F429951

General Info

Members Datasets Scaffolds Average Seq Length
384 155 768 281

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0531097|Ga0395905_0531097_74_1033
Length 319
Sequence LICGCCIAAAHSAEAAICYPGLTCPSGKETKRMMAVRFFRRSRSTADSQKAETKESVGSLLRFLLTIAIIAWAFRSFVGAPFNIPSGSMLPTLYVGDYVAVTKWPYGYSRYSFPLAFPSFDGRIFGGLPHRGDVVVFRHPTEDADLIKRVIALAGDRVAVSDGQLILNGRPVPRQPLAPAKIAVTPNSPCRAIPPSTPTIALDDKQPICLYHAFLETLPGGPTYTVLDQVDHGAADDFPETTVPAGRVFLMGDNRDDSLDSRFPTYEGGIGMVPTENLIGRASFTFWSTDGGASWFKPWTWFTALRGSRIGNGYTGKAK

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 7.29
Rhizosphere 92.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0531097 3300037471 Bacteria 1077
2 JGI24752J21851_1004059 3300001976 Bacteria 1923
3 JGI24739J22299_10010073 3300001989 Bacteria 3513
4 JGI24737J22298_10000172 3300001990 Bacteria 20869
5 JGI24737J22298_10001166 3300001990 Bacteria 9251
6 JGI24737J22298_10032463 3300001990 Bacteria 1625
7 JGI24745J21846_1001435 3300002073 Bacteria 2314
8 JGI24744J21845_10019765 3300002077 Bacteria 1331
9 JGI24034J26672_10006866 3300002239 Bacteria 1649
10 Ga0065715_10165652 3300005293 Bacteria 1589
11 Ga0070658_10036686 3300005327 Bacteria 3951
12 Ga0070658_10038193 3300005327 Bacteria 3873
13 Ga0070658_10048204 3300005327 Bacteria 3448
14 Ga0070676_10021919 3300005328 Bacteria 3579
15 Ga0070683_100037821 3300005329 Bacteria 4419
16 Ga0070670_100013595 3300005331 Bacteria 6976
17 Ga0070670_100018265 3300005331 Bacteria 6016
18 Ga0070677_10076351 3300005333 Bacteria 1422
19 Ga0068869_100506333 3300005334 Bacteria 1009
20 Ga0070666_10015985 3300005335 Bacteria 4794
21 Ga0070666_10017759 3300005335 Bacteria 4564
22 Ga0070666_10052317 3300005335 Bacteria 2752
23 Ga0068868_100031808 3300005338 Bacteria 4057
24 Ga0068868_100178990 3300005338 Bacteria 1758
25 Ga0070660_100001509 3300005339 Bacteria 15957
26 Ga0070660_100023985 3300005339 Bacteria 4523
27 Ga0070660_100078800 3300005339 Bacteria 2583
28 Ga0070660_100195111 3300005339 Bacteria 1641
29 Ga0070660_100217484 3300005339 Bacteria 1552
30 Ga0070660_100284758 3300005339 Bacteria 1353
31 Ga0070691_10000966 3300005341 Bacteria 11743
32 Ga0070661_100003586 3300005344 Bacteria 10685
33 Ga0070661_100004643 3300005344 Bacteria 9459
34 Ga0070661_100027778 3300005344 Bacteria 4077
35 Ga0070675_100116381 3300005354 Bacteria 2267
36 Ga0070675_100119850 3300005354 Bacteria 2235
37 Ga0070675_100479898 3300005354 Bacteria 1118
38 Ga0070671_100002442 3300005355 Bacteria 14371
39 Ga0070671_100043168 3300005355 Bacteria 3747
40 Ga0070671_100066503 3300005355 Bacteria 3004
41 Ga0070671_100153832 3300005355 Bacteria 1943
42 Ga0070674_100067354 3300005356 Bacteria 2518
43 Ga0070674_100161997 3300005356 Bacteria 1698
44 Ga0070673_100024424 3300005364 Bacteria 4432
45 Ga0070673_100028540 3300005364 Bacteria 4151
46 Ga0070673_100057079 3300005364 Bacteria 3084
47 Ga0070673_100284590 3300005364 Bacteria 1451
48 Ga0070673_100484852 3300005364 Bacteria 1116
49 Ga0070659_100001907 3300005366 Bacteria 14906
50 Ga0070659_100012067 3300005366 Bacteria 6397
51 Ga0070659_100022212 3300005366 Bacteria 4840
52 Ga0070659_100140310 3300005366 Bacteria 1967
53 Ga0070659_100268711 3300005366 Bacteria 1416
54 Ga0070667_100001032 3300005367 Bacteria 25440
55 Ga0070667_100002148 3300005367 Bacteria 17364
56 Ga0070667_100203105 3300005367 Bacteria 1759
57 Ga0070709_10065820 3300005434 Bacteria 2322
58 Ga0070714_100049213 3300005435 Bacteria 3587
59 Ga0070714_100219667 3300005435 Bacteria 1746
60 Ga0070713_100108444 3300005436 Bacteria 2417
61 Ga0070711_100394312 3300005439 Bacteria 1122
62 Ga0070663_100031587 3300005455 Bacteria 3640
63 Ga0070663_100350692 3300005455 Bacteria 1195
64 Ga0070678_100000889 3300005456 Bacteria 15354
65 Ga0070678_100013061 3300005456 Bacteria 5191
66 Ga0070662_100009181 3300005457 Bacteria 6456
67 Ga0070662_100017631 3300005457 Bacteria 4818
68 Ga0070662_100018296 3300005457 Bacteria 4738
69 Ga0070662_100087124 3300005457 Bacteria 2337
70 Ga0070662_100227704 3300005457 Bacteria 1490
71 Ga0068867_100010099 3300005459 Bacteria 6653
72 Ga0068867_100191501 3300005459 Bacteria 1632
73 Ga0070684_100030763 3300005535 Bacteria 4565
74 Ga0068853_100047060 3300005539 Bacteria 3701
75 Ga0068853_100164153 3300005539 Bacteria 2006
76 Ga0068853_100258520 3300005539 Bacteria 1600
77 Ga0070672_100002340 3300005543 Bacteria 11982
78 Ga0070672_100002525 3300005543 Bacteria 11648
79 Ga0070672_100254720 3300005543 Bacteria 1479
80 Ga0070665_100053988 3300005548 Bacteria 4030
81 Ga0070665_100570603 3300005548 Bacteria 1144
82 Ga0070664_100010612 3300005564 Bacteria 7465
83 Ga0070664_100020123 3300005564 Bacteria 5494
84 Ga0070664_100030014 3300005564 Bacteria 4534
85 Ga0070664_100042361 3300005564 Bacteria 3844
86 Ga0068857_100002400 3300005577 Bacteria 15273
87 Ga0068857_100006185 3300005577 Bacteria 10233
88 Ga0068857_100061045 3300005577 Bacteria 3349
89 Ga0068857_100180735 3300005577 Bacteria 1920
90 Ga0068854_100021395 3300005578 Bacteria 4389
91 Ga0068854_100063130 3300005578 Bacteria 2688
92 Ga0068854_100066983 3300005578 Bacteria 2615
93 Ga0068854_100181209 3300005578 Bacteria 1645
94 Ga0068856_100548076 3300005614 Bacteria 1178
95 Ga0068852_100001822 3300005616 Bacteria 14491
96 Ga0068852_100015269 3300005616 Bacteria 5948
97 Ga0068852_100033274 3300005616 Bacteria 4278
98 Ga0068852_100265524 3300005616 Bacteria 1650
99 Ga0068852_100369145 3300005616 Bacteria 1405
100 Ga0068859_100033630 3300005617 Bacteria 5149
101 Ga0068859_100201486 3300005617 Bacteria 2075
102 Ga0068864_100002309 3300005618 Bacteria 15778
103 Ga0068864_100003157 3300005618 Bacteria 13623
104 Ga0068864_100010134 3300005618 Bacteria 7781
105 Ga0068866_10062190 3300005718 Bacteria 1942
106 Ga0068866_10076974 3300005718 Bacteria 1780
107 Ga0068861_100363858 3300005719 Bacteria 1273
108 Ga0068851_10020093 3300005834 Bacteria 3230
109 Ga0068851_10048310 3300005834 Bacteria 2156
110 Ga0068851_10088731 3300005834 Bacteria 1625
111 Ga0068863_100008753 3300005841 Bacteria 9883
112 Ga0068863_100014029 3300005841 Bacteria 7719
113 Ga0068858_100016866 3300005842 Bacteria 6858
114 Ga0068858_100020431 3300005842 Bacteria 6192
115 Ga0068860_100115768 3300005843 Bacteria 2564
116 Ga0068862_100060368 3300005844 Bacteria 3257
117 Ga0081539_10128831 3300005985 Bacteria 1246
118 Ga0070717_10146343 3300006028 Bacteria 2041
119 Ga0075362_10117539 3300006177 Bacteria 1256
120 Ga0097621_100011743 3300006237 Bacteria 6468
121 Ga0097621_100025728 3300006237 Bacteria 4607
122 Ga0097621_100131998 3300006237 Bacteria 2127
123 Ga0097621_100406458 3300006237 Bacteria 1220
124 Ga0068871_100003418 3300006358 Bacteria 10915
125 Ga0068865_100002786 3300006881 Bacteria 10384
126 Ga0068865_100003011 3300006881 Bacteria 10063
127 Ga0068865_100064471 3300006881 Bacteria 2579
128 Ga0097620_100033627 3300006931 Bacteria 5149
129 Ga0097620_100201498 3300006931 Bacteria 2075
130 Ga0105240_10052853 3300009093 Bacteria 5104
131 Ga0105240_10243482 3300009093 Bacteria 2084
132 Ga0105245_10012462 3300009098 Bacteria 7399
133 Ga0105245_10088412 3300009098 Bacteria 2846
134 Ga0105243_10199044 3300009148 Bacteria 1755
135 Ga0105241_10154871 3300009174 Bacteria 1878
136 Ga0105242_10003308 3300009176 Bacteria 12547
137 Ga0105248_10001494 3300009177 Bacteria 26021
138 Ga0105248_10006331 3300009177 Bacteria 12988
139 Ga0105248_10161260 3300009177 Bacteria 2529
140 Ga0105248_10180586 3300009177 Bacteria 2378
141 Ga0105248_10316452 3300009177 Bacteria 1758
142 Ga0105237_10027805 3300009545 Bacteria 5764
143 Ga0105238_10008144 3300009551 Bacteria 10483
144 Ga0105238_10038697 3300009551 Bacteria 4843
145 Ga0105249_10647977 3300009553 Bacteria 1114
146 Ga0105239_10087185 3300010375 Bacteria 3441
147 Ga0105246_10052609 3300011119 Bacteria 2799
148 Ga0105246_10505630 3300011119 Bacteria 1027
149 Ga0157373_10009371 3300013100 Bacteria 7235
150 Ga0157373_10028733 3300013100 Bacteria 4010
151 Ga0157373_10071924 3300013100 Bacteria 2442
152 Ga0157373_10167732 3300013100 Bacteria 1545
153 Ga0157371_10121181 3300013102 Bacteria 1860
154 Ga0157371_10126062 3300013102 Bacteria 1821
155 Ga0157371_10262186 3300013102 Bacteria 1246
156 Ga0157370_10002132 3300013104 Bacteria 24152
157 Ga0157369_10010201 3300013105 Bacteria 10718
158 Ga0157369_10133344 3300013105 Bacteria 2631
159 Ga0157374_10019892 3300013296 Bacteria 5949
160 Ga0157374_10082739 3300013296 Bacteria 3048
161 Ga0157374_10115702 3300013296 Bacteria 2583
162 Ga0157374_10131984 3300013296 Bacteria 2418
163 Ga0157378_10009310 3300013297 Bacteria 8556
164 Ga0157378_10048255 3300013297 Bacteria 3786
165 Ga0157378_10086697 3300013297 Bacteria 2838
166 Ga0157378_10317195 3300013297 Bacteria 1513
167 Ga0163162_10019478 3300013306 Bacteria 6657
168 Ga0163162_10024015 3300013306 Bacteria 6016
169 Ga0163162_10032880 3300013306 Bacteria 5151
170 Ga0163162_10129364 3300013306 Bacteria 2633
171 Ga0157372_10021307 3300013307 Bacteria 7001
172 Ga0157372_10221918 3300013307 Bacteria 2191
173 Ga0157372_10618803 3300013307 Bacteria 1262
174 Ga0157375_10007721 3300013308 Bacteria 9415
175 Ga0157375_10018918 3300013308 Bacteria 6253
176 Ga0157375_10059996 3300013308 Bacteria 3770
177 Ga0157375_10090337 3300013308 Bacteria 3121
178 Ga0163163_10002645 3300014325 Bacteria 15158
179 Ga0163163_10028520 3300014325 Bacteria 5361
180 Ga0163163_10109588 3300014325 Bacteria 2788
181 Ga0182008_10088237 3300014497 Bacteria 1528
182 Ga0157377_10202175 3300014745 Bacteria 1262
183 Ga0157379_10010111 3300014968 Bacteria 8225
184 Ga0157376_10002926 3300014969 Bacteria 11717
185 Ga0207697_10013441 3300025315 Bacteria 3416
186 Ga0207697_10052158 3300025315 Bacteria 1692
187 Ga0207682_10020124 3300025893 Bacteria 2618
188 Ga0207642_10075690 3300025899 Bacteria 1617
189 Ga0207688_10004520 3300025901 Bacteria 7572
190 Ga0207647_10001452 3300025904 Bacteria 18194
191 Ga0207647_10007265 3300025904 Bacteria 8018
192 Ga0207647_10015410 3300025904 Bacteria 5241
193 Ga0207643_10022846 3300025908 Bacteria 3446
194 Ga0207705_10000475 3300025909 Bacteria 34403
195 Ga0207705_10011041 3300025909 Bacteria 6550
196 Ga0207705_10205409 3300025909 Bacteria 1493
197 Ga0207695_10063623 3300025913 Bacteria 3803
198 Ga0207671_10078157 3300025914 Bacteria 2478
199 Ga0207660_10154733 3300025917 Bacteria 1764
200 Ga0207657_10000919 3300025919 Bacteria 31133
201 Ga0207657_10005161 3300025919 Bacteria 13700
202 Ga0207657_10005933 3300025919 Bacteria 12714
203 Ga0207657_10006910 3300025919 Bacteria 11706
204 Ga0207657_10039871 3300025919 Bacteria 4168
205 Ga0207657_10121244 3300025919 Bacteria 2151
206 Ga0207657_10181146 3300025919 Bacteria 1703
207 Ga0207649_10002717 3300025920 Bacteria 9805
208 Ga0207649_10022408 3300025920 Bacteria 3649
209 Ga0207649_10040650 3300025920 Bacteria 2828
210 Ga0207649_10100025 3300025920 Bacteria 1917
211 Ga0207694_10046515 3300025924 Bacteria 3354
212 Ga0207650_10003728 3300025925 Bacteria 10424
213 Ga0207650_10007235 3300025925 Bacteria 7559
214 Ga0207650_10176106 3300025925 Bacteria 1702
215 Ga0207659_10113403 3300025926 Bacteria 2064
216 Ga0207659_10132070 3300025926 Bacteria 1928
217 Ga0207687_10004771 3300025927 Bacteria 9017
218 Ga0207700_10148085 3300025928 Bacteria 1937
219 Ga0207644_10000522 3300025931 Bacteria 24894
220 Ga0207644_10000744 3300025931 Bacteria 20651
221 Ga0207644_10001113 3300025931 Bacteria 17260
222 Ga0207644_10001832 3300025931 Bacteria 13807
223 Ga0207644_10140228 3300025931 Bacteria 1861
224 Ga0207690_10007049 3300025932 Bacteria 6669
225 Ga0207690_10022770 3300025932 Bacteria 3901
226 Ga0207690_10023595 3300025932 Bacteria 3841
227 Ga0207690_10092431 3300025932 Bacteria 2141
228 Ga0207706_10001627 3300025933 Bacteria 22270
229 Ga0207706_10001832 3300025933 Bacteria 20857
230 Ga0207706_10003071 3300025933 Bacteria 16064
231 Ga0207706_10033298 3300025933 Bacteria 4588
232 Ga0207706_10057532 3300025933 Bacteria 3425
233 Ga0207706_10289534 3300025933 Bacteria 1428
234 Ga0207709_10261299 3300025935 Bacteria 1270
235 Ga0207669_10016112 3300025937 Bacteria 3789
236 Ga0207669_10130394 3300025937 Bacteria 1726
237 Ga0207669_10186247 3300025937 Bacteria 1493
238 Ga0207704_10007755 3300025938 Bacteria 5094
239 Ga0207704_10085824 3300025938 Bacteria 2051
240 Ga0207691_10001381 3300025940 Bacteria 24252
241 Ga0207691_10001970 3300025940 Bacteria 20068
242 Ga0207691_10051372 3300025940 Bacteria 3769
243 Ga0207691_10199652 3300025940 Bacteria 1741
244 Ga0207711_10004917 3300025941 Bacteria 11345
245 Ga0207711_10010222 3300025941 Bacteria 7792
246 Ga0207711_10015974 3300025941 Bacteria 6227
247 Ga0207711_10244844 3300025941 Bacteria 1645
248 Ga0207689_10495128 3300025942 Bacteria 1024
249 Ga0207661_10038477 3300025944 Bacteria 3749
250 Ga0207679_10013960 3300025945 Bacteria 5267
251 Ga0207679_10016870 3300025945 Bacteria 4856
252 Ga0207679_10041905 3300025945 Bacteria 3286
253 Ga0207679_10205790 3300025945 Bacteria 1647
254 Ga0207667_10002705 3300025949 Bacteria 21934
255 Ga0207667_10122628 3300025949 Bacteria 2678
256 Ga0207651_10212729 3300025960 Bacteria 1557
257 Ga0207651_10346303 3300025960 Bacteria 1250
258 Ga0207640_10031644 3300025981 Bacteria 3272
259 Ga0207640_10061097 3300025981 Bacteria 2494
260 Ga0207640_10203250 3300025981 Bacteria 1503
261 Ga0207658_10020918 3300025986 Bacteria 4534
262 Ga0207658_10061395 3300025986 Bacteria 2809
263 Ga0207658_10174739 3300025986 Bacteria 1773
264 Ga0207677_10005869 3300026023 Bacteria 6681
265 Ga0207677_10044849 3300026023 Bacteria 2949
266 Ga0207677_10127337 3300026023 Bacteria 1927
267 Ga0207639_10023082 3300026041 Bacteria 4488
268 Ga0207639_10159567 3300026041 Bacteria 1899
269 Ga0207678_10079449 3300026067 Bacteria 2809
270 Ga0207678_10094600 3300026067 Bacteria 2553
271 Ga0207678_10304147 3300026067 Bacteria 1371
272 Ga0207641_10008123 3300026088 Bacteria 8690
273 Ga0207641_10018468 3300026088 Bacteria 5717
274 Ga0207641_10065329 3300026088 Bacteria 3112
275 Ga0207648_10002294 3300026089 Bacteria 20667
276 Ga0207648_10056491 3300026089 Bacteria 3425
277 Ga0207648_10193606 3300026089 Bacteria 1803
278 Ga0207676_10006903 3300026095 Bacteria 8046
279 Ga0207676_10017039 3300026095 Bacteria 5263
280 Ga0207676_10037630 3300026095 Bacteria 3688
281 Ga0207674_10000725 3300026116 Bacteria 43126
282 Ga0207674_10005100 3300026116 Bacteria 15681
283 Ga0207674_10005725 3300026116 Bacteria 14735
284 Ga0207683_10006429 3300026121 Bacteria 10062
285 Ga0207683_10013889 3300026121 Bacteria 6867
286 Ga0207683_10024585 3300026121 Bacteria 5189
287 Ga0207683_10053751 3300026121 Bacteria 3532
288 Ga0207698_10011182 3300026142 Bacteria 5807
289 Ga0207698_10022529 3300026142 Bacteria 4380
290 Ga0207698_10040484 3300026142 Bacteria 3463
291 Ga0207698_10048912 3300026142 Bacteria 3214
292 Ga0207698_10165106 3300026142 Bacteria 1942
293 Ga0268266_10014788 3300028379 Bacteria 6704
294 Ga0268266_10075571 3300028379 Bacteria 2926
295 Ga0268265_10083771 3300028380 Bacteria 2526
296 Ga0307405_10008360 3300031731 Bacteria 5239
297 Ga0307410_10501772 3300031852 Bacteria 998
298 Ga0307416_100000569 3300032002 Bacteria 18881
299 Ga0307416_100160099 3300032002 Bacteria 2079
300 Ga0307414_10020146 3300032004 Bacteria 4151
301 Ga0373937_0254875 3300036401 Bacteria 1654
302 Ga0395899_0000432 3300037312 Bacteria 48281
303 Ga0395899_0016019 3300037312 Bacteria 5717
304 Ga0395899_0030225 3300037312 Bacteria 4075
305 Ga0395899_0055079 3300037312 Bacteria 2942
306 Ga0395900_0000432 3300037418 Bacteria 60134
307 Ga0395900_0001148 3300037418 Bacteria 33301
308 Ga0395900_0039357 3300037418 Bacteria 4871
309 Ga0395900_0069601 3300037418 Bacteria 3617
310 Ga0395900_0088568 3300037418 Bacteria 3182
311 Ga0395900_0090486 3300037418 Bacteria 3145
312 Ga0395900_0091093 3300037418 Bacteria 3133
313 Ga0395900_0094463 3300037418 Bacteria 3072
314 Ga0395900_0100303 3300037418 Bacteria 2974
315 Ga0395900_0115288 3300037418 Bacteria 2757
316 Ga0395900_0197491 3300037418 Bacteria 2037
317 Ga0395900_0239121 3300037418 Bacteria 1822
318 Ga0395900_0328462 3300037418 Bacteria 1508
319 Ga0395898_0000021 3300037466 Bacteria 393971
320 Ga0395898_0034924 3300037466 Bacteria 5003
321 Ga0395898_0086129 3300037466 Bacteria 3028
322 Ga0395898_0111778 3300037466 Bacteria 2618
323 Ga0395898_0194394 3300037466 Bacteria 1938
324 Ga0395905_0000413 3300037471 Bacteria 60132
325 Ga0395905_0000649 3300037471 Bacteria 46291
326 Ga0395905_0004444 3300037471 Bacteria 14575
327 Ga0395905_0005169 3300037471 Bacteria 13387
328 Ga0395905_0017192 3300037471 Bacteria 6870
329 Ga0395905_0041687 3300037471 Bacteria 4308
330 Ga0395905_0045062 3300037471 Bacteria 4137
331 Ga0395905_0047289 3300037471 Bacteria 4033
332 Ga0395905_0056746 3300037471 Bacteria 3663
333 Ga0395905_0086870 3300037471 Bacteria 2932
334 Ga0395905_0102455 3300037471 Bacteria 2687
335 Ga0395905_0169216 3300037471 Bacteria 2052
336 Ga0395905_0594611 3300037471 Bacteria 1008
337 Ga0395901_0000476 3300038443 Bacteria 46589
338 Ga0395901_0010511 3300038443 Bacteria 9374
339 Ga0395901_0036122 3300038443 Bacteria 5105
340 Ga0395901_0076546 3300038443 Bacteria 3491
341 Ga0395901_0085249 3300038443 Bacteria 3302
342 Ga0395901_0178303 3300038443 Bacteria 2228
343 Ga0395901_0259943 3300038443 Bacteria 1807
344 Ga0395901_0302073 3300038443 Bacteria 1659
345 Ga0395901_0324837 3300038443 Bacteria 1591
346 Ga0395901_0330754 3300038443 Bacteria 1575
347 Ga0439458_0000231 3300042157 Bacteria 13292
348 Ga0439458_0000814 3300042157 Bacteria 8018
349 Ga0439458_0038029 3300042157 Bacteria 1161
350 Ga0466969_0035024 3300044656 Bacteria 2542
351 Ga0466959_0103248 3300045049 Bacteria 2039
352 Ga0466967_0294927 3300045976 Bacteria 1559
353 Ga0495663_0003568 3300046525 Bacteria 4474
354 Ga0495621_0003418 3300046539 Bacteria 4386
355 Ga0495677_0001639 3300047445 Bacteria 8998
356 Ga0496100_0035259 3300048903 Bacteria 3145
357 Ga0496100_0142320 3300048903 Bacteria 1701
358 Ga0496101_0009079 3300048904 Bacteria 6521
359 Ga0496102_0020465 3300048905 Bacteria 5847
360 Ga0496102_0058000 3300048905 Bacteria 3537
361 Ga0496106_0444978 3300048909 Bacteria 1041
362 Ga0496107_0001637 3300048910 Bacteria 13959
363 Ga0496107_0041492 3300048910 Bacteria 3304
364 Ga0496107_0060236 3300048910 Bacteria 2747
365 Ga0496107_0140674 3300048910 Bacteria 1784
366 Ga0496108_0002271 3300048911 Bacteria 15400
367 Ga0496108_0115054 3300048911 Bacteria 2303
368 Ga0496109_0014399 3300048912 Bacteria 6882
369 Ga0496109_0132111 3300048912 Bacteria 2331
370 Ga0496109_0143709 3300048912 Bacteria 2231
371 Ga0496110_0007769 3300048913 Bacteria 8589
372 Ga0496110_0016392 3300048913 Bacteria 6186
373 Ga0496110_0064923 3300048913 Bacteria 3227
374 Ga0496111_0058138 3300048914 Bacteria 2799
375 Ga0496111_0329983 3300048914 Bacteria 1130
376 Ga0496112_0010155 3300048915 Bacteria 8530
377 Ga0496112_0021670 3300048915 Bacteria 6112
378 Ga0496112_0047822 3300048915 Bacteria 4196
379 Ga0496113_0002378 3300048916 Bacteria 10913
380 Ga0496113_0006537 3300048916 Bacteria 7400
381 Ga0496113_0025766 3300048916 Bacteria 4196
382 Ga0496113_0042922 3300048916 Bacteria 3343
383 Ga0496114_0000023 3300048917 Bacteria 219092
384 Ga0501069_0130466 3300049585 Bacteria 1439
385 Ga0395905_0531097
386 JGI24752J21851_1004059
387 JGI24739J22299_10010073
388 JGI24737J22298_10000172
389 JGI24737J22298_10001166
390 JGI24737J22298_10032463
391 JGI24745J21846_1001435
392 JGI24744J21845_10019765
393 JGI24034J26672_10006866
394 Ga0065715_10165652
395 Ga0070658_10036686
396 Ga0070658_10038193
397 Ga0070658_10048204
398 Ga0070676_10021919
399 Ga0070683_100037821
400 Ga0070670_100013595
401 Ga0070670_100018265
402 Ga0070677_10076351
403 Ga0068869_100506333
404 Ga0070666_10015985
405 Ga0070666_10017759
406 Ga0070666_10052317
407 Ga0068868_100031808
408 Ga0068868_100178990
409 Ga0070660_100001509
410 Ga0070660_100023985
411 Ga0070660_100078800
412 Ga0070660_100195111
413 Ga0070660_100217484
414 Ga0070660_100284758
415 Ga0070691_10000966
416 Ga0070661_100003586
417 Ga0070661_100004643
418 Ga0070661_100027778
419 Ga0070675_100116381
420 Ga0070675_100119850
421 Ga0070675_100479898
422 Ga0070671_100002442
423 Ga0070671_100043168
424 Ga0070671_100066503
425 Ga0070671_100153832
426 Ga0070674_100067354
427 Ga0070674_100161997
428 Ga0070673_100024424
429 Ga0070673_100028540
430 Ga0070673_100057079
431 Ga0070673_100284590
432 Ga0070673_100484852
433 Ga0070659_100001907
434 Ga0070659_100012067
435 Ga0070659_100022212
436 Ga0070659_100140310
437 Ga0070659_100268711
438 Ga0070667_100001032
439 Ga0070667_100002148
440 Ga0070667_100203105
441 Ga0070709_10065820
442 Ga0070714_100049213
443 Ga0070714_100219667
444 Ga0070713_100108444
445 Ga0070711_100394312
446 Ga0070663_100031587
447 Ga0070663_100350692
448 Ga0070678_100000889
449 Ga0070678_100013061
450 Ga0070662_100009181
451 Ga0070662_100017631
452 Ga0070662_100018296
453 Ga0070662_100087124
454 Ga0070662_100227704
455 Ga0068867_100010099
456 Ga0068867_100191501
457 Ga0070684_100030763
458 Ga0068853_100047060
459 Ga0068853_100164153
460 Ga0068853_100258520
461 Ga0070672_100002340
462 Ga0070672_100002525
463 Ga0070672_100254720
464 Ga0070665_100053988
465 Ga0070665_100570603
466 Ga0070664_100010612
467 Ga0070664_100020123
468 Ga0070664_100030014
469 Ga0070664_100042361
470 Ga0068857_100002400
471 Ga0068857_100006185
472 Ga0068857_100061045
473 Ga0068857_100180735
474 Ga0068854_100021395
475 Ga0068854_100063130
476 Ga0068854_100066983
477 Ga0068854_100181209
478 Ga0068856_100548076
479 Ga0068852_100001822
480 Ga0068852_100015269
481 Ga0068852_100033274
482 Ga0068852_100265524
483 Ga0068852_100369145
484 Ga0068859_100033630
485 Ga0068859_100201486
486 Ga0068864_100002309
487 Ga0068864_100003157
488 Ga0068864_100010134
489 Ga0068866_10062190
490 Ga0068866_10076974
491 Ga0068861_100363858
492 Ga0068851_10020093
493 Ga0068851_10048310
494 Ga0068851_10088731
495 Ga0068863_100008753
496 Ga0068863_100014029
497 Ga0068858_100016866
498 Ga0068858_100020431
499 Ga0068860_100115768
500 Ga0068862_100060368
501 Ga0081539_10128831
502 Ga0070717_10146343
503 Ga0075362_10117539
504 Ga0097621_100011743
505 Ga0097621_100025728
506 Ga0097621_100131998
507 Ga0097621_100406458
508 Ga0068871_100003418
509 Ga0068865_100002786
510 Ga0068865_100003011
511 Ga0068865_100064471
512 Ga0097620_100033627
513 Ga0097620_100201498
514 Ga0105240_10052853
515 Ga0105240_10243482
516 Ga0105245_10012462
517 Ga0105245_10088412
518 Ga0105243_10199044
519 Ga0105241_10154871
520 Ga0105242_10003308
521 Ga0105248_10001494
522 Ga0105248_10006331
523 Ga0105248_10161260
524 Ga0105248_10180586
525 Ga0105248_10316452
526 Ga0105237_10027805
527 Ga0105238_10008144
528 Ga0105238_10038697
529 Ga0105249_10647977
530 Ga0105239_10087185
531 Ga0105246_10052609
532 Ga0105246_10505630
533 Ga0157373_10009371
534 Ga0157373_10028733
535 Ga0157373_10071924
536 Ga0157373_10167732
537 Ga0157371_10121181
538 Ga0157371_10126062
539 Ga0157371_10262186
540 Ga0157370_10002132
541 Ga0157369_10010201
542 Ga0157369_10133344
543 Ga0157374_10019892
544 Ga0157374_10082739
545 Ga0157374_10115702
546 Ga0157374_10131984
547 Ga0157378_10009310
548 Ga0157378_10048255
549 Ga0157378_10086697
550 Ga0157378_10317195
551 Ga0163162_10019478
552 Ga0163162_10024015
553 Ga0163162_10032880
554 Ga0163162_10129364
555 Ga0157372_10021307
556 Ga0157372_10221918
557 Ga0157372_10618803
558 Ga0157375_10007721
559 Ga0157375_10018918
560 Ga0157375_10059996
561 Ga0157375_10090337
562 Ga0163163_10002645
563 Ga0163163_10028520
564 Ga0163163_10109588
565 Ga0182008_10088237
566 Ga0157377_10202175
567 Ga0157379_10010111
568 Ga0157376_10002926
569 Ga0207697_10013441
570 Ga0207697_10052158
571 Ga0207682_10020124
572 Ga0207642_10075690
573 Ga0207688_10004520
574 Ga0207647_10001452
575 Ga0207647_10007265
576 Ga0207647_10015410
577 Ga0207643_10022846
578 Ga0207705_10000475
579 Ga0207705_10011041
580 Ga0207705_10205409
581 Ga0207695_10063623
582 Ga0207671_10078157
583 Ga0207660_10154733
584 Ga0207657_10000919
585 Ga0207657_10005161
586 Ga0207657_10005933
587 Ga0207657_10006910
588 Ga0207657_10039871
589 Ga0207657_10121244
590 Ga0207657_10181146
591 Ga0207649_10002717
592 Ga0207649_10022408
593 Ga0207649_10040650
594 Ga0207649_10100025
595 Ga0207694_10046515
596 Ga0207650_10003728
597 Ga0207650_10007235
598 Ga0207650_10176106
599 Ga0207659_10113403
600 Ga0207659_10132070
601 Ga0207687_10004771
602 Ga0207700_10148085
603 Ga0207644_10000522
604 Ga0207644_10000744
605 Ga0207644_10001113
606 Ga0207644_10001832
607 Ga0207644_10140228
608 Ga0207690_10007049
609 Ga0207690_10022770
610 Ga0207690_10023595
611 Ga0207690_10092431
612 Ga0207706_10001627
613 Ga0207706_10001832
614 Ga0207706_10003071
615 Ga0207706_10033298
616 Ga0207706_10057532
617 Ga0207706_10289534
618 Ga0207709_10261299
619 Ga0207669_10016112
620 Ga0207669_10130394
621 Ga0207669_10186247
622 Ga0207704_10007755
623 Ga0207704_10085824
624 Ga0207691_10001381
625 Ga0207691_10001970
626 Ga0207691_10051372
627 Ga0207691_10199652
628 Ga0207711_10004917
629 Ga0207711_10010222
630 Ga0207711_10015974
631 Ga0207711_10244844
632 Ga0207689_10495128
633 Ga0207661_10038477
634 Ga0207679_10013960
635 Ga0207679_10016870
636 Ga0207679_10041905
637 Ga0207679_10205790
638 Ga0207667_10002705
639 Ga0207667_10122628
640 Ga0207651_10212729
641 Ga0207651_10346303
642 Ga0207640_10031644
643 Ga0207640_10061097
644 Ga0207640_10203250
645 Ga0207658_10020918
646 Ga0207658_10061395
647 Ga0207658_10174739
648 Ga0207677_10005869
649 Ga0207677_10044849
650 Ga0207677_10127337
651 Ga0207639_10023082
652 Ga0207639_10159567
653 Ga0207678_10079449
654 Ga0207678_10094600
655 Ga0207678_10304147
656 Ga0207641_10008123
657 Ga0207641_10018468
658 Ga0207641_10065329
659 Ga0207648_10002294
660 Ga0207648_10056491
661 Ga0207648_10193606
662 Ga0207676_10006903
663 Ga0207676_10017039
664 Ga0207676_10037630
665 Ga0207674_10000725
666 Ga0207674_10005100
667 Ga0207674_10005725
668 Ga0207683_10006429
669 Ga0207683_10013889
670 Ga0207683_10024585
671 Ga0207683_10053751
672 Ga0207698_10011182
673 Ga0207698_10022529
674 Ga0207698_10040484
675 Ga0207698_10048912
676 Ga0207698_10165106
677 Ga0268266_10014788
678 Ga0268266_10075571
679 Ga0268265_10083771
680 Ga0307405_10008360
681 Ga0307410_10501772
682 Ga0307416_100000569
683 Ga0307416_100160099
684 Ga0307414_10020146
685 Ga0373937_0254875
686 Ga0395899_0000432
687 Ga0395899_0016019
688 Ga0395899_0030225
689 Ga0395899_0055079
690 Ga0395900_0000432
691 Ga0395900_0001148
692 Ga0395900_0039357
693 Ga0395900_0069601
694 Ga0395900_0088568
695 Ga0395900_0090486
696 Ga0395900_0091093
697 Ga0395900_0094463
698 Ga0395900_0100303
699 Ga0395900_0115288
700 Ga0395900_0197491
701 Ga0395900_0239121
702 Ga0395900_0328462
703 Ga0395898_0000021
704 Ga0395898_0034924
705 Ga0395898_0086129
706 Ga0395898_0111778
707 Ga0395898_0194394
708 Ga0395905_0000413
709 Ga0395905_0000649
710 Ga0395905_0004444
711 Ga0395905_0005169
712 Ga0395905_0017192
713 Ga0395905_0041687
714 Ga0395905_0045062
715 Ga0395905_0047289
716 Ga0395905_0056746
717 Ga0395905_0086870
718 Ga0395905_0102455
719 Ga0395905_0169216
720 Ga0395905_0594611
721 Ga0395901_0000476
722 Ga0395901_0010511
723 Ga0395901_0036122
724 Ga0395901_0076546
725 Ga0395901_0085249
726 Ga0395901_0178303
727 Ga0395901_0259943
728 Ga0395901_0302073
729 Ga0395901_0324837
730 Ga0395901_0330754
731 Ga0439458_0000231
732 Ga0439458_0000814
733 Ga0439458_0038029
734 Ga0466969_0035024
735 Ga0466959_0103248
736 Ga0466967_0294927
737 Ga0495663_0003568
738 Ga0495621_0003418
739 Ga0495677_0001639
740 Ga0496100_0035259
741 Ga0496100_0142320
742 Ga0496101_0009079
743 Ga0496102_0020465
744 Ga0496102_0058000
745 Ga0496106_0444978
746 Ga0496107_0001637
747 Ga0496107_0041492
748 Ga0496107_0060236
749 Ga0496107_0140674
750 Ga0496108_0002271
751 Ga0496108_0115054
752 Ga0496109_0014399
753 Ga0496109_0132111
754 Ga0496109_0143709
755 Ga0496110_0007769
756 Ga0496110_0016392
757 Ga0496110_0064923
758 Ga0496111_0058138
759 Ga0496111_0329983
760 Ga0496112_0010155
761 Ga0496112_0021670
762 Ga0496112_0047822
763 Ga0496113_0002378
764 Ga0496113_0006537
765 Ga0496113_0025766
766 Ga0496113_0042922
767 Ga0496114_0000023
768 Ga0501069_0130466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

57

287

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7484 18 224
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7444 69 224
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6864 18 224
3s04-assembly3.cif.gz_A crystal structure of escherichia coli type i signal peptidase in complex with an arylomycin lipoglycopeptide antibiotic 0.662 18 231
3s04-assembly3.cif.gz_A crystal structure of escherichia coli type i signal peptidase in complex with an arylomycin lipoglycopeptide antibiotic 0.6346 18 231
ID Description Score Start End Superfamily
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7733 14 220 2.10.109.10
4n31B00 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7444 69 224 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7298 18 220 2.10.109.10
af_O74800_20_156_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7267 14 227 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7202 18 220 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A443G007-F1-model_v4 deleted 0.8661 71 221
AF-A0A443G007-F1-model_v4 deleted 0.8413 71 221
AF-A4EYM9-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8403 69 220 GO:0004252
GO:0006465
GO:0016020
AF-A0A6F8Q1V6-F1-model_v4 deleted 0.8379 75 227
AF-A0A7U0SZV8-F1-model_v4 deleted 0.8342 88 201

Map