597 3300026121 Bacteria 33268
305 Ga0207683_10038549 3300026121 Bacteria 4166
306 Ga0207683_10247935 3300026121 Unclassified 1625
307 Ga0207698_10006881 3300026142 Bacteria 7115
308 Ga0207698_10009482 3300026142 Bacteria 6211
309 Ga0207698_10026849 3300026142 Unclassified 4079
310 Ga0207698_10107235 3300026142 Bacteria 2332
311 Ga0207698_10166775 3300026142 Bacteria 1934
312 Ga0207698_10330011 3300026142 Unclassified 1433
313 Ga0268266_10000014 3300028379 Bacteria 644033
314 Ga0268266_10101154 3300028379 Bacteria 2540
315 Ga0268265_10039508 3300028380 Unclassified 3479
316 Ga0268265_10043616 3300028380 Bacteria 3336
317 Ga0268264_10000013 3300028381 Bacteria 513859
318 Ga0268264_10000801 3300028381 Bacteria 33940
319 Ga0268264_10020399 3300028381 Bacteria 5417
320 Ga0268264_10070289 3300028381 Bacteria 2963
321 Ga0268264_10078086 3300028381 Bacteria 2822
322 Ga0268264_10188616 3300028381 Bacteria 1878
323 Ga0307517_10153904 3300028786 Bacteria 1568
324 Ga0307511_10001218 3300030521 Bacteria 27286
325 Ga0307513_10267190 3300031456 Unclassified 1496
326 Ga0307509_10025440 3300031507 Bacteria 6610
327 Ga0307508_10004344 3300031616 Bacteria 13864
328 Ga0265342_10136497 3300031712 Bacteria 1371
329 Ga0307414_10058611 3300032004 Bacteria 2714
330 Ga0373927_0004569 3300035695 Bacteria 9668
331 Ga0395899_0005291 3300037312 Bacteria 10018
332 Ga0395899_0005294 3300037312 Bacteria 10015
333 Ga0395899_0125660 3300037312 Unclassified 1834
334 Ga0395900_0046358 3300037418 Bacteria 4476
335 Ga0395900_0050107 3300037418 Bacteria 4301
336 Ga0395900_0194005 3300037418 Unclassified 2058
337 Ga0395900_0272595 3300037418 Unclassified 1686
338 Ga0395900_0306176 3300037418 Bacteria 1573
339 Ga0395898_0001279 3300037466 Bacteria 37056
340 Ga0395898_0009578 3300037466 Bacteria 10172
341 Ga0395898_0056750 3300037466 Bacteria 3816
342 Ga0395898_0294098 3300037466 Unclassified 1549
343 Ga0395901_0015212 3300038443 Bacteria 7828
344 Ga0395901_0049204 3300038443 Bacteria 4379
345 Ga0395901_0120556 3300038443 Bacteria 2756
346 Ga0395901_0726346 3300038443 Unclassified 988
347 Ga0436365_1577799 3300039437 Bacteria 1598
348 Ga0451577_0007737 3300042876 Bacteria 10534
349 Ga0466972_0000661 3300044658 Bacteria 16620
350 Ga0466972_0031297 3300044658 Bacteria 2618
351 Ga0453684_0000337 3300044712 Bacteria 195296
352 Ga0453684_0018518 3300044712 Bacteria 10683
353 Ga0453684_0025954 3300044712 Bacteria 8485
354 Ga0453684_0548752 3300044712 Bacteria 1273
355 Ga0466960_0006836 3300044901 Bacteria 4598
356 Ga0466959_0020306 3300045049 Bacteria 4893
357 Ga0451576_0004036 3300045051 Bacteria 19504
358 Ga0451576_0141040 3300045051 Bacteria 2513
359 Ga0495638_0033322 3300046460 Unclassified 3295
360 Ga0495644_0006633 3300046523 Bacteria 4486
361 Ga0495645_0239635 3300046543 Bacteria 1211
362 Ga0495661_0011980 3300046665 Bacteria 5868
363 Ga0495687_000106 3300047443 Bacteria 128130
364 Ga0495686_0000016 3300047472 Bacteria 443701
365 Ga0496100_0070252 3300048903 Bacteria 2335
366 Ga0501046_0144740 3300049580 Unclassified 1796
367 Ga0501047_0429615 3300049581 Bacteria 1152
368 Ga0501070_0048805 3300049586 Unclassified 3516
369 Ga0501035_0451840 3300049822 Bacteria 1063
370 Ga0501044_0358795 3300049823 Unclassified 1376
371 Ga0501044_0374107 3300049823 Bacteria 1341
372 nmdc:mga09592_38049_c1 3300050508 Unclassified 4037
373 nmdc:mga06r32_9671_c1 3300050510 Bacteria 8709
374 nmdc:mga08y16_310493_c1 3300050511 Unclassified 1624
375 nmdc:mga08y16_517069_c1 3300050511 Unclassified 1211
376 nmdc:mga08y16_644640_c1 3300050511 Unclassified 1064
377 Ga0500583_0003587 3300053092 Bacteria 4911
378 Ga0500568_0039153 3300053139 Bacteria 1916
379 Ga0500622_0003372 3300053156 Bacteria 10750
380 2819679127 2818991460 Bacteria 7595395
381 2852623202 2852623160 Bacteria 4376875
382 2884795152 2884791551 Bacteria 8511252
383 2929926377 2929921140 Bacteria 8649150
384 8003151741 8003151029 Bacteria 8187759
385 Ga0157371_10004344
386 JGI24740J21852_10000312
387 JGI24739J22299_10010107
388 JGI24739J22299_10041138
389 JGI25154J39366_1000016
390 JGI25157J39369_1002846
391 JGI25406J46586_10011756
392 rootH1_10125285
393 rootH2_10018538
394 rootL2_10018192
395 rootH1_10032098
396 JGI25160J50197_1001334
397 JGI25160J50197_1003921
398 JGI25160J50197_1004084
399 JGI25160J50197_1005112
400 Ga0065165_1021969
401 Ga0065714_10005259
402 Ga0065704_10128320
403 Ga0070658_10047699
404 Ga0070658_10047756
405 Ga0070658_10282697
406 Ga0070670_100054188
407 Ga0068869_100083795
408 Ga0068869_100122376
409 Ga0068869_100259347
410 Ga0068869_100285369
411 Ga0070666_10000152
412 Ga0070666_10011721
413 Ga0070666_10242180
414 Ga0070680_100015020
415 Ga0068868_100023561
416 Ga0068868_100027930
417 Ga0070660_100001201
418 Ga0070660_100002765
419 Ga0070660_100020641
420 Ga0070660_100153650
421 Ga0070692_10018053
422 Ga0070668_100037517
423 Ga0070668_100126829
424 Ga0070675_100270634
425 Ga0070671_100049503
426 Ga0070671_100157516
427 Ga0070674_100090577
428 Ga0070673_100016646
429 Ga0070673_100273782
430 Ga0070659_100079156
431 Ga0070667_100007255
432 Ga0070667_100012206
433 Ga0070667_100047439
434 Ga0070667_100051154
435 Ga0070667_100220423
436 Ga0070667_100290958
437 Ga0070663_100009188
438 Ga0070678_100025666
439 Ga0070678_100173863
440 Ga0070681_10008321
441 Ga0068867_100223440
442 Ga0070679_100023038
443 Ga0070679_100023837
444 Ga0070679_100266919
445 Ga0070684_100014079
446 Ga0068853_100047925
447 Ga0068853_100051932
448 Ga0070672_100057218
449 Ga0070672_100249178
450 Ga0070665_100000009
451 Ga0068855_100001370
452 Ga0068855_100006679
453 Ga0068855_100708612
454 Ga0070664_100257679
455 Ga0068857_100269273
456 Ga0068854_100088298
457 Ga0068854_100267469
458 Ga0068856_100005474
459 Ga0068852_100011190
460 Ga0068852_100012762
461 Ga0068852_100029207
462 Ga0068852_100118070
463 Ga0068852_100163884
464 Ga0068852_100170299
465 Ga0068852_100407560
466 Ga0068859_100000026
467 Ga0068859_100037401
468 Ga0068859_100055156
469 Ga0068859_100065816
470 Ga0068864_100003051
471 Ga0068864_100059456
472 Ga0068866_10032993
473 Ga0068861_100067355
474 Ga0068861_100404944
475 Ga0068851_10025961
476 Ga0068870_10254507
477 Ga0068863_100009621
478 Ga0068863_100015580
479 Ga0068863_100052396
480 Ga0068858_100004620
481 Ga0068860_100003506
482 Ga0068860_100003692
483 Ga0068860_100005422
484 Ga0068860_100010007
485 Ga0068860_100024010
486 Ga0068860_100110388
487 Ga0068860_100493940
488 Ga0068862_100038073
489 Ga0081539_10000935
490 Ga0097621_100000018
491 Ga0097621_100013966
492 Ga0097621_100020490
493 Ga0068871_100000275
494 Ga0068871_100006329
495 Ga0068871_100153505
496 Ga0068871_100421517
497 Ga0075431_100000866
498 Ga0075429_100009709
499 Ga0068865_100019239
500 Ga0068865_100244173
501 Ga0097620_100000026
502 Ga0097620_100037401
503 Ga0097620_100055155
504 Ga0097620_100065813
505 Ga0105240_10002649
506 Ga0105240_10010818
507 Ga0105240_10017519
508 Ga0105240_10192865
509 Ga0105240_10398377
510 Ga0111539_10049532
511 Ga0111539_10262126
512 Ga0111539_10525628
513 Ga0105245_10086825
514 Ga0114129_10001572
515 Ga0105241_10002882
516 Ga0105241_10021586
517 Ga0105241_10152041
518 Ga0105242_10040708
519 Ga0105242_10146483
520 Ga0105242_10441637
521 Ga0105248_10125639
522 Ga0105237_10007466
523 Ga0105237_10013943
524 Ga0105237_10019609
525 Ga0105237_10042630
526 Ga0105238_10006264
527 Ga0105238_10170528
528 Ga0105249_10000882
529 Ga0105239_10007420
530 Ga0105239_10058740
531 Ga0105239_10311360
532 Ga0105239_10701298
533 Ga0105246_10084761
534 Ga0157373_10009386
535 Ga0157373_10062724
536 Ga0157373_10163444
537 Ga0157371_10001463
538 Ga0157371_10002753
539 Ga0157371_10003752
540 Ga0157371_10030737
541 Ga0157371_10049663
542 Ga0157371_10064314
543 Ga0157371_10151572
544 Ga0157371_10155066
545 Ga0157371_10292675
546 Ga0157370_10000716
547 Ga0157370_10002309
548 Ga0157370_10033932
549 Ga0157370_10051288
550 Ga0157370_10261607
551 Ga0157369_10007187
552 Ga0157369_10022689
553 Ga0157369_10031302
554 Ga0157369_10054343
555 Ga0157369_10218756
556 Ga0157374_10344929
557 Ga0157378_10012965
558 Ga0157378_10067440
559 Ga0157378_10185775
560 Ga0157378_10222906
561 Ga0157378_10478366
562 Ga0163162_10000728
563 Ga0163162_10003091
564 Ga0163162_10003695
565 Ga0163162_10026074
566 Ga0163162_10051073
567 Ga0163162_10095899
568 Ga0163162_10173620
569 Ga0163162_10351036
570 Ga0157372_10000573
571 Ga0157372_10007880
572 Ga0157372_10018412
573 Ga0157372_10023196
574 Ga0157372_10037120
575 Ga0157372_10054230
576 Ga0157372_10055114
577 Ga0157372_10102333
578 Ga0157372_10332838
579 Ga0157372_10388521
580 Ga0157375_10034613
581 Ga0157375_10139406
582 Ga0157375_10145028
583 Ga0157375_10210804
584 Ga0157375_10495804
585 Ga0163163_10395244
586 Ga0157380_10005484
587 Ga0157379_10019249
588 Ga0157376_10000076
589 Ga0157376_10156986
590 Ga0157376_10598266
591 Ga0163161_10004225
592 Ga0163161_10191938
593 Ga0209646_1000003
594 Ga0209026_1000333
595 Ga0209129_1008402
596 Ga0207426_1000132
597 Ga0207426_1000277
598 Ga0207426_1000392
599 Ga0207656_10136885
600 Ga0207642_10114074
601 Ga0207688_10048560
602 Ga0207680_10002441
603 Ga0207680_10271765
604 Ga0207680_10356462
605 Ga0207647_10013261
606 Ga0207647_10143241
607 Ga0207645_10000693
608 Ga0207643_10013579
609 Ga0207705_10002684
610 Ga0207705_10056512
611 Ga0207654_10002690
612 Ga0207654_10013730
613 Ga0207654_10028496
614 Ga0207654_10264477
615 Ga0207707_10003340
616 Ga0207707_10038286
617 Ga0207707_10047856
618 Ga0207707_10326783
619 Ga0207695_10000128
620 Ga0207695_10001712
621 Ga0207695_10003683
622 Ga0207695_10348026
623 Ga0207695_10354230
624 Ga0207695_10369964
625 Ga0207671_10001027
626 Ga0207671_10005214
627 Ga0207671_10018101
628 Ga0207660_10004403
629 Ga0207660_10165806
630 Ga0207657_10006445
631 Ga0207657_10007951
632 Ga0207657_10070608
633 Ga0207657_10185754
634 Ga0207652_10000546
635 Ga0207652_10001149
636 Ga0207652_10012635
637 Ga0207652_10036266
638 Ga0207652_10049897
639 Ga0207681_10010297
640 Ga0207694_10013834
641 Ga0207694_10014121
642 Ga0207694_10083020
643 Ga0207650_10101911
644 Ga0207650_10221490
645 Ga0207659_10028420
646 Ga0207644_10012160
647 Ga0207644_10103486
648 Ga0207704_10192987
649 Ga0207704_10437549
650 Ga0207711_10095542
651 Ga0207689_10011065
652 Ga0207689_10031331
653 Ga0207689_10088520
654 Ga0207689_10374858
655 Ga0207661_10016451
656 Ga0207661_10362468
657 Ga0207679_10199141
658 Ga0207667_10000610
659 Ga0207667_10001143
660 Ga0207667_10001317
661 Ga0207667_10020059
662 Ga0207651_10211673
663 Ga0207712_10006001
664 Ga0207668_10389747
665 Ga0207668_10414880
666 Ga0207640_10119236
667 Ga0207640_10123583
668 Ga0207658_10040251
669 Ga0207658_10064057
670 Ga0207677_10007100
671 Ga0207677_10287461
672 Ga0207677_10343340
673 Ga0207703_10016603
674 Ga0207678_10012570
675 Ga0207702_10007728
676 Ga0207702_10317284
677 Ga0207641_10000215
678 Ga0207641_10051999
679 Ga0207641_10142545
680 Ga0207641_10207516
681 Ga0207648_10001098
682 Ga0207648_10101786
683 Ga0207676_10004945
684 Ga0207676_10185310
685 Ga0207674_10007729
686 Ga0207674_10046895
687 Ga0207675_100069989
688 Ga0207683_10000597
689 Ga0207683_10038549
690 Ga0207683_10247935
691 Ga0207698_10006881
692 Ga0207698_10009482
693 Ga0207698_10026849
694 Ga0207698_10107235
695 Ga0207698_10166775
696 Ga0207698_10330011
697 Ga0268266_10000014
698 Ga0268266_10101154
699 Ga0268265_10039508
700 Ga0268265_10043616
701 Ga0268264_10000013
702 Ga0268264_10000801
703 Ga0268264_10020399
704 Ga0268264_10070289
705 Ga0268264_10078086
706 Ga0268264_10188616
707 Ga0307517_10153904
708 Ga0307511_10001218
709 Ga0307513_10267190
710 Ga0307509_10025440
711 Ga0307508_10004344
712 Ga0265342_10136497
713 Ga0307414_10058611
714 Ga0373927_0004569
715 Ga0395899_0005291
716 Ga0395899_0005294
717 Ga0395899_0125660
718 Ga0395900_0046358
719 Ga0395900_0050107
720 Ga0395900_0194005
721 Ga0395900_0272595
722 Ga0395900_0306176
723 Ga0395898_0001279
724 Ga0395898_0009578
725 Ga0395898_0056750
726 Ga0395898_0294098
727 Ga0395901_0015212
728 Ga0395901_0049204
729 Ga0395901_0120556
730 Ga0395901_0726346
731 Ga0436365_1577799
732 Ga0451577_0007737
733 Ga0466972_0000661
734 Ga0466972_0031297
735 Ga0453684_0000337
736 Ga0453684_0018518
737 Ga0453684_0025954
738 Ga0453684_0548752
739 Ga0466960_0006836
740 Ga0466959_0020306
741 Ga0451576_0004036
742 Ga0451576_0141040
743 Ga0495638_0033322
744 Ga0495644_0006633
745 Ga0495645_0239635
746 Ga0495661_0011980
747 Ga0495687_000106
748 Ga0495686_0000016
749 Ga0496100_0070252
750 Ga0501046_0144740
751 Ga0501047_0429615
752 Ga0501070_0048805
753 Ga0501035_0451840
754 Ga0501044_0358795
755 Ga0501044_0374107
756 nmdc:mga09592_38049_c1
757 nmdc:mga06r32_9671_c1
758 nmdc:mga08y16_310493_c1
759 nmdc:mga08y16_517069_c1
760 nmdc:mga08y16_644640_c1
761 Ga0500583_0003587
762 Ga0500568_0039153
763 Ga0500622_0003372
764 2819679127
765 2852623202
766 2884795152
767 2929926377
768 8003151741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

99

347

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8352 34 282
3l23-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase/epimerase (yp_001303399.1) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8326 34 302
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8277 30 301
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8173 34 282
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8162 30 301
ID Description Score Start End Superfamily
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8017 30 301 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.797 34 302 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7775 34 302 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7769 36 303 3.20.20.150
3p6lA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7658 29 303 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A4V3GL00-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9873 33 305 GO:0016853
AF-A0A4Q5ZF10-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9641 116 305 GO:0016853
AF-A0A7T5EXH1-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9484 35 304 GO:0016853
AF-A0A1F3PAY2-F1-model_v4 Xylose isomerase 0.9468 8 305 GO:0016853
AF-A0A4V3GL00-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9457 33 305 GO:0016853

Map