F429907

General Info

Members Datasets Scaffolds Average Seq Length
384 187 384 461

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10015919|Ga0213876_100159193
Length 504
Sequence MTVPSPGRLGGATDASHGAPPPRGLLSAADGADVALVDGAETVTYAALDRRANAFAAWLRAQGVGPDDRVALCLDGGVPFAVALLGCFRALAVAVPIDAQLTSDERQAVLSDLQPRLVVDAADAAAVMRAHRAPPDGTVSASPSEHVQPPASRLSILPPTDDPGRTVLILYTSGSTGRPKGAVLAQRALQFALRSWAADVLGLGRHDTVLQVLPLAHSYGLCAGLLAPLLAGARIVQHQRFAADATLQALDQHGVTVFPGVATMFSRLLAHDPVRPPRLRLTVAGAAPCDDGLCAVWQARMGTRILRGYGMTELFRPISFRYDEPDDAPSSVGRPVPGVEVRLDANAELLIRTPAAMSGYLHAPEETRAVLHDGWFASGDLGAIDAQGRVTILGRTRERILRGGYSVFPAEVEAVLLDHPAVAEAAVVGAPHPELGEDVVAFVALRAALHPDALVDHCRRHLAAFKYPRRVVVLAALPRSAAGKILKSRLIAPQKEAAPDDAAH

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.78
Rhizosphere 98.18
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10000608 3300005290 Bacteria 11387
2 Ga0065712_10019218 3300005290 Bacteria 3068
3 Ga0065715_10009764 3300005293 Unclassified 4447
4 Ga0065715_10100103 3300005293 Bacteria 3332
5 Ga0070658_10086701 3300005327 Bacteria 2576
6 Ga0070676_10005899 3300005328 Bacteria 6539
7 Ga0070683_100099790 3300005329 Bacteria 2733
8 Ga0070690_100038623 3300005330 Unclassified 3013
9 Ga0070670_100001311 3300005331 Bacteria 19840
10 Ga0070670_100007327 3300005331 Bacteria 9363
11 Ga0068869_100002343 3300005334 Bacteria 11396
12 Ga0070666_10009749 3300005335 Bacteria 6001
13 Ga0070680_100000432 3300005336 Bacteria 28531
14 Ga0070682_100000399 3300005337 Bacteria 29036
15 Ga0070660_100000696 3300005339 Bacteria 22283
16 Ga0070660_100032670 3300005339 Unclassified 3918
17 Ga0070689_100016679 3300005340 Bacteria 5377
18 Ga0070691_10005993 3300005341 Bacteria 5547
19 Ga0070687_100015881 3300005343 Bacteria 3416
20 Ga0070661_100001223 3300005344 Bacteria 18062
21 Ga0070661_100017430 3300005344 Bacteria 5096
22 Ga0070692_10000070 3300005345 Bacteria 20702
23 Ga0070669_100015330 3300005353 Bacteria 5461
24 Ga0070669_100039812 3300005353 Bacteria 3416
25 Ga0070675_100094785 3300005354 Unclassified 2505
26 Ga0070671_100080232 3300005355 Bacteria 2728
27 Ga0070674_100047002 3300005356 Bacteria 2955
28 Ga0070659_100000962 3300005366 Bacteria 21186
29 Ga0070659_100024643 3300005366 Unclassified 4614
30 Ga0070667_100073858 3300005367 Unclassified 2908
31 Ga0070701_10006438 3300005438 Bacteria 4942
32 Ga0070705_100000192 3300005440 Bacteria 35880
33 Ga0070705_100010601 3300005440 Unclassified 4620
34 Ga0070700_100122262 3300005441 Bacteria 1746
35 Ga0070694_100016672 3300005444 Bacteria 4626
36 Ga0070694_100032220 3300005444 Bacteria 3442
37 Ga0070708_100012125 3300005445 Bacteria 7026
38 Ga0070708_100015531 3300005445 Bacteria 6292
39 Ga0070708_100037776 3300005445 Bacteria 4216
40 Ga0070708_100037864 3300005445 Bacteria 4210
41 Ga0070708_100163310 3300005445 Bacteria 2076
42 Ga0070708_100233415 3300005445 Bacteria 1726
43 Ga0070708_100247356 3300005445 Bacteria 1675
44 Ga0070663_100032653 3300005455 Unclassified 3590
45 Ga0070663_100091005 3300005455 Unclassified 2260
46 Ga0070662_100002919 3300005457 Bacteria 10625
47 Ga0070681_10001981 3300005458 Bacteria 18512
48 Ga0070681_10023079 3300005458 Bacteria 6256
49 Ga0068867_100056603 3300005459 Bacteria 2902
50 Ga0070706_100014191 3300005467 Bacteria 7360
51 Ga0070706_100154326 3300005467 Bacteria 2143
52 Ga0070706_100160271 3300005467 Bacteria 2100
53 Ga0070706_100172213 3300005467 Bacteria 2021
54 Ga0070706_100219122 3300005467 Bacteria 1776
55 Ga0070707_100044599 3300005468 Bacteria 4245
56 Ga0070707_100079632 3300005468 Bacteria 3162
57 Ga0070707_100083185 3300005468 Bacteria 3092
58 Ga0070707_100116239 3300005468 Bacteria 2596
59 Ga0070707_100120296 3300005468 Bacteria 2549
60 Ga0070707_100122191 3300005468 Bacteria 2528
61 Ga0070698_100008047 3300005471 Bacteria 11404
62 Ga0070698_100105911 3300005471 Bacteria 2781
63 Ga0070698_100112585 3300005471 Bacteria 2686
64 Ga0070699_100005745 3300005518 Bacteria 10858
65 Ga0070699_100011530 3300005518 Bacteria 7630
66 Ga0070699_100013445 3300005518 Bacteria 7049
67 Ga0070699_100016775 3300005518 Bacteria 6288
68 Ga0070699_100071862 3300005518 Bacteria 3009
69 Ga0070699_100076735 3300005518 Bacteria 2909
70 Ga0070679_100021785 3300005530 Bacteria 6259
71 Ga0070697_100000998 3300005536 Bacteria 21338
72 Ga0070697_100087899 3300005536 Bacteria 2566
73 Ga0070697_100134762 3300005536 Bacteria 2073
74 Ga0068853_100015800 3300005539 Bacteria 6199
75 Ga0070672_100063990 3300005543 Unclassified 2905
76 Ga0070695_100003185 3300005545 Bacteria 9571
77 Ga0070695_100109433 3300005545 Bacteria 1873
78 Ga0070696_100000118 3300005546 Bacteria 41199
79 Ga0070696_100022855 3300005546 Unclassified 4251
80 Ga0070693_100000191 3300005547 Bacteria 28471
81 Ga0070693_100020696 3300005547 Bacteria 3475
82 Ga0070665_100125807 3300005548 Bacteria 2565
83 Ga0070704_100003482 3300005549 Bacteria 9037
84 Ga0070704_100191634 3300005549 Bacteria 1644
85 Ga0068855_100001325 3300005563 Bacteria 30653
86 Ga0068855_100017956 3300005563 Bacteria 8501
87 Ga0070664_100002558 3300005564 Bacteria 14667
88 Ga0070664_100016842 3300005564 Bacteria 5999
89 Ga0068857_100101755 3300005577 Bacteria 2578
90 Ga0068854_100000883 3300005578 Bacteria 18020
91 Ga0068854_100075155 3300005578 Bacteria 2480
92 Ga0068856_100000353 3300005614 Bacteria 50137
93 Ga0068856_100010904 3300005614 Bacteria 8820
94 Ga0070702_100006242 3300005615 Bacteria 5626
95 Ga0068859_100001263 3300005617 Bacteria 25835
96 Ga0068859_100073734 3300005617 Bacteria 3451
97 Ga0068859_100248091 3300005617 Bacteria 1870
98 Ga0068864_100177873 3300005618 Bacteria 1943
99 Ga0068866_10041803 3300005718 Unclassified 2277
100 Ga0068870_10000272 3300005840 Bacteria 19195
101 Ga0068863_100012798 3300005841 Bacteria 8090
102 Ga0068863_100237494 3300005841 Bacteria 1759
103 Ga0068860_100092869 3300005843 Bacteria 2876
104 Ga0068860_100093617 3300005843 Bacteria 2864
105 Ga0068862_100032960 3300005844 Bacteria 4376
106 Ga0068862_100209576 3300005844 Bacteria 1761
107 Ga0081455_10001883 3300005937 Bacteria 25250
108 Ga0070712_100012945 3300006175 Bacteria 5316
109 Ga0068871_100093078 3300006358 Unclassified 2514
110 Ga0075428_100000028 3300006844 Bacteria 119875
111 Ga0075428_100039962 3300006844 Bacteria 5163
112 Ga0075428_100047298 3300006844 Bacteria 4726
113 Ga0075428_100066817 3300006844 Bacteria 3937
114 Ga0075428_100293410 3300006844 Bacteria 1749
115 Ga0075430_100000051 3300006846 Bacteria 61002
116 Ga0075430_100000249 3300006846 Bacteria 37298
117 Ga0075430_100034307 3300006846 Bacteria 4306
118 Ga0075430_100036397 3300006846 Bacteria 4174
119 Ga0075431_100002850 3300006847 Bacteria 16729
120 Ga0075431_100005232 3300006847 Bacteria 12772
121 Ga0075431_100160112 3300006847 Bacteria 2315
122 Ga0075431_100177242 3300006847 Bacteria 2189
123 Ga0075433_10000440 3300006852 Bacteria 26836
124 Ga0075433_10004468 3300006852 Bacteria 10895
125 Ga0075433_10023185 3300006852 Bacteria 5221
126 Ga0075433_10026082 3300006852 Bacteria 4943
127 Ga0075433_10059147 3300006852 Bacteria 3353
128 Ga0075433_10081024 3300006852 Unclassified 2861
129 Ga0075433_10148613 3300006852 Bacteria 2084
130 Ga0075434_100007769 3300006871 Bacteria 9927
131 Ga0075434_100009705 3300006871 Bacteria 8994
132 Ga0075434_100025265 3300006871 Bacteria 5812
133 Ga0075434_100040999 3300006871 Unclassified 4585
134 Ga0075434_100054506 3300006871 Bacteria 3972
135 Ga0075434_100066220 3300006871 Bacteria 3598
136 Ga0075434_100185220 3300006871 Unclassified 2102
137 Ga0075429_100004157 3300006880 Bacteria 12383
138 Ga0075429_100033816 3300006880 Bacteria 4441
139 Ga0097620_100001263 3300006931 Bacteria 25835
140 Ga0097620_100073733 3300006931 Bacteria 3451
141 Ga0097620_100248059 3300006931 Bacteria 1870
142 Ga0075435_100018869 3300007076 Bacteria 5255
143 Ga0075435_100019215 3300007076 Bacteria 5212
144 Ga0075435_100054244 3300007076 Bacteria 3235
145 Ga0105240_10197461 3300009093 Bacteria 2360
146 Ga0111539_10002514 3300009094 Bacteria 24300
147 Ga0111539_10023628 3300009094 Bacteria 7554
148 Ga0111539_10166256 3300009094 Unclassified 2579
149 Ga0114129_10030980 3300009147 Bacteria 7565
150 Ga0114129_10043714 3300009147 Bacteria 6303
151 Ga0114129_10062581 3300009147 Bacteria 5198
152 Ga0114129_10068524 3300009147 Bacteria 4947
153 Ga0114129_10080854 3300009147 Bacteria 4517
154 Ga0114129_10094880 3300009147 Bacteria 4131
155 Ga0114129_10261184 3300009147 Unclassified 2321
156 Ga0114129_10266911 3300009147 Bacteria 2291
157 Ga0114129_10274756 3300009147 Bacteria 2253
158 Ga0114129_10402004 3300009147 Bacteria 1805
159 Ga0105243_10006401 3300009148 Bacteria 9099
160 Ga0105241_10000954 3300009174 Bacteria 21864
161 Ga0105242_10054643 3300009176 Bacteria 3264
162 Ga0105248_10103509 3300009177 Bacteria 3209
163 Ga0105246_10006951 3300011119 Bacteria 6921
164 Ga0157373_10001458 3300013100 Bacteria 18085
165 Ga0157374_10009842 3300013296 Bacteria 8204
166 Ga0157378_10263147 3300013297 Bacteria 1656
167 Ga0163162_10025282 3300013306 Bacteria 5867
168 Ga0157372_10000063 3300013307 Bacteria 119595
169 Ga0157372_10026453 3300013307 Bacteria 6313
170 Ga0157375_10036561 3300013308 Bacteria 4699
171 Ga0157375_10136913 3300013308 Bacteria 2574
172 Ga0157376_10009087 3300014969 Bacteria 7202
173 Ga0182007_10017988 3300015262 Bacteria 2570
174 Ga0213876_10015646 3300021384 Bacteria 4015
175 Ga0213876_10015919 3300021384 Bacteria 3978
176 Ga0207645_10000433 3300025907 Bacteria 34676
177 Ga0207645_10002784 3300025907 Bacteria 13611
178 Ga0207643_10000177 3300025908 Bacteria 43454
179 Ga0207684_10000819 3300025910 Bacteria 35958
180 Ga0207684_10025017 3300025910 Bacteria 5088
181 Ga0207684_10083983 3300025910 Bacteria 2712
182 Ga0207684_10115480 3300025910 Bacteria 2299
183 Ga0207684_10116794 3300025910 Bacteria 2286
184 Ga0207654_10000910 3300025911 Bacteria 16345
185 Ga0207707_10002021 3300025912 Bacteria 18415
186 Ga0207693_10039484 3300025915 Bacteria 3717
187 Ga0207660_10001296 3300025917 Bacteria 16690
188 Ga0207660_10026206 3300025917 Bacteria 3968
189 Ga0207657_10000075 3300025919 Bacteria 93163
190 Ga0207657_10022338 3300025919 Bacteria 5922
191 Ga0207649_10002126 3300025920 Bacteria 11229
192 Ga0207652_10001314 3300025921 Bacteria 22077
193 Ga0207646_10000768 3300025922 Bacteria 41565
194 Ga0207646_10042903 3300025922 Bacteria 4064
195 Ga0207646_10087028 3300025922 Bacteria 2796
196 Ga0207646_10094388 3300025922 Bacteria 2679
197 Ga0207646_10099921 3300025922 Bacteria 2600
198 Ga0207681_10026804 3300025923 Unclassified 3720
199 Ga0207650_10011265 3300025925 Bacteria 6152
200 Ga0207650_10036460 3300025925 Bacteria 3578
201 Ga0207644_10097559 3300025931 Bacteria 2201
202 Ga0207690_10002905 3300025932 Bacteria 10326
203 Ga0207690_10064812 3300025932 Bacteria 2496
204 Ga0207706_10001713 3300025933 Bacteria 21605
205 Ga0207706_10016652 3300025933 Bacteria 6634
206 Ga0207709_10039754 3300025935 Bacteria 2812
207 Ga0207669_10104230 3300025937 Unclassified 1883
208 Ga0207691_10017497 3300025940 Bacteria 6796
209 Ga0207691_10039062 3300025940 Bacteria 4392
210 Ga0207689_10000711 3300025942 Bacteria 31848
211 Ga0207689_10014430 3300025942 Bacteria 6720
212 Ga0207661_10077505 3300025944 Bacteria 2734
213 Ga0207679_10001477 3300025945 Bacteria 14732
214 Ga0207679_10079568 3300025945 Unclassified 2500
215 Ga0207667_10002454 3300025949 Bacteria 23178
216 Ga0207712_10029251 3300025961 Bacteria 3694
217 Ga0207668_10041192 3300025972 Unclassified 3121
218 Ga0207640_10034520 3300025981 Bacteria 3157
219 Ga0207640_10151746 3300025981 Bacteria 1703
220 Ga0207677_10019253 3300026023 Bacteria 4119
221 Ga0207703_10025266 3300026035 Bacteria 4671
222 Ga0207639_10018698 3300026041 Bacteria 4927
223 Ga0207678_10007331 3300026067 Bacteria 9767
224 Ga0207678_10019945 3300026067 Bacteria 5892
225 Ga0207708_10073561 3300026075 Bacteria 2619
226 Ga0207702_10003089 3300026078 Bacteria 15437
227 Ga0207702_10057594 3300026078 Bacteria 3303
228 Ga0207641_10019783 3300026088 Bacteria 5527
229 Ga0207641_10095914 3300026088 Bacteria 2604
230 Ga0207648_10000508 3300026089 Bacteria 43455
231 Ga0207676_10035436 3300026095 Bacteria 3787
232 Ga0207674_10000630 3300026116 Bacteria 45952
233 Ga0207674_10053545 3300026116 Bacteria 4113
234 Ga0207683_10022623 3300026121 Bacteria 5398
235 Ga0209995_1002831 3300027471 Bacteria 2748
236 Ga0209971_1000041 3300027682 Bacteria 41543
237 Ga0209966_1000369 3300027695 Bacteria 13674
238 Ga0209998_10000028 3300027717 Bacteria 60458
239 Ga0209974_10004653 3300027876 Bacteria 4879
240 Ga0207428_10000119 3300027907 Bacteria 106261
241 Ga0207428_10002252 3300027907 Bacteria 19373
242 Ga0268265_10008097 3300028380 Bacteria 7104
243 Ga0268265_10151062 3300028380 Bacteria 1959
244 Ga0268264_10129112 3300028381 Bacteria 2238
245 Ga0268264_10155395 3300028381 Bacteria 2055
246 Ga0307407_10036030 3300031903 Bacteria 2723
247 Ga0307409_100052947 3300031995 Bacteria 3116
248 Ga0307409_100152800 3300031995 Bacteria 2007
249 Ga0373940_0010095 3300035088 Bacteria 2212
250 Ga0373951_0017741 3300035091 Bacteria 1612
251 Ga0373960_0008551 3300035121 Bacteria 2455
252 Ga0373960_0021023 3300035121 Bacteria 1731
253 Ga0373931_0010967 3300035691 Bacteria 4368
254 Ga0373931_0014830 3300035691 Unclassified 3816
255 Ga0373927_0133557 3300035695 Bacteria 1622
256 Ga0395898_0006589 3300037466 Bacteria 12387
257 Ga0395901_0001482 3300038443 Bacteria 24416
258 Ga0436365_1170607 3300039437 Bacteria 4480
259 Ga0436365_1627183 3300039437 Bacteria 4443
260 Ga0439458_0006268 3300042157 Bacteria 2652
261 Ga0439459_0000108 3300042438 Bacteria 7745
262 Ga0451577_0001635 3300042876 Bacteria 29060
263 Ga0451577_0018257 3300042876 Bacteria 6464
264 Ga0451577_0097556 3300042876 Bacteria 2625
265 Ga0453683_0011685 3300044673 Bacteria 5784
266 Ga0453683_0046485 3300044673 Bacteria 2722
267 Ga0453684_0022118 3300044712 Bacteria 9455
268 Ga0453684_0064036 3300044712 Bacteria 4699
269 Ga0451576_0006923 3300045051 Bacteria 13732
270 Ga0451576_0012955 3300045051 Bacteria 9344
271 Ga0451576_0021367 3300045051 Bacteria 7033
272 Ga0451576_0044416 3300045051 Bacteria 4684
273 Ga0451576_0167307 3300045051 Bacteria 2294
274 Ga0451576_0278371 3300045051 Bacteria 1749
275 Ga0495580_0003773 3300046472 Bacteria 12828
276 Ga0495580_0004749 3300046472 Bacteria 11371
277 Ga0495580_0073541 3300046472 Bacteria 2386
278 Ga0496102_0042467 3300048905 Bacteria 4120
279 Ga0496104_0193882 3300048907 Unclassified 1944
280 Ga0496113_0037502 3300048916 Unclassified 3558
281 Ga0501033_0093996 3300049570 Bacteria 2193
282 Ga0501036_0012915 3300049572 Bacteria 6934
283 Ga0501038_0001197 3300049574 Bacteria 23510
284 Ga0501039_0000716 3300049575 Bacteria 23871
285 Ga0501039_0051165 3300049575 Bacteria 3197
286 Ga0501040_0000225 3300049576 Bacteria 33117
287 Ga0501040_0003062 3300049576 Bacteria 10839
288 Ga0501040_0011771 3300049576 Bacteria 5723
289 Ga0501040_0066344 3300049576 Bacteria 2487
290 Ga0501041_0000157 3300049577 Bacteria 29988
291 Ga0501041_0003445 3300049577 Bacteria 9107
292 Ga0501041_0011108 3300049577 Bacteria 5318
293 Ga0501042_0000339 3300049578 Bacteria 23441
294 Ga0501042_0012934 3300049578 Bacteria 5669
295 Ga0501042_0069707 3300049578 Bacteria 2515
296 Ga0501043_0022291 3300049579 Bacteria 4969
297 Ga0501043_0117783 3300049579 Bacteria 2084
298 Ga0501046_0000394 3300049580 Bacteria 43581
299 Ga0501046_0007239 3300049580 Bacteria 9757
300 Ga0501048_0002956 3300049582 Bacteria 12983
301 Ga0501048_0062555 3300049582 Bacteria 2634
302 Ga0501067_0025169 3300049583 Bacteria 3299
303 Ga0501068_0099242 3300049584 Bacteria 1804
304 Ga0501071_0012950 3300049587 Bacteria 5673
305 Ga0501072_0015723 3300049588 Bacteria 5800
306 Ga0501072_0031872 3300049588 Bacteria 4126
307 Ga0501072_0086976 3300049588 Bacteria 2480
308 Ga0501074_0010996 3300049590 Bacteria 6570
309 Ga0501074_0011809 3300049590 Bacteria 6349
310 Ga0501075_0000240 3300049591 Bacteria 29341
311 Ga0501075_0007218 3300049591 Bacteria 7700
312 Ga0501075_0037242 3300049591 Unclassified 3633
313 Ga0501075_0076875 3300049591 Bacteria 2526
314 Ga0501075_0097013 3300049591 Bacteria 2237
315 Ga0501076_0000299 3300049592 Bacteria 30945
316 Ga0501076_0033976 3300049592 Bacteria 3983
317 Ga0501076_0107190 3300049592 Bacteria 2256
318 Ga0501077_0000919 3300049593 Bacteria 17716
319 Ga0501077_0034801 3300049593 Bacteria 3206
320 Ga0501077_0045224 3300049593 Bacteria 2797
321 Ga0501079_0009391 3300049741 Bacteria 7413
322 Ga0501079_0011732 3300049741 Bacteria 6693
323 Ga0501079_0042391 3300049741 Unclassified 3515
324 Ga0501080_0026495 3300049742 Bacteria 5387
325 Ga0501081_0001124 3300049743 Bacteria 16106
326 Ga0501083_0005668 3300049744 Bacteria 8844
327 Ga0501044_0282473 3300049823 Bacteria 1593
328 Ga0501045_0002153 3300049824 Bacteria 13335
329 Ga0501045_0034506 3300049824 Bacteria 3672
330 nmdc:mga05p37_10069_c1 3300050507 Bacteria 11222
331 nmdc:mga05p37_11406_c1 3300050507 Bacteria 10578
332 nmdc:mga05p37_128364_c1 3300050507 Bacteria 3113
333 nmdc:mga05p37_13731_c1 3300050507 Bacteria 9705
334 nmdc:mga05p37_24771_c1 3300050507 Bacteria 7294
335 nmdc:mga05p37_272473_c1 3300050507 Bacteria 2022
336 nmdc:mga05p37_34625_c1 3300050507 Bacteria 6187
337 nmdc:mga05p37_82354_c1 3300050507 Bacteria 3965
338 nmdc:mga05p37_95993_c2 3300050507 Bacteria 3123
339 nmdc:mga09592_16011_c1 3300050508 Bacteria 6128
340 nmdc:mga09592_32268_c1 3300050508 Bacteria 4367
341 nmdc:mga09592_6256_c1 3300050508 Bacteria 9696
342 nmdc:mga0qj67_1826_c1 3300050509 Bacteria 15080
343 nmdc:mga0qj67_20036_c1 3300050509 Bacteria 5118
344 nmdc:mga0qj67_22858_c1 3300050509 Bacteria 4804
345 nmdc:mga06r32_13298_c1 3300050510 Bacteria 7453
346 nmdc:mga06r32_18001_c1 3300050510 Bacteria 6460
347 nmdc:mga06r32_40905_c1 3300050510 Bacteria 4403
348 nmdc:mga06r32_436403_c1 3300050510 Bacteria 1290
349 nmdc:mga06r32_543_c1 3300050510 Bacteria 32734
350 nmdc:mga08y16_4252_c1 3300050511 Bacteria 14947
351 nmdc:mga08y16_6269_c1 3300050511 Bacteria 12468
352 nmdc:mga0n895_140675_c1 3300050512 Bacteria 2442
353 nmdc:mga0n895_16203_c1 3300050512 Bacteria 6834
354 nmdc:mga0n895_83509_c1 3300050512 Bacteria 3186
355 nmdc:mga0n895_99362_c1 3300050512 Bacteria 2918
356 nmdc:mga0rr50_18865_c1 3300050513 Bacteria 4643
357 nmdc:mga0rr50_38229_c1 3300050513 Bacteria 3471
358 nmdc:mga0rr50_43358_c1 3300050513 Bacteria 3292
359 nmdc:mga08x19_19184_c1 3300050514 Bacteria 4195
360 nmdc:mga08x19_66159_c1 3300050514 Bacteria 2348
361 nmdc:mga0a205_118143_c1 3300050515 Bacteria 2550
362 nmdc:mga0a205_140598_c1 3300050515 Bacteria 2314
363 nmdc:mga0a205_16908_c1 3300050515 Bacteria 6829
364 nmdc:mga0a205_2719_c1 3300050515 Bacteria 15628
365 nmdc:mga0a205_27766_c1 3300050515 Bacteria 5406
366 nmdc:mga0a205_37558_c1 3300050515 Bacteria 4658
367 nmdc:mga0a205_38839_c1 3300050515 Bacteria 4581
368 nmdc:mga0a205_41528_c1 3300050515 Bacteria 4429
369 nmdc:mga0a205_65519_c1 3300050515 Bacteria 3510
370 nmdc:mga0a205_81806_c1 3300050515 Bacteria 3120
371 nmdc:mga0a205_8636_c1 3300050515 Bacteria 9270
372 Ga0501084_0002186 3300054114 Bacteria 15690
373 Ga0501084_0012733 3300054114 Bacteria 6968
374 Ga0501084_0023855 3300054114 Bacteria 5102
375 Ga0501084_0082757 3300054114 Bacteria 2693
376 Ga0501084_0265934 3300054114 Unclassified 1448
377 Ga0501082_0001867 3300060353 Bacteria 18540
378 Ga0501082_0002759 3300060353 Bacteria 15351
379 Ga0501082_0074831 3300060353 Bacteria 2917
380 Ga0530510_0000152 3300061734 Bacteria 41201
381 Ga0530510_0000819 3300061734 Bacteria 20363
382 Ga0530510_0002288 3300061734 Bacteria 13135
383 Ga0530510_0095776 3300061734 Bacteria 2169
384 Ga0530510_0116599 3300061734 Bacteria 1958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0097013 Ga0501075_0097013_537_1667 373
2 3300050510 nmdc:mga06r32_436403_c1 nmdc:mga06r32_436403_c1_111_1262 375
3 3300005445 Ga0070708_100247356 Ga0070708_1002473561 401
4 3300060353 Ga0501082_0074831 Ga0501082_0074831_1668_2906 406
5 3300005563 Ga0068855_100017956 Ga0068855_1000179566 414
6 3300005564 Ga0070664_100016842 Ga0070664_1000168424 414
7 3300005614 Ga0068856_100010904 Ga0068856_1000109047 414
8 3300025917 Ga0207660_10026206 Ga0207660_100262063 414
9 3300025925 Ga0207650_10011265 Ga0207650_100112655 414
10 3300025940 Ga0207691_10017497 Ga0207691_100174972 414
11 3300025972 Ga0207668_10041192 Ga0207668_100411921 414
12 3300026121 Ga0207683_10022623 Ga0207683_100226235 414
13 3300050507 nmdc:mga05p37_272473_c1 nmdc:mga05p37_272473_c1_755_2005 415
14 3300031903 Ga0307407_10036030 Ga0307407_100360302 426
15 3300031995 Ga0307409_100052947 Ga0307409_1000529472 429
16 3300037466 Ga0395898_0006589 Ga0395898_0006589_6791_8110 430
17 3300038443 Ga0395901_0001482 Ga0395901_0001482_4406_5725 430
18 3300049576 Ga0501040_0066344 Ga0501040_0066344_877_2196 433
19 3300039437 Ga0436365_1170607 Ga0436365_1170607_786_2216 437
20 3300006846 Ga0075430_100036397 Ga0075430_1000363973 440
21 3300005444 Ga0070694_100032220 Ga0070694_1000322206 441
22 3300027471 Ga0209995_1002831 Ga0209995_10028312 441
23 3300027682 Ga0209971_1000041 Ga0209971_100004113 441
24 3300027695 Ga0209966_1000369 Ga0209966_100036917 441
25 3300027717 Ga0209998_10000028 Ga0209998_1000002833 441
26 3300042876 Ga0451577_0097556 Ga0451577_0097556_913_2280 441
27 3300045051 Ga0451576_0167307 Ga0451576_0167307_764_2131 441
28 3300046472 Ga0495580_0003773 Ga0495580_0003773_10045_11433 441
29 3300049575 Ga0501039_0051165 Ga0501039_0051165_423_1790 441
30 3300049577 Ga0501041_0003445 Ga0501041_0003445_1250_2617 441
31 3300049578 Ga0501042_0012934 Ga0501042_0012934_3395_4762 441
32 3300049580 Ga0501046_0000394 Ga0501046_0000394_11168_12535 441
33 3300049588 Ga0501072_0015723 Ga0501072_0015723_4168_5535 441
34 3300049590 Ga0501074_0010996 Ga0501074_0010996_4427_5794 441
35 3300049593 Ga0501077_0034801 Ga0501077_0034801_75_1442 441
36 3300054114 Ga0501084_0012733 Ga0501084_0012733_2727_4094 441
37 3300006847 Ga0075431_100002850 Ga0075431_1000028505 444
38 3300049579 Ga0501043_0117783 Ga0501043_0117783_200_1576 444
39 3300050509 nmdc:mga0qj67_22858_c1 nmdc:mga0qj67_22858_c1_1698_3122 444
40 3300050510 nmdc:mga06r32_543_c1 nmdc:mga06r32_543_c1_18280_19704 444
41 3300050512 nmdc:mga0n895_16203_c1 nmdc:mga0n895_16203_c1_529_1938 445
42 3300050514 nmdc:mga08x19_66159_c1 nmdc:mga08x19_66159_c1_48_1457 445
43 3300050515 nmdc:mga0a205_118143_c1 nmdc:mga0a205_118143_c1_421_1830 445
44 3300006844 Ga0075428_100039962 Ga0075428_1000399622 446
45 3300006846 Ga0075430_100000249 Ga0075430_10000024936 446
46 3300006847 Ga0075431_100005232 Ga0075431_1000052326 446
47 3300049584 Ga0501068_0099242 Ga0501068_0099242_55_1434 446
48 3300050507 nmdc:mga05p37_11406_c1 nmdc:mga05p37_11406_c1_6906_8303 446
49 3300050509 nmdc:mga0qj67_20036_c1 nmdc:mga0qj67_20036_c1_668_2065 446
50 3300050510 nmdc:mga06r32_13298_c1 nmdc:mga06r32_13298_c1_3538_4935 446
51 3300006847 Ga0075431_100160112 Ga0075431_1001601122 448
52 3300006852 Ga0075433_10000440 Ga0075433_1000044027 448
53 3300006871 Ga0075434_100009705 Ga0075434_1000097057 448
54 3300006880 Ga0075429_100004157 Ga0075429_1000041577 448
55 3300009147 Ga0114129_10030980 Ga0114129_100309802 448
56 3300050507 nmdc:mga05p37_128364_c1 nmdc:mga05p37_128364_c1_469_1881 448
57 3300050508 nmdc:mga09592_6256_c1 nmdc:mga09592_6256_c1_6671_8083 448
58 3300050515 nmdc:mga0a205_2719_c1 nmdc:mga0a205_2719_c1_2173_3585 448
59 3300050515 nmdc:mga0a205_27766_c1 nmdc:mga0a205_27766_c1_3841_5217 448
60 3300005356 Ga0070674_100047002 Ga0070674_1000470022 450
61 3300005843 Ga0068860_100092869 Ga0068860_1000928692 450
62 3300006844 Ga0075428_100047298 Ga0075428_1000472982 450
63 3300006846 Ga0075430_100034307 Ga0075430_1000343073 450
64 3300006852 Ga0075433_10004468 Ga0075433_1000446812 450
65 3300006852 Ga0075433_10081024 Ga0075433_100810242 450
66 3300006871 Ga0075434_100025265 Ga0075434_1000252652 450
67 3300006880 Ga0075429_100033816 Ga0075429_1000338166 450
68 3300007076 Ga0075435_100054244 Ga0075435_1000542445 450
69 3300009094 Ga0111539_10002514 Ga0111539_1000251425 450
70 3300009094 Ga0111539_10023628 Ga0111539_100236282 450
71 3300009147 Ga0114129_10274756 Ga0114129_102747562 450
72 3300009147 Ga0114129_10402004 Ga0114129_104020041 450
73 3300027907 Ga0207428_10002252 Ga0207428_100022526 450
74 3300035121 Ga0373960_0021023 Ga0373960_0021023_156_1532 450
75 3300035691 Ga0373931_0010967 Ga0373931_0010967_198_1574 450
76 3300045051 Ga0451576_0278371 Ga0451576_0278371_135_1511 450
77 3300050507 nmdc:mga05p37_10069_c1 nmdc:mga05p37_10069_c1_8153_9529 450
78 3300050507 nmdc:mga05p37_82354_c1 nmdc:mga05p37_82354_c1_842_2218 450
79 3300050508 nmdc:mga09592_16011_c1 nmdc:mga09592_16011_c1_1055_2431 450
80 3300050508 nmdc:mga09592_32268_c1 nmdc:mga09592_32268_c1_240_1616 450
81 3300050510 nmdc:mga06r32_40905_c1 nmdc:mga06r32_40905_c1_240_1616 450
82 3300050511 nmdc:mga08y16_4252_c1 nmdc:mga08y16_4252_c1_787_2163 450
83 3300050513 nmdc:mga0rr50_43358_c1 nmdc:mga0rr50_43358_c1_1490_2866 450
84 3300050514 nmdc:mga08x19_19184_c1 nmdc:mga08x19_19184_c1_1665_3041 450
85 3300050515 nmdc:mga0a205_81806_c1 nmdc:mga0a205_81806_c1_1318_2694 450
86 3300005445 Ga0070708_100163310 Ga0070708_1001633101 451
87 3300005445 Ga0070708_100233415 Ga0070708_1002334151 451
88 3300005467 Ga0070706_100154326 Ga0070706_1001543262 451
89 3300005467 Ga0070706_100160271 Ga0070706_1001602713 451
90 3300005467 Ga0070706_100219122 Ga0070706_1002191222 451
91 3300005468 Ga0070707_100044599 Ga0070707_1000445996 451
92 3300005468 Ga0070707_100079632 Ga0070707_1000796324 451
93 3300005468 Ga0070707_100116239 Ga0070707_1001162392 451
94 3300005471 Ga0070698_100105911 Ga0070698_1001059112 451
95 3300005471 Ga0070698_100112585 Ga0070698_1001125851 451
96 3300005518 Ga0070699_100005745 Ga0070699_1000057452 451
97 3300005518 Ga0070699_100011530 Ga0070699_1000115309 451
98 3300005536 Ga0070697_100087899 Ga0070697_1000878991 451
99 3300005536 Ga0070697_100134762 Ga0070697_1001347622 451
100 3300025910 Ga0207684_10025017 Ga0207684_100250172 451
101 3300025910 Ga0207684_10083983 Ga0207684_100839833 451
102 3300025910 Ga0207684_10115480 Ga0207684_101154801 451
103 3300025910 Ga0207684_10116794 Ga0207684_101167941 451
104 3300025922 Ga0207646_10042903 Ga0207646_100429036 451
105 3300025922 Ga0207646_10087028 Ga0207646_100870282 451
106 3300025922 Ga0207646_10099921 Ga0207646_100999211 451
107 3300045051 Ga0451576_0012955 Ga0451576_0012955_7264_8643 451
108 3300046472 Ga0495580_0073541 Ga0495580_0073541_683_2062 451
109 3300005445 Ga0070708_100012125 Ga0070708_1000121253 452
110 3300005467 Ga0070706_100014191 Ga0070706_1000141914 452
111 3300005468 Ga0070707_100120296 Ga0070707_1001202962 452
112 3300005471 Ga0070698_100008047 Ga0070698_10000804710 452
113 3300005518 Ga0070699_100016775 Ga0070699_1000167753 452
114 3300005536 Ga0070697_100000998 Ga0070697_10000099825 452
115 3300005937 Ga0081455_10001883 Ga0081455_1000188319 452
116 3300006847 Ga0075431_100177242 Ga0075431_1001772421 452
117 3300009147 Ga0114129_10043714 Ga0114129_100437147 452
118 3300009147 Ga0114129_10068524 Ga0114129_100685242 452
119 3300025910 Ga0207684_10000819 Ga0207684_1000081913 452
120 3300025922 Ga0207646_10000768 Ga0207646_1000076813 452
121 3300044673 Ga0453683_0011685 Ga0453683_0011685_3519_4898 452
122 3300044673 Ga0453683_0046485 Ga0453683_0046485_150_1529 452
123 3300045051 Ga0451576_0044416 Ga0451576_0044416_1697_3076 452
124 3300049576 Ga0501040_0003062 Ga0501040_0003062_257_1624 452
125 3300049576 Ga0501040_0011771 Ga0501040_0011771_3828_5207 452
126 3300049582 Ga0501048_0062555 Ga0501048_0062555_1189_2556 452
127 3300049583 Ga0501067_0025169 Ga0501067_0025169_1488_2855 452
128 3300049588 Ga0501072_0086976 Ga0501072_0086976_506_1885 452
129 3300049741 Ga0501079_0011732 Ga0501079_0011732_2831_4210 452
130 3300049744 Ga0501083_0005668 Ga0501083_0005668_770_2137 452
131 3300049824 Ga0501045_0034506 Ga0501045_0034506_2249_3616 452
132 3300050507 nmdc:mga05p37_24771_c1 nmdc:mga05p37_24771_c1_2627_4006 452
133 3300050507 nmdc:mga05p37_95993_c2 nmdc:mga05p37_95993_c2_1264_2631 452
134 3300050515 nmdc:mga0a205_140598_c1 nmdc:mga0a205_140598_c1_85_1452 452
135 3300054114 Ga0501084_0023855 Ga0501084_0023855_2502_3881 452
136 3300060353 Ga0501082_0001867 Ga0501082_0001867_3003_4370 452
137 3300061734 Ga0530510_0095776 Ga0530510_0095776_284_1651 452
138 3300049578 Ga0501042_0069707 Ga0501042_0069707_894_2276 453
139 3300049588 Ga0501072_0031872 Ga0501072_0031872_163_1545 453
140 3300049593 Ga0501077_0045224 Ga0501077_0045224_843_2225 453
141 3300005328 Ga0070676_10005899 Ga0070676_100058993 454
142 3300005329 Ga0070683_100099790 Ga0070683_1000997903 454
143 3300005331 Ga0070670_100001311 Ga0070670_1000013117 454
144 3300005334 Ga0068869_100002343 Ga0068869_1000023437 454
145 3300005336 Ga0070680_100000432 Ga0070680_10000043220 454
146 3300005337 Ga0070682_100000399 Ga0070682_10000039929 454
147 3300005339 Ga0070660_100000696 Ga0070660_1000006969 454
148 3300005340 Ga0070689_100016679 Ga0070689_1000166797 454
149 3300005341 Ga0070691_10005993 Ga0070691_100059938 454
150 3300005343 Ga0070687_100015881 Ga0070687_1000158813 454
151 3300005344 Ga0070661_100001223 Ga0070661_10000122318 454
152 3300005345 Ga0070692_10000070 Ga0070692_100000707 454
153 3300005353 Ga0070669_100039812 Ga0070669_1000398122 454
154 3300005366 Ga0070659_100000962 Ga0070659_10000096221 454
155 3300005438 Ga0070701_10006438 Ga0070701_100064387 454
156 3300005440 Ga0070705_100000192 Ga0070705_10000019231 454
157 3300005444 Ga0070694_100016672 Ga0070694_1000166725 454
158 3300005457 Ga0070662_100002919 Ga0070662_1000029199 454
159 3300005458 Ga0070681_10001981 Ga0070681_100019811 454
160 3300005459 Ga0068867_100056603 Ga0068867_1000566032 454
161 3300005518 Ga0070699_100076735 Ga0070699_1000767352 454
162 3300005530 Ga0070679_100021785 Ga0070679_1000217851 454
163 3300005539 Ga0068853_100015800 Ga0068853_1000158002 454
164 3300005545 Ga0070695_100003185 Ga0070695_1000031852 454
165 3300005546 Ga0070696_100000118 Ga0070696_10000011820 454
166 3300005547 Ga0070693_100000191 Ga0070693_10000019117 454
167 3300005549 Ga0070704_100003482 Ga0070704_1000034821 454
168 3300005563 Ga0068855_100001325 Ga0068855_10000132517 454
169 3300005564 Ga0070664_100002558 Ga0070664_10000255818 454
170 3300005577 Ga0068857_100101755 Ga0068857_1001017552 454
171 3300005578 Ga0068854_100000883 Ga0068854_10000088317 454
172 3300005614 Ga0068856_100000353 Ga0068856_1000003534 454
173 3300005615 Ga0070702_100006242 Ga0070702_1000062422 454
174 3300005617 Ga0068859_100001263 Ga0068859_10000126325 454
175 3300005618 Ga0068864_100177873 Ga0068864_1001778732 454
176 3300005840 Ga0068870_10000272 Ga0068870_1000027218 454
177 3300005841 Ga0068863_100012798 Ga0068863_1000127988 454
178 3300005844 Ga0068862_100209576 Ga0068862_1002095762 454
179 3300006931 Ga0097620_100001263 Ga0097620_1000012638 454
180 3300009174 Ga0105241_10000954 Ga0105241_1000095417 454
181 3300013100 Ga0157373_10001458 Ga0157373_1000145818 454
182 3300013297 Ga0157378_10263147 Ga0157378_102631472 454
183 3300013307 Ga0157372_10000063 Ga0157372_1000006379 454
184 3300013308 Ga0157375_10036561 Ga0157375_100365616 454
185 3300015262 Ga0182007_10017988 Ga0182007_100179881 454
186 3300025907 Ga0207645_10000433 Ga0207645_1000043327 454
187 3300025908 Ga0207643_10000177 Ga0207643_1000017726 454
188 3300025911 Ga0207654_10000910 Ga0207654_1000091012 454
189 3300025912 Ga0207707_10002021 Ga0207707_1000202118 454
190 3300025917 Ga0207660_10001296 Ga0207660_1000129617 454
191 3300025919 Ga0207657_10000075 Ga0207657_1000007529 454
192 3300025920 Ga0207649_10002126 Ga0207649_1000212611 454
193 3300025921 Ga0207652_10001314 Ga0207652_100013145 454
194 3300025925 Ga0207650_10036460 Ga0207650_100364602 454
195 3300025932 Ga0207690_10002905 Ga0207690_100029057 454
196 3300025933 Ga0207706_10001713 Ga0207706_1000171319 454
197 3300025940 Ga0207691_10039062 Ga0207691_100390626 454
198 3300025942 Ga0207689_10000711 Ga0207689_100007117 454
199 3300025944 Ga0207661_10077505 Ga0207661_100775052 454
200 3300025945 Ga0207679_10001477 Ga0207679_100014773 454
201 3300025949 Ga0207667_10002454 Ga0207667_1000245417 454
202 3300025981 Ga0207640_10034520 Ga0207640_100345203 454
203 3300026023 Ga0207677_10019253 Ga0207677_100192532 454
204 3300026035 Ga0207703_10025266 Ga0207703_100252664 454
205 3300026041 Ga0207639_10018698 Ga0207639_100186982 454
206 3300026067 Ga0207678_10007331 Ga0207678_100073317 454
207 3300026075 Ga0207708_10073561 Ga0207708_100735612 454
208 3300026078 Ga0207702_10003089 Ga0207702_1000308913 454
209 3300026088 Ga0207641_10095914 Ga0207641_100959142 454
210 3300026089 Ga0207648_10000508 Ga0207648_1000050818 454
211 3300026095 Ga0207676_10035436 Ga0207676_100354363 454
212 3300026116 Ga0207674_10000630 Ga0207674_1000063027 454
213 3300028380 Ga0268265_10008097 Ga0268265_100080975 454
214 3300035088 Ga0373940_0010095 Ga0373940_0010095_666_2054 454
215 3300035091 Ga0373951_0017741 Ga0373951_0017741_198_1586 454
216 3300035121 Ga0373960_0008551 Ga0373960_0008551_401_1789 454
217 3300042157 Ga0439458_0006268 Ga0439458_0006268_156_1544 454
218 3300042438 Ga0439459_0000108 Ga0439459_0000108_5401_6789 454
219 3300042876 Ga0451577_0018257 Ga0451577_0018257_3276_4664 454
220 3300044712 Ga0453684_0064036 Ga0453684_0064036_1646_3034 454
221 3300045051 Ga0451576_0006923 Ga0451576_0006923_3555_4943 454
222 3300048905 Ga0496102_0042467 Ga0496102_0042467_1875_3263 454
223 3300050512 nmdc:mga0n895_140675_c1 nmdc:mga0n895_140675_c1_945_2333 454
224 3300050515 nmdc:mga0a205_65519_c1 nmdc:mga0a205_65519_c1_944_2332 454
225 3300006852 Ga0075433_10023185 Ga0075433_100231857 455
226 3300006871 Ga0075434_100007769 Ga0075434_10000776910 455
227 3300007076 Ga0075435_100019215 Ga0075435_1000192156 455
228 3300049741 Ga0501079_0042391 Ga0501079_0042391_1218_2588 455
229 3300050513 nmdc:mga0rr50_18865_c1 nmdc:mga0rr50_18865_c1_121_1542 455
230 3300050515 nmdc:mga0a205_38839_c1 nmdc:mga0a205_38839_c1_120_1541 455
231 3300061734 Ga0530510_0116599 Ga0530510_0116599_283_1659 455
232 3300021384 Ga0213876_10015646 Ga0213876_100156462 456
233 3300021384 Ga0213876_10015919 Ga0213876_100159193 456
234 3300039437 Ga0436365_1627183 Ga0436365_1627183_1974_3434 456
235 3300006844 Ga0075428_100000028 Ga0075428_1000000283 457
236 3300006846 Ga0075430_100000051 Ga0075430_10000005134 457
237 3300050507 nmdc:mga05p37_13731_c1 nmdc:mga05p37_13731_c1_5583_6980 457
238 3300050509 nmdc:mga0qj67_1826_c1 nmdc:mga0qj67_1826_c1_10406_11803 457
239 3300050510 nmdc:mga06r32_18001_c1 nmdc:mga06r32_18001_c1_4995_6392 457
240 3300005617 Ga0068859_100073734 Ga0068859_1000737342 458
241 3300005617 Ga0068859_100248091 Ga0068859_1002480911 458
242 3300006931 Ga0097620_100073733 Ga0097620_1000737332 458
243 3300006931 Ga0097620_100248059 Ga0097620_1002480591 458
244 3300007076 Ga0075435_100018869 Ga0075435_1000188696 458
245 3300009147 Ga0114129_10094880 Ga0114129_100948805 458
246 3300009177 Ga0105248_10103509 Ga0105248_101035092 458
247 3300025961 Ga0207712_10029251 Ga0207712_100292512 458
248 3300031995 Ga0307409_100152800 Ga0307409_1001528002 459
249 3300005445 Ga0070708_100037776 Ga0070708_1000377763 460
250 3300005518 Ga0070699_100013445 Ga0070699_1000134453 460
251 3300025922 Ga0207646_10094388 Ga0207646_100943882 460
252 3300061734 Ga0530510_0000152 Ga0530510_0000152_17284_18684 460
253 3300049577 Ga0501041_0011108 Ga0501041_0011108_2861_4264 461
254 3300049591 Ga0501075_0007218 Ga0501075_0007218_6007_7410 461
255 3300049592 Ga0501076_0033976 Ga0501076_0033976_449_1852 461
256 3300049592 Ga0501076_0107190 Ga0501076_0107190_201_1604 461
257 3300054114 Ga0501084_0082757 Ga0501084_0082757_870_2273 461
258 3300061734 Ga0530510_0002288 Ga0530510_0002288_9916_11319 461
259 3300005441 Ga0070700_100122262 Ga0070700_1001222622 462
260 3300005445 Ga0070708_100037864 Ga0070708_1000378645 462
261 3300005467 Ga0070706_100172213 Ga0070706_1001722131 462
262 3300005468 Ga0070707_100083185 Ga0070707_1000831852 462
263 3300005468 Ga0070707_100122191 Ga0070707_1001221912 462
264 3300005518 Ga0070699_100071862 Ga0070699_1000718621 462
265 3300005843 Ga0068860_100093617 Ga0068860_1000936172 462
266 3300006175 Ga0070712_100012945 Ga0070712_1000129454 462
267 3300009148 Ga0105243_10006401 Ga0105243_100064015 462
268 3300025915 Ga0207693_10039484 Ga0207693_100394842 462
269 3300025935 Ga0207709_10039754 Ga0207709_100397541 462
270 3300025942 Ga0207689_10014430 Ga0207689_100144305 462
271 3300026088 Ga0207641_10019783 Ga0207641_100197832 462
272 3300026116 Ga0207674_10053545 Ga0207674_100535452 462
273 3300028381 Ga0268264_10155395 Ga0268264_101553952 462
274 3300006871 Ga0075434_100066220 Ga0075434_1000662202 463
275 3300050512 nmdc:mga0n895_99362_c1 nmdc:mga0n895_99362_c1_760_2154 463
276 3300050515 nmdc:mga0a205_37558_c1 nmdc:mga0a205_37558_c1_2665_4080 463
277 3300005445 Ga0070708_100015531 Ga0070708_1000155312 464
278 3300005844 Ga0068862_100032960 Ga0068862_1000329604 464
279 3300006844 Ga0075428_100066817 Ga0075428_1000668175 464
280 3300006852 Ga0075433_10026082 Ga0075433_100260822 464
281 3300006871 Ga0075434_100054506 Ga0075434_1000545063 464
282 3300009147 Ga0114129_10266911 Ga0114129_102669112 464
283 3300027907 Ga0207428_10000119 Ga0207428_1000011946 464
284 3300028380 Ga0268265_10151062 Ga0268265_101510621 464
285 3300035695 Ga0373927_0133557 Ga0373927_0133557_41_1438 464
286 3300042876 Ga0451577_0001635 Ga0451577_0001635_5408_6826 464
287 3300044712 Ga0453684_0022118 Ga0453684_0022118_20_1438 464
288 3300045051 Ga0451576_0021367 Ga0451576_0021367_1124_2542 464
289 3300046472 Ga0495580_0004749 Ga0495580_0004749_310_1713 464
290 3300050511 nmdc:mga08y16_6269_c1 nmdc:mga08y16_6269_c1_6300_7718 464
291 3300050515 nmdc:mga0a205_16908_c1 nmdc:mga0a205_16908_c1_5270_6688 464
292 3300050515 nmdc:mga0a205_41528_c1 nmdc:mga0a205_41528_c1_450_1850 464
293 3300006844 Ga0075428_100293410 Ga0075428_1002934101 465
294 3300006852 Ga0075433_10148613 Ga0075433_101486132 465
295 3300009147 Ga0114129_10062581 Ga0114129_100625813 465
296 3300009147 Ga0114129_10080854 Ga0114129_100808542 465
297 3300009147 Ga0114129_10261184 Ga0114129_102611842 465
298 3300027876 Ga0209974_10004653 Ga0209974_100046533 465
299 3300049591 Ga0501075_0037242 Ga0501075_0037242_1450_2850 465
300 3300049591 Ga0501075_0076875 Ga0501075_0076875_973_2415 465
301 3300050507 nmdc:mga05p37_34625_c1 nmdc:mga05p37_34625_c1_3338_4744 465
302 3300050515 nmdc:mga0a205_8636_c1 nmdc:mga0a205_8636_c1_252_1652 465
303 3300054114 Ga0501084_0265934 Ga0501084_0265934_38_1438 465
304 3300049570 Ga0501033_0093996 Ga0501033_0093996_205_1608 466
305 3300049572 Ga0501036_0012915 Ga0501036_0012915_2237_3640 466
306 3300049574 Ga0501038_0001197 Ga0501038_0001197_8010_9413 466
307 3300049575 Ga0501039_0000716 Ga0501039_0000716_13956_15359 466
308 3300049576 Ga0501040_0000225 Ga0501040_0000225_13605_15008 466
309 3300049577 Ga0501041_0000157 Ga0501041_0000157_25131_26534 466
310 3300049578 Ga0501042_0000339 Ga0501042_0000339_12730_14133 466
311 3300049579 Ga0501043_0022291 Ga0501043_0022291_1461_2864 466
312 3300049580 Ga0501046_0007239 Ga0501046_0007239_48_1451 466
313 3300049582 Ga0501048_0002956 Ga0501048_0002956_8280_9683 466
314 3300049587 Ga0501071_0012950 Ga0501071_0012950_1332_2735 466
315 3300049590 Ga0501074_0011809 Ga0501074_0011809_3865_5268 466
316 3300049591 Ga0501075_0000240 Ga0501075_0000240_8075_9478 466
317 3300049592 Ga0501076_0000299 Ga0501076_0000299_13621_15024 466
318 3300049593 Ga0501077_0000919 Ga0501077_0000919_3410_4813 466
319 3300049741 Ga0501079_0009391 Ga0501079_0009391_2380_3783 466
320 3300049742 Ga0501080_0026495 Ga0501080_0026495_1788_3191 466
321 3300049743 Ga0501081_0001124 Ga0501081_0001124_11912_13315 466
322 3300049823 Ga0501044_0282473 Ga0501044_0282473_46_1449 466
323 3300049824 Ga0501045_0002153 Ga0501045_0002153_8371_9774 466
324 3300054114 Ga0501084_0002186 Ga0501084_0002186_12451_13854 466
325 3300060353 Ga0501082_0002759 Ga0501082_0002759_10134_11537 466
326 3300061734 Ga0530510_0000819 Ga0530510_0000819_15678_17081 466
327 3300005290 Ga0065712_10000608 Ga0065712_1000060812 469
328 3300005290 Ga0065712_10019218 Ga0065712_100192181 469
329 3300005293 Ga0065715_10009764 Ga0065715_100097644 469
330 3300005293 Ga0065715_10100103 Ga0065715_101001032 469
331 3300005327 Ga0070658_10086701 Ga0070658_100867013 469
332 3300005330 Ga0070690_100038623 Ga0070690_1000386231 469
333 3300005331 Ga0070670_100007327 Ga0070670_1000073273 469
334 3300005335 Ga0070666_10009749 Ga0070666_100097496 469
335 3300005339 Ga0070660_100032670 Ga0070660_1000326703 469
336 3300005344 Ga0070661_100017430 Ga0070661_1000174303 469
337 3300005353 Ga0070669_100015330 Ga0070669_1000153301 469
338 3300005354 Ga0070675_100094785 Ga0070675_1000947851 469
339 3300005355 Ga0070671_100080232 Ga0070671_1000802323 469
340 3300005366 Ga0070659_100024643 Ga0070659_1000246433 469
341 3300005367 Ga0070667_100073858 Ga0070667_1000738581 469
342 3300005440 Ga0070705_100010601 Ga0070705_1000106011 469
343 3300005455 Ga0070663_100032653 Ga0070663_1000326533 469
344 3300005455 Ga0070663_100091005 Ga0070663_1000910052 469
345 3300005458 Ga0070681_10023079 Ga0070681_100230792 469
346 3300005543 Ga0070672_100063990 Ga0070672_1000639902 469
347 3300005545 Ga0070695_100109433 Ga0070695_1001094331 469
348 3300005546 Ga0070696_100022855 Ga0070696_1000228554 469
349 3300005547 Ga0070693_100020696 Ga0070693_1000206963 469
350 3300005548 Ga0070665_100125807 Ga0070665_1001258073 469
351 3300005549 Ga0070704_100191634 Ga0070704_1001916341 469
352 3300005578 Ga0068854_100075155 Ga0068854_1000751553 469
353 3300005718 Ga0068866_10041803 Ga0068866_100418031 469
354 3300005841 Ga0068863_100237494 Ga0068863_1002374942 469
355 3300006358 Ga0068871_100093078 Ga0068871_1000930781 469
356 3300006852 Ga0075433_10059147 Ga0075433_100591472 469
357 3300006871 Ga0075434_100040999 Ga0075434_1000409994 469
358 3300006871 Ga0075434_100185220 Ga0075434_1001852202 469
359 3300009093 Ga0105240_10197461 Ga0105240_101974613 469
360 3300009094 Ga0111539_10166256 Ga0111539_101662562 469
361 3300009176 Ga0105242_10054643 Ga0105242_100546432 469
362 3300011119 Ga0105246_10006951 Ga0105246_100069514 469
363 3300013296 Ga0157374_10009842 Ga0157374_100098425 469
364 3300013306 Ga0163162_10025282 Ga0163162_100252822 469
365 3300013307 Ga0157372_10026453 Ga0157372_100264535 469
366 3300013308 Ga0157375_10136913 Ga0157375_101369132 469
367 3300014969 Ga0157376_10009087 Ga0157376_100090876 469
368 3300025907 Ga0207645_10002784 Ga0207645_1000278411 469
369 3300025919 Ga0207657_10022338 Ga0207657_100223383 469
370 3300025923 Ga0207681_10026804 Ga0207681_100268043 469
371 3300025931 Ga0207644_10097559 Ga0207644_100975591 469
372 3300025932 Ga0207690_10064812 Ga0207690_100648122 469
373 3300025933 Ga0207706_10016652 Ga0207706_100166523 469
374 3300025937 Ga0207669_10104230 Ga0207669_101042302 469
375 3300025945 Ga0207679_10079568 Ga0207679_100795683 469
376 3300025981 Ga0207640_10151746 Ga0207640_101517461 469
377 3300026067 Ga0207678_10019945 Ga0207678_100199452 469
378 3300026078 Ga0207702_10057594 Ga0207702_100575941 469
379 3300028381 Ga0268264_10129112 Ga0268264_101291122 469
380 3300035691 Ga0373931_0014830 Ga0373931_0014830_1401_2810 469
381 3300048907 Ga0496104_0193882 Ga0496104_0193882_515_1927 469
382 3300048916 Ga0496113_0037502 Ga0496113_0037502_1957_3369 469
383 3300050512 nmdc:mga0n895_83509_c1 nmdc:mga0n895_83509_c1_1198_2631 469
384 3300050513 nmdc:mga0rr50_38229_c1 nmdc:mga0rr50_38229_c1_212_1621 469

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

411

484

0.95

PF00501

AMP-binding

AMP-binding enzyme

27

361

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u95-assembly1.cif.gz_A structure of the open conformation of 4-coumarate-coa ligase from nicotiana tabacum 0.903 4 363
3u16-assembly2.cif.gz_B structure of base n-terminal domain from acinetobacter baumannii bound to 6-(p-benzyloxy)phenyl-1-(pyridin-4-ylmethyl)-1h-pyrazolo[3,4-b]pyridine-4-carboxylic acid. 0.8931 1 363
3o83-assembly1.cif.gz_A structure of base n-terminal domain from acinetobacter baumannii bound to 2-(4-n-dodecyl-1,2,3-triazol-1-yl)-5'-o-[n-(2-hydroxybenzoyl)sulfamoyl]adenosine 0.8911 1 363
8atd-assembly1.cif.gz_F wild type hexamer oxalyl-coa synthetase (ocs) 0.8901 16 366
3wvn-assembly1.cif.gz_A complex structure of vinn with l-aspartate 0.89 5 362
ID Description Score Start End Superfamily
af_A0A1D6KNL0_124_190_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9635 370 434 3.30.300.30
af_Q7KVU5_528_609_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9624 366 444 3.30.300.30
af_Q4CLK5_113_248_3.40.50.980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9596 27 104 3.40.50.980
af_P31552_422_517_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9516 367 453 3.30.300.30
af_A0A0R0JS26_74_160_3.40.50.980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9509 32 106 3.40.50.980
ID Description Score Start End GO Terms
AF-A0A5M9X1Z8-F1-model_v4 AMP-binding protein 0.9425 4 107 GO:0003824
GO:0005829
GO:0017000
GO:0031177
GO:0043041
GO:0044550
AF-A0A3E0PLB7-F1-model_v4 Benzoate-CoA ligase family protein 0.9357 3 382 GO:0016878
GO:0044550
AF-A0A7C5MDQ0-F1-model_v4 Carrier domain-containing protein 0.9239 367 451 GO:0005737
GO:0031177
GO:0043041
GO:0044550
AF-A0A535KEW9-F1-model_v4 2-aminobenzoate-CoA ligase 0.9233 4 307 GO:0016878
GO:0044550
AF-A0A533VPQ0-F1-model_v4 Long-chain fatty acid--CoA ligase 0.921 1 365 GO:0016874

Feature Viewer

pLDDT pTM Quality
91.14 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map