F429987

General Info

Members Datasets Scaffolds Average Seq Length
384 183 384 352

Family's Representative Sequence

Representative Sequence 3300046475|Ga0495639_0008037|Ga0495639_0008037_2958_4028
Length 356
Sequence MRLCAGLLIFASLAAAQGKKNDESRKPLTLASQGSFFVGGESKTLAAVAGRGGVFGSPGEITINQMYVQFQIPPNGDRHVPVVMVHGCCLSSKTWETTPDGRMGWNEYFVRKDRPVYLADQASRARSGFDPSVISAVKAGTVPPSQLPNVLAATHQTAWSVFRFGPKFGEPFADGQFPIEAVDELYKQMIPDLNATLPNPNPTWKNMAALAVKVNGAVLMGHSESGFFPEQAALADPSAIPSIKGLISIEMPCPELQPAQIAMLAKIPTLVMFGDHLSDIPGGGPANWNASYESCQKFVQQMKDKGGDAEMMYLPKMGIKGNSHMLMQDRNNLQLADLILTWIDGHVESKKAAGKR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.56
Rhizosphere 97.4
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003567 3300001977 Bacteria 2450
2 JGI25406J46586_10018228 3300003203 Bacteria 2888
3 Ga0058862_12708187 3300004803 Bacteria 1885
4 Ga0065714_10095591 3300005288 Bacteria 1783
5 Ga0065712_10000553 3300005290 Bacteria 13550
6 Ga0065715_10007355 3300005293 Bacteria 3830
7 Ga0065715_10181321 3300005293 Bacteria 1474
8 Ga0065707_10120822 3300005295 Bacteria 2124
9 Ga0065707_10121766 3300005295 Bacteria 2103
10 Ga0065707_10150909 3300005295 Bacteria 1655
11 Ga0070676_10004530 3300005328 Bacteria 7317
12 Ga0070676_10019294 3300005328 Bacteria 3792
13 Ga0070676_10031210 3300005328 Bacteria 3044
14 Ga0070690_100017819 3300005330 Bacteria 4280
15 Ga0070690_100082708 3300005330 Bacteria 2102
16 Ga0070690_100256412 3300005330 Bacteria 1239
17 Ga0070670_100010911 3300005331 Bacteria 7759
18 Ga0070670_100013919 3300005331 Bacteria 6898
19 Ga0070670_100014579 3300005331 Bacteria 6750
20 Ga0070677_10003804 3300005333 Bacteria 4889
21 Ga0070677_10019323 3300005333 Bacteria 2466
22 Ga0070677_10019609 3300005333 Bacteria 2453
23 Ga0068869_100022926 3300005334 Bacteria 4306
24 Ga0068869_100124164 3300005334 Bacteria 1978
25 Ga0070666_10009835 3300005335 Bacteria 5971
26 Ga0068868_100017351 3300005338 Bacteria 5361
27 Ga0068868_100098574 3300005338 Bacteria 2363
28 Ga0070660_100082531 3300005339 Bacteria 2524
29 Ga0070689_100010751 3300005340 Bacteria 6536
30 Ga0070689_100084488 3300005340 Bacteria 2495
31 Ga0070661_100006468 3300005344 Bacteria 8078
32 Ga0070661_100044735 3300005344 Bacteria 3235
33 Ga0070668_100055843 3300005347 Plasmid 3049
34 Ga0070669_100031883 3300005353 Bacteria 3807
35 Ga0070669_100148036 3300005353 Bacteria 1815
36 Ga0070669_100281725 3300005353 Unclassified 1332
37 Ga0070675_100000652 3300005354 Bacteria 23995
38 Ga0070675_100008348 3300005354 Bacteria 8036
39 Ga0070675_100022991 3300005354 Bacteria 4981
40 Ga0070675_100032087 3300005354 Bacteria 4248
41 Ga0070675_100058422 3300005354 Bacteria 3181
42 Ga0070675_100062365 3300005354 Bacteria 3080
43 Ga0070675_100077447 3300005354 Bacteria 2768
44 Ga0070675_100085697 3300005354 Unclassified 2632
45 Ga0070671_100004706 3300005355 Bacteria 10841
46 Ga0070671_100025275 3300005355 Unclassified 4872
47 Ga0070671_100073655 3300005355 Bacteria 2853
48 Ga0070671_100140382 3300005355 Bacteria 2039
49 Ga0070674_100002229 3300005356 Bacteria 10665
50 Ga0070674_100092045 3300005356 Unclassified 2191
51 Ga0070673_100003354 3300005364 Bacteria 9956
52 Ga0070673_100004182 3300005364 Bacteria 9105
53 Ga0070673_100011417 3300005364 Bacteria 6059
54 Ga0070673_100056929 3300005364 Bacteria 3087
55 Ga0070673_100068478 3300005364 Bacteria 2842
56 Ga0070673_100240117 3300005364 Unclassified 1575
57 Ga0070688_100020274 3300005365 Bacteria 3863
58 Ga0070688_100031464 3300005365 Bacteria 3192
59 Ga0070667_100012855 3300005367 Bacteria 6917
60 Ga0070667_100025418 3300005367 Unclassified 4923
61 Ga0070701_10055671 3300005438 Unclassified 2067
62 Ga0070705_100125902 3300005440 Unclassified 1663
63 Ga0070700_100187418 3300005441 Unclassified 1444
64 Ga0070694_100072156 3300005444 Bacteria 2381
65 Ga0070663_100283840 3300005455 Bacteria 1320
66 Ga0070678_100071450 3300005456 Bacteria 2598
67 Ga0070678_100236582 3300005456 Bacteria 1525
68 Ga0070678_100270602 3300005456 Bacteria 1432
69 Ga0070662_100024290 3300005457 Unclassified 4174
70 Ga0070681_10003585 3300005458 Bacteria 14558
71 Ga0068867_100001024 3300005459 Bacteria 19120
72 Ga0068867_100249733 3300005459 Bacteria 1442
73 Ga0068867_100314241 3300005459 Bacteria 1296
74 Ga0070685_10003653 3300005466 Bacteria 7804
75 Ga0070685_10037791 3300005466 Bacteria 2736
76 Ga0070685_10126628 3300005466 Unclassified 1592
77 Ga0070707_100005984 3300005468 Bacteria 11346
78 Ga0070699_100004802 3300005518 Bacteria 11943
79 Ga0070684_100063781 3300005535 Bacteria 3231
80 Ga0070684_100087251 3300005535 Bacteria 2770
81 Ga0068853_100438431 3300005539 Unclassified 1227
82 Ga0070672_100017439 3300005543 Bacteria 5168
83 Ga0070672_100034300 3300005543 Bacteria 3851
84 Ga0070672_100081590 3300005543 Unclassified 2593
85 Ga0070672_100125295 3300005543 Bacteria 2106
86 Ga0070686_100036185 3300005544 Plasmid 3055
87 Ga0070696_100127950 3300005546 Unclassified 1845
88 Ga0070665_100059497 3300005548 Bacteria 3830
89 Ga0070704_100041075 3300005549 Bacteria 3190
90 Ga0068855_100006084 3300005563 Bacteria 14714
91 Ga0068855_100011824 3300005563 Bacteria 10552
92 Ga0070664_100000492 3300005564 Bacteria 29880
93 Ga0070664_100024234 3300005564 Bacteria 5018
94 Ga0070664_100029137 3300005564 Bacteria 4601
95 Ga0070664_100034498 3300005564 Bacteria 4245
96 Ga0068857_100224937 3300005577 Bacteria 1715
97 Ga0068854_100144128 3300005578 Bacteria 1831
98 Ga0068856_100008072 3300005614 Bacteria 10275
99 Ga0070702_100195378 3300005615 Bacteria 1335
100 Ga0068859_100046378 3300005617 Unclassified 4364
101 Ga0068859_100066850 3300005617 Bacteria 3629
102 Ga0068859_100067309 3300005617 Bacteria 3616
103 Ga0068859_100116104 3300005617 Bacteria 2741
104 Ga0068864_100002489 3300005618 Bacteria 15223
105 Ga0068864_100046653 3300005618 Bacteria 3718
106 Ga0068864_100060815 3300005618 Unclassified 3270
107 Ga0068864_100290773 3300005618 Unclassified 1528
108 Ga0068866_10007041 3300005718 Bacteria 4700
109 Ga0068863_100005948 3300005841 Bacteria 11971
110 Ga0068863_100026662 3300005841 Bacteria 5510
111 Ga0068858_100023055 3300005842 Bacteria 5806
112 Ga0068858_100034635 3300005842 Bacteria 4684
113 Ga0068858_100047492 3300005842 Unclassified 3979
114 Ga0068858_100050257 3300005842 Bacteria 3858
115 Ga0068858_100057008 3300005842 Bacteria 3610
116 Ga0068860_100002099 3300005843 Bacteria 21005
117 Ga0068860_100022822 3300005843 Bacteria 6051
118 Ga0068860_100039674 3300005843 Bacteria 4504
119 Ga0068860_100098368 3300005843 Bacteria 2790
120 Ga0068860_100309853 3300005843 Unclassified 1548
121 Ga0068862_100003413 3300005844 Bacteria 13698
122 Ga0081539_10000464 3300005985 Bacteria 85930
123 Ga0081539_10001728 3300005985 Bacteria 34898
124 Ga0097621_100011693 3300006237 Bacteria 6478
125 Ga0097621_100026072 3300006237 Bacteria 4582
126 Ga0097621_100140978 3300006237 Unclassified 2060
127 Ga0068871_100051741 3300006358 Bacteria 3326
128 Ga0068871_100068234 3300006358 Bacteria 2919
129 Ga0068871_100100188 3300006358 Bacteria 2426
130 Ga0075428_100032412 3300006844 Bacteria 5772
131 Ga0075428_100063518 3300006844 Unclassified 4042
132 Ga0075428_100258773 3300006844 Bacteria 1874
133 Ga0075430_100019883 3300006846 Bacteria 5713
134 Ga0075431_100007755 3300006847 Bacteria 10691
135 Ga0075431_100195064 3300006847 Bacteria 2074
136 Ga0075433_10002365 3300006852 Bacteria 14336
137 Ga0075433_10003547 3300006852 Bacteria 12039
138 Ga0075433_10004935 3300006852 Bacteria 10447
139 Ga0075433_10097625 3300006852 Bacteria 2600
140 Ga0075433_10104827 3300006852 Bacteria 2505
141 Ga0075433_10223390 3300006852 Unclassified 1673
142 Ga0075434_100000516 3300006871 Bacteria 29363
143 Ga0075434_100004686 3300006871 Bacteria 12358
144 Ga0075434_100008850 3300006871 Bacteria 9370
145 Ga0075434_100052276 3300006871 Bacteria 4059
146 Ga0075434_100066668 3300006871 Bacteria 3586
147 Ga0075434_100417954 3300006871 Bacteria 1362
148 Ga0075429_100068088 3300006880 Bacteria 3098
149 Ga0075429_100233716 3300006880 Bacteria 1610
150 Ga0068865_100009035 3300006881 Bacteria 6165
151 Ga0097620_100046379 3300006931 Unclassified 4364
152 Ga0097620_100066853 3300006931 Bacteria 3629
153 Ga0097620_100067305 3300006931 Bacteria 3616
154 Ga0097620_100116109 3300006931 Bacteria 2741
155 Ga0075435_100013799 3300007076 Bacteria 6022
156 Ga0075435_100084156 3300007076 Bacteria 2616
157 Ga0105240_10009670 3300009093 Bacteria 13626
158 Ga0111539_10000150 3300009094 Bacteria 79163
159 Ga0111539_10041209 3300009094 Bacteria 5553
160 Ga0111539_10069520 3300009094 Bacteria 4158
161 Ga0111539_10075140 3300009094 Bacteria 3981
162 Ga0111539_10153129 3300009094 Unclassified 2699
163 Ga0111539_10320100 3300009094 Bacteria 1805
164 Ga0105245_10018833 3300009098 Bacteria 6040
165 Ga0105245_10071967 3300009098 Bacteria 3140
166 Ga0105245_10102288 3300009098 Bacteria 2653
167 Ga0114129_10000330 3300009147 Bacteria 55300
168 Ga0114129_10049153 3300009147 Bacteria 5927
169 Ga0114129_10145391 3300009147 Bacteria 3248
170 Ga0114129_10209893 3300009147 Bacteria 2633
171 Ga0114129_10364539 3300009147 Bacteria 1911
172 Ga0105243_10016558 3300009148 Bacteria 5575
173 Ga0105241_10092294 3300009174 Unclassified 2390
174 Ga0105248_10000121 3300009177 Bacteria 89807
175 Ga0105248_10002915 3300009177 Bacteria 18984
176 Ga0105248_10004514 3300009177 Bacteria 15398
177 Ga0105248_10064661 3300009177 Unclassified 4107
178 Ga0105248_10082420 3300009177 Bacteria 3617
179 Ga0105248_10214645 3300009177 Bacteria 2167
180 Ga0105238_10005456 3300009551 Bacteria 12564
181 Ga0105238_10174163 3300009551 Bacteria 2128
182 Ga0105249_10022225 3300009553 Bacteria 5681
183 Ga0105249_10382709 3300009553 Bacteria 1433
184 Ga0105239_10059219 3300010375 Bacteria 4203
185 Ga0157370_10002436 3300013104 Bacteria 22439
186 Ga0157369_10006115 3300013105 Bacteria 13970
187 Ga0157374_10050690 3300013296 Unclassified 3860
188 Ga0157378_10007616 3300013297 Bacteria 9452
189 Ga0163162_10000523 3300013306 Bacteria 35637
190 Ga0163162_10008477 3300013306 Bacteria 10030
191 Ga0157372_10344210 3300013307 Bacteria 1737
192 Ga0157375_10001362 3300013308 Bacteria 21089
193 Ga0157375_10002834 3300013308 Bacteria 15010
194 Ga0157375_10215279 3300013308 Bacteria 2079
195 Ga0157375_10561018 3300013308 Bacteria 1303
196 Ga0163163_10001162 3300014325 Bacteria 22395
197 Ga0163163_10011623 3300014325 Bacteria 7998
198 Ga0163163_10027352 3300014325 Bacteria 5462
199 Ga0163163_10246740 3300014325 Unclassified 1836
200 Ga0157380_10001086 3300014326 Bacteria 17488
201 Ga0157380_10017315 3300014326 Bacteria 5331
202 Ga0157380_10181368 3300014326 Bacteria 1850
203 Ga0157380_10192651 3300014326 Bacteria 1801
204 Ga0157377_10050943 3300014745 Bacteria 2334
205 Ga0157379_10000921 3300014968 Bacteria 23764
206 Ga0157379_10030047 3300014968 Bacteria 4833
207 Ga0157379_10090373 3300014968 Bacteria 2747
208 Ga0157379_10298275 3300014968 Bacteria 1468
209 Ga0157376_10506837 3300014969 Bacteria 1187
210 Ga0163161_10023056 3300017792 Bacteria 4386
211 Ga0163161_10055891 3300017792 Bacteria 2866
212 Ga0163161_10145772 3300017792 Unclassified 1796
213 Ga0213875_10022894 3300021388 Bacteria 2987
214 Ga0207697_10006987 3300025315 Bacteria 5062
215 Ga0207697_10085770 3300025315 Bacteria 1330
216 Ga0207682_10001725 3300025893 Bacteria 10019
217 Ga0207682_10005013 3300025893 Bacteria 5431
218 Ga0207682_10011423 3300025893 Bacteria 3467
219 Ga0207642_10024382 3300025899 Bacteria 2432
220 Ga0207688_10005050 3300025901 Bacteria 7180
221 Ga0207688_10208538 3300025901 Bacteria 1173
222 Ga0207680_10235629 3300025903 Bacteria 1259
223 Ga0207645_10003847 3300025907 Bacteria 11235
224 Ga0207645_10015457 3300025907 Bacteria 5068
225 Ga0207645_10154923 3300025907 Unclassified 1497
226 Ga0207645_10233383 3300025907 Unclassified 1215
227 Ga0207643_10035231 3300025908 Bacteria 2805
228 Ga0207643_10058910 3300025908 Bacteria 2190
229 Ga0207643_10198083 3300025908 Bacteria 1222
230 Ga0207654_10004807 3300025911 Bacteria 6841
231 Ga0207654_10056280 3300025911 Bacteria 2281
232 Ga0207707_10010321 3300025912 Bacteria 8103
233 Ga0207707_10194566 3300025912 Unclassified 1769
234 Ga0207695_10016168 3300025913 Bacteria 8750
235 Ga0207662_10002860 3300025918 Bacteria 8738
236 Ga0207662_10039592 3300025918 Bacteria 2766
237 Ga0207657_10050668 3300025919 Bacteria 3612
238 Ga0207649_10047623 3300025920 Bacteria 2640
239 Ga0207652_10117973 3300025921 Bacteria 2358
240 Ga0207681_10032211 3300025923 Bacteria 3431
241 Ga0207681_10089313 3300025923 Bacteria 2197
242 Ga0207681_10239181 3300025923 Bacteria 1412
243 Ga0207681_10299629 3300025923 Unclassified 1271
244 Ga0207650_10000510 3300025925 Bacteria 32441
245 Ga0207650_10015340 3300025925 Bacteria 5334
246 Ga0207650_10033423 3300025925 Bacteria 3725
247 Ga0207650_10287017 3300025925 Bacteria 1341
248 Ga0207659_10004025 3300025926 Bacteria 8869
249 Ga0207659_10008903 3300025926 Bacteria 6255
250 Ga0207659_10010259 3300025926 Bacteria 5879
251 Ga0207659_10030106 3300025926 Unclassified 3705
252 Ga0207659_10035635 3300025926 Bacteria 3441
253 Ga0207659_10066663 3300025926 Bacteria 2613
254 Ga0207687_10005071 3300025927 Bacteria 8720
255 Ga0207664_10106623 3300025929 Unclassified 2323
256 Ga0207644_10064608 3300025931 Bacteria 2659
257 Ga0207644_10070505 3300025931 Bacteria 2555
258 Ga0207706_10028865 3300025933 Bacteria 4952
259 Ga0207709_10003849 3300025935 Bacteria 8792
260 Ga0207670_10032295 3300025936 Bacteria 3365
261 Ga0207670_10193653 3300025936 Bacteria 1540
262 Ga0207669_10088071 3300025937 Bacteria 2012
263 Ga0207704_10002729 3300025938 Bacteria 7958
264 Ga0207704_10173853 3300025938 Bacteria 1548
265 Ga0207691_10012307 3300025940 Bacteria 8202
266 Ga0207691_10074526 3300025940 Bacteria 3061
267 Ga0207691_10084874 3300025940 Unclassified 2842
268 Ga0207711_10014535 3300025941 Bacteria 6543
269 Ga0207711_10122015 3300025941 Unclassified 2327
270 Ga0207711_10190124 3300025941 Bacteria 1871
271 Ga0207689_10003005 3300025942 Bacteria 15556
272 Ga0207661_10082419 3300025944 Bacteria 2659
273 Ga0207679_10007017 3300025945 Bacteria 7138
274 Ga0207679_10036814 3300025945 Bacteria 3474
275 Ga0207679_10121526 3300025945 Bacteria 2080
276 Ga0207667_10026159 3300025949 Bacteria 6380
277 Ga0207651_10017493 3300025960 Bacteria 4239
278 Ga0207651_10020778 3300025960 Unclassified 3971
279 Ga0207651_10052352 3300025960 Bacteria 2783
280 Ga0207651_10118057 3300025960 Unclassified 2006
281 Ga0207651_10185289 3300025960 Bacteria 1655
282 Ga0207712_10029626 3300025961 Bacteria 3674
283 Ga0207677_10030616 3300026023 Unclassified 3438
284 Ga0207677_10039917 3300026023 Bacteria 3090
285 Ga0207703_10046278 3300026035 Unclassified 3504
286 Ga0207703_10073576 3300026035 Bacteria 2827
287 Ga0207703_10167121 3300026035 Bacteria 1932
288 Ga0207703_10194829 3300026035 Bacteria 1797
289 Ga0207639_10410677 3300026041 Unclassified 1222
290 Ga0207678_10147294 3300026067 Bacteria 2009
291 Ga0207708_10043874 3300026075 Bacteria 3408
292 Ga0207708_10049944 3300026075 Bacteria 3185
293 Ga0207702_10014215 3300026078 Bacteria 6611
294 Ga0207702_10055051 3300026078 Bacteria 3373
295 Ga0207641_10001690 3300026088 Bacteria 21462
296 Ga0207641_10039147 3300026088 Unclassified 3964
297 Ga0207648_10000587 3300026089 Bacteria 40789
298 Ga0207648_10383671 3300026089 Bacteria 1271
299 Ga0207676_10010042 3300026095 Bacteria 6734
300 Ga0207676_10242542 3300026095 Unclassified 1617
301 Ga0207676_10269719 3300026095 Bacteria 1541
302 Ga0207674_10195185 3300026116 Bacteria 1974
303 Ga0207674_10217016 3300026116 Bacteria 1861
304 Ga0207675_100037277 3300026118 Bacteria 4536
305 Ga0207675_100265843 3300026118 Bacteria 1663
306 Ga0207683_10009197 3300026121 Bacteria 8419
307 Ga0207683_10031838 3300026121 Bacteria 4579
308 Ga0207683_10129634 3300026121 Bacteria 2268
309 Ga0207683_10305769 3300026121 Bacteria 1455
310 Ga0207698_10041836 3300026142 Bacteria 3419
311 Ga0209974_10019582 3300027876 Bacteria 2244
312 Ga0207428_10002949 3300027907 Bacteria 16836
313 Ga0207428_10011638 3300027907 Bacteria 7764
314 Ga0268265_10054691 3300028380 Bacteria 3030
315 Ga0268265_10105716 3300028380 Bacteria 2285
316 Ga0268264_10038860 3300028381 Unclassified 3929
317 Ga0268264_10187167 3300028381 Bacteria 1884
318 Ga0265338_10180092 3300028800 Bacteria 1612
319 Ga0265314_10000658 3300031711 Bacteria 42283
320 Ga0373934_0005209 3300035086 Bacteria 4810
321 Ga0373934_0055897 3300035086 Bacteria 1569
322 Ga0373954_0004986 3300035118 Bacteria 5734
323 Ga0373955_0089484 3300035172 Bacteria 1752
324 Ga0373937_0016792 3300036401 Bacteria 6508
325 Ga0373937_0039381 3300036401 Bacteria 4307
326 Ga0373937_0082766 3300036401 Bacteria 2969
327 Ga0373937_0186790 3300036401 Bacteria 1947
328 Ga0373925_0506108 3300037068 Bacteria 992
329 Ga0436364_0012709 3300037853 Bacteria 1183
330 Ga0436364_1289035 3300037853 Bacteria 14704
331 Ga0436365_0074144 3300039437 Bacteria 4269
332 Ga0439453_0004309 3300041408 Unclassified 2110
333 Ga0495592_0070037 3300046454 Unclassified 2556
334 Ga0495653_0179184 3300046463 Unclassified 1456
335 Ga0495580_0033745 3300046472 Bacteria 3686
336 Ga0495582_0018631 3300046473 Bacteria 3795
337 Ga0495639_0008037 3300046475 Bacteria 4529
338 Ga0495608_0065470 3300046511 Bacteria 2380
339 Ga0495618_0113503 3300046514 Unclassified 1735
340 Ga0495586_0025868 3300046535 Unclassified 3140
341 Ga0495586_0116667 3300046535 Bacteria 1489
342 Ga0495587_0004553 3300046536 Bacteria 9106
343 Ga0495667_0002263 3300046559 Bacteria 12884
344 Ga0495667_0205962 3300046559 Bacteria 1258
345 Ga0495634_0010869 3300046642 Bacteria 6650
346 Ga0495659_0012790 3300046664 Bacteria 2725
347 Ga0495657_0001304 3300046675 Bacteria 21715
348 Ga0495613_0002244 3300046689 Bacteria 14608
349 Ga0495613_0072175 3300046689 Bacteria 2516
350 Ga0495636_0013778 3300047318 Bacteria 3210
351 Ga0495636_0099847 3300047318 Bacteria 1268
352 Ga0495675_0166136 3300047444 Bacteria 1357
353 Ga0495684_0015676 3300047471 Bacteria 5832
354 Ga0495684_0080840 3300047471 Bacteria 2467
355 Ga0495684_0122376 3300047471 Bacteria 1959
356 Ga0495602_0003418 3300048088 Bacteria 16412
357 Ga0496104_0141903 3300048907 Bacteria 2308
358 Ga0496104_0169574 3300048907 Bacteria 2093
359 Ga0496108_0072818 3300048911 Unclassified 2901
360 Ga0496109_0038753 3300048912 Unclassified 4311
361 Ga0496113_0211757 3300048916 Bacteria 1543
362 Ga0496115_0137182 3300048918 Bacteria 2017
363 nmdc:mga05p37_118806_c1 3300050507 Bacteria 3248
364 nmdc:mga05p37_240839_c1 3300050507 Unclassified 2175
365 nmdc:mga05p37_3762_c1 3300050507 Bacteria 17761
366 nmdc:mga05p37_58924_c1 3300050507 Bacteria 4729
367 nmdc:mga09592_28557_c1 3300050508 Bacteria 4634
368 nmdc:mga09592_43622_c1 3300050508 Bacteria 3773
369 nmdc:mga0qj67_80330_c1 3300050509 Unclassified 2612
370 nmdc:mga06r32_173682_c1 3300050510 Bacteria 2139
371 nmdc:mga06r32_75167_c1 3300050510 Bacteria 3278
372 nmdc:mga08y16_105838_c1 3300050511 Bacteria 2928
373 nmdc:mga08y16_1168_c1 3300050511 Bacteria 25884
374 nmdc:mga08y16_170086_c1 3300050511 Bacteria 2263
375 nmdc:mga08y16_170332_c1 3300050511 Unclassified 2262
376 nmdc:mga08y16_6027_c1 3300050511 Bacteria 12706
377 nmdc:mga08y16_64992_c1 3300050511 Bacteria 3808
378 nmdc:mga0n895_101456_c1 3300050512 Bacteria 2888
379 nmdc:mga0n895_13008_c1 3300050512 Bacteria 7486
380 nmdc:mga0n895_410186_c1 3300050512 Bacteria 1370
381 nmdc:mga0a205_17742_c1 3300050515 Bacteria 6680
382 nmdc:mga0a205_25026_c1 3300050515 Bacteria 5683
383 nmdc:mga0a205_46015_c1 3300050515 Unclassified 4208
384 nmdc:mga0a205_4890_c1 3300050515 Bacteria 12050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0506108 Ga0373925_0506108_16_906 292
2 3300025925 Ga0207650_10033423 Ga0207650_100334233 297
3 3300046559 Ga0495667_0205962 Ga0495667_0205962_10_951 307
4 3300046536 Ga0495587_0004553 Ga0495587_0004553_7713_8684 319
5 3300048088 Ga0495602_0003418 Ga0495602_0003418_1864_2835 319
6 3300005618 Ga0068864_100060815 Ga0068864_1000608155 322
7 3300026095 Ga0207676_10242542 Ga0207676_102425423 322
8 3300047444 Ga0495675_0166136 Ga0495675_0166136_111_1091 322
9 3300009094 Ga0111539_10153129 Ga0111539_101531293 331
10 3300005290 Ga0065712_10000553 Ga0065712_1000055311 332
11 3300005293 Ga0065715_10181321 Ga0065715_101813212 332
12 3300005563 Ga0068855_100006084 Ga0068855_10000608411 332
13 3300005614 Ga0068856_100008072 Ga0068856_10000807210 332
14 3300009093 Ga0105240_10009670 Ga0105240_100096707 332
15 3300013104 Ga0157370_10002436 Ga0157370_1000243610 332
16 3300013105 Ga0157369_10006115 Ga0157369_100061157 332
17 3300013307 Ga0157372_10344210 Ga0157372_103442102 332
18 3300014745 Ga0157377_10050943 Ga0157377_100509433 332
19 3300025913 Ga0207695_10016168 Ga0207695_100161684 332
20 3300025949 Ga0207667_10026159 Ga0207667_100261598 332
21 3300026078 Ga0207702_10014215 Ga0207702_100142154 332
22 3300031711 Ga0265314_10000658 Ga0265314_1000065814 333
23 3300046473 Ga0495582_0018631 Ga0495582_0018631_362_1384 333
24 3300047318 Ga0495636_0099847 Ga0495636_0099847_71_1078 333
25 3300048907 Ga0496104_0169574 Ga0496104_0169574_1060_2073 333
26 3300005354 Ga0070675_100085697 Ga0070675_1000856972 334
27 3300005617 Ga0068859_100116104 Ga0068859_1001161042 334
28 3300006931 Ga0097620_100116109 Ga0097620_1001161092 334
29 3300009147 Ga0114129_10049153 Ga0114129_100491533 334
30 3300025908 Ga0207643_10058910 Ga0207643_100589103 334
31 3300025926 Ga0207659_10008903 Ga0207659_100089038 334
32 3300025936 Ga0207670_10032295 Ga0207670_100322952 334
33 3300050507 nmdc:mga05p37_58924_c1 nmdc:mga05p37_58924_c1_3094_4143 334
34 3300005365 Ga0070688_100020274 Ga0070688_1000202742 335
35 3300005564 Ga0070664_100024234 Ga0070664_1000242344 335
36 3300014326 Ga0157380_10017315 Ga0157380_100173155 335
37 3300021388 Ga0213875_10022894 Ga0213875_100228942 335
38 3300025945 Ga0207679_10036814 Ga0207679_100368144 335
39 3300037853 Ga0436364_1289035 Ga0436364_1289035_9963_10982 335
40 3300039437 Ga0436365_0074144 Ga0436365_0074144_2341_3360 335
41 3300005618 Ga0068864_100046653 Ga0068864_1000466532 336
42 3300026095 Ga0207676_10269719 Ga0207676_102697192 336
43 3300037853 Ga0436364_0012709 Ga0436364_0012709_127_1161 336
44 3300026078 Ga0207702_10055051 Ga0207702_100550512 337
45 3300050512 nmdc:mga0n895_101456_c1 nmdc:mga0n895_101456_c1_593_1618 337
46 3300050515 nmdc:mga0a205_17742_c1 nmdc:mga0a205_17742_c1_3346_4371 337
47 3300005468 Ga0070707_100005984 Ga0070707_1000059842 338
48 3300006847 Ga0075431_100195064 Ga0075431_1001950642 338
49 3300006871 Ga0075434_100066668 Ga0075434_1000666684 338
50 3300013308 Ga0157375_10561018 Ga0157375_105610182 338
51 3300050510 nmdc:mga06r32_173682_c1 nmdc:mga06r32_173682_c1_820_1878 338
52 3300050512 nmdc:mga0n895_410186_c1 nmdc:mga0n895_410186_c1_179_1201 338
53 3300006852 Ga0075433_10003547 Ga0075433_1000354712 340
54 3300006871 Ga0075434_100008850 Ga0075434_1000088508 340
55 3300050512 nmdc:mga0n895_13008_c1 nmdc:mga0n895_13008_c1_4387_5460 340
56 3300050515 nmdc:mga0a205_4890_c1 nmdc:mga0a205_4890_c1_9675_10748 340
57 3300005455 Ga0070663_100283840 Ga0070663_1002838401 341
58 3300009147 Ga0114129_10364539 Ga0114129_103645392 341
59 3300009551 Ga0105238_10174163 Ga0105238_101741631 341
60 3300026067 Ga0207678_10147294 Ga0207678_101472942 341
61 3300006871 Ga0075434_100417954 Ga0075434_1004179542 342
62 3300035118 Ga0373954_0004986 Ga0373954_0004986_3443_4483 342
63 3300036401 Ga0373937_0082766 Ga0373937_0082766_1312_2352 342
64 3300046472 Ga0495580_0033745 Ga0495580_0033745_1967_3034 342
65 3300005546 Ga0070696_100127950 Ga0070696_1001279502 343
66 3300006852 Ga0075433_10104827 Ga0075433_101048274 343
67 3300006852 Ga0075433_10223390 Ga0075433_102233902 343
68 3300025907 Ga0207645_10233383 Ga0207645_102333831 343
69 3300050515 nmdc:mga0a205_25026_c1 nmdc:mga0a205_25026_c1_1260_2306 343
70 3300005458 Ga0070681_10003585 Ga0070681_100035855 344
71 3300006846 Ga0075430_100019883 Ga0075430_1000198835 344
72 3300006847 Ga0075431_100007755 Ga0075431_1000077558 344
73 3300006880 Ga0075429_100068088 Ga0075429_1000680883 344
74 3300009147 Ga0114129_10209893 Ga0114129_102098932 344
75 3300025912 Ga0207707_10010321 Ga0207707_100103213 344
76 3300025921 Ga0207652_10117973 Ga0207652_101179732 344
77 3300035086 Ga0373934_0005209 Ga0373934_0005209_515_1567 344
78 3300035172 Ga0373955_0089484 Ga0373955_0089484_168_1235 344
79 3300036401 Ga0373937_0016792 Ga0373937_0016792_2643_3710 344
80 3300041408 Ga0439453_0004309 Ga0439453_0004309_23_1111 344
81 3300047471 Ga0495684_0015676 Ga0495684_0015676_4650_5702 344
82 3300048907 Ga0496104_0141903 Ga0496104_0141903_798_1850 344
83 3300048918 Ga0496115_0137182 Ga0496115_0137182_585_1637 344
84 3300050508 nmdc:mga09592_28557_c1 nmdc:mga09592_28557_c1_2641_3714 344
85 3300050510 nmdc:mga06r32_75167_c1 nmdc:mga06r32_75167_c1_871_1944 344
86 3300003203 JGI25406J46586_10018228 JGI25406J46586_100182283 345
87 3300004803 Ga0058862_12708187 Ga0058862_127081872 345
88 3300005518 Ga0070699_100004802 Ga0070699_1000048025 345
89 3300005842 Ga0068858_100023055 Ga0068858_1000230555 345
90 3300005843 Ga0068860_100098368 Ga0068860_1000983682 345
91 3300005985 Ga0081539_10000464 Ga0081539_1000046432 345
92 3300005985 Ga0081539_10001728 Ga0081539_1000172813 345
93 3300006852 Ga0075433_10097625 Ga0075433_100976253 345
94 3300014968 Ga0157379_10090373 Ga0157379_100903732 345
95 3300026035 Ga0207703_10194829 Ga0207703_101948292 345
96 3300005288 Ga0065714_10095591 Ga0065714_100955912 346
97 3300005295 Ga0065707_10150909 Ga0065707_101509092 346
98 3300005330 Ga0070690_100082708 Ga0070690_1000827082 346
99 3300005331 Ga0070670_100010911 Ga0070670_1000109112 346
100 3300005333 Ga0070677_10019323 Ga0070677_100193231 346
101 3300005338 Ga0068868_100017351 Ga0068868_1000173514 346
102 3300005340 Ga0070689_100084488 Ga0070689_1000844882 346
103 3300005344 Ga0070661_100044735 Ga0070661_1000447352 346
104 3300005354 Ga0070675_100062365 Ga0070675_1000623653 346
105 3300005355 Ga0070671_100004706 Ga0070671_1000047063 346
106 3300005364 Ga0070673_100068478 Ga0070673_1000684782 346
107 3300005535 Ga0070684_100063781 Ga0070684_1000637813 346
108 3300005564 Ga0070664_100000492 Ga0070664_10000049228 346
109 3300005618 Ga0068864_100002489 Ga0068864_1000024898 346
110 3300005842 Ga0068858_100050257 Ga0068858_1000502573 346
111 3300006358 Ga0068871_100068234 Ga0068871_1000682342 346
112 3300006358 Ga0068871_100100188 Ga0068871_1001001882 346
113 3300009177 Ga0105248_10004514 Ga0105248_1000451413 346
114 3300009553 Ga0105249_10382709 Ga0105249_103827091 346
115 3300013306 Ga0163162_10000523 Ga0163162_100005238 346
116 3300013308 Ga0157375_10002834 Ga0157375_100028348 346
117 3300014325 Ga0163163_10011623 Ga0163163_100116232 346
118 3300014968 Ga0157379_10298275 Ga0157379_102982751 346
119 3300025315 Ga0207697_10085770 Ga0207697_100857701 346
120 3300025907 Ga0207645_10154923 Ga0207645_101549231 346
121 3300025908 Ga0207643_10035231 Ga0207643_100352312 346
122 3300025918 Ga0207662_10039592 Ga0207662_100395923 346
123 3300025923 Ga0207681_10239181 Ga0207681_102391811 346
124 3300025925 Ga0207650_10000510 Ga0207650_100005107 346
125 3300025925 Ga0207650_10287017 Ga0207650_102870171 346
126 3300025931 Ga0207644_10064608 Ga0207644_100646081 346
127 3300025933 Ga0207706_10028865 Ga0207706_100288654 346
128 3300025940 Ga0207691_10074526 Ga0207691_100745262 346
129 3300025960 Ga0207651_10052352 Ga0207651_100523523 346
130 3300026023 Ga0207677_10039917 Ga0207677_100399172 346
131 3300026035 Ga0207703_10073576 Ga0207703_100735762 346
132 3300026095 Ga0207676_10010042 Ga0207676_100100422 346
133 3300035086 Ga0373934_0055897 Ga0373934_0055897_327_1379 346
134 3300036401 Ga0373937_0039381 Ga0373937_0039381_2029_3081 346
135 3300046454 Ga0495592_0070037 Ga0495592_0070037_596_1648 346
136 3300046463 Ga0495653_0179184 Ga0495653_0179184_10_1062 346
137 3300046511 Ga0495608_0065470 Ga0495608_0065470_470_1522 346
138 3300046514 Ga0495618_0113503 Ga0495618_0113503_26_1078 346
139 3300046535 Ga0495586_0025868 Ga0495586_0025868_2034_3086 346
140 3300046535 Ga0495586_0116667 Ga0495586_0116667_313_1359 346
141 3300046559 Ga0495667_0002263 Ga0495667_0002263_641_1693 346
142 3300046675 Ga0495657_0001304 Ga0495657_0001304_4880_5932 346
143 3300046689 Ga0495613_0072175 Ga0495613_0072175_410_1495 346
144 3300047471 Ga0495684_0080840 Ga0495684_0080840_749_1801 346
145 3300005330 Ga0070690_100256412 Ga0070690_1002564121 347
146 3300005334 Ga0068869_100124164 Ga0068869_1001241642 347
147 3300005339 Ga0070660_100082531 Ga0070660_1000825313 347
148 3300005355 Ga0070671_100140382 Ga0070671_1001403823 347
149 3300005459 Ga0068867_100314241 Ga0068867_1003142412 347
150 3300005535 Ga0070684_100087251 Ga0070684_1000872511 347
151 3300005563 Ga0068855_100011824 Ga0068855_1000118242 347
152 3300006237 Ga0097621_100011693 Ga0097621_1000116934 347
153 3300009098 Ga0105245_10018833 Ga0105245_100188333 347
154 3300009098 Ga0105245_10071967 Ga0105245_100719674 347
155 3300009177 Ga0105248_10002915 Ga0105248_1000291522 347
156 3300009551 Ga0105238_10005456 Ga0105238_1000545611 347
157 3300010375 Ga0105239_10059219 Ga0105239_100592195 347
158 3300013297 Ga0157378_10007616 Ga0157378_1000761613 347
159 3300014325 Ga0163163_10027352 Ga0163163_100273525 347
160 3300014969 Ga0157376_10506837 Ga0157376_105068371 347
161 3300017792 Ga0163161_10055891 Ga0163161_100558912 347
162 3300025901 Ga0207688_10208538 Ga0207688_102085381 347
163 3300025911 Ga0207654_10004807 Ga0207654_1000480710 347
164 3300025911 Ga0207654_10056280 Ga0207654_100562802 347
165 3300025919 Ga0207657_10050668 Ga0207657_100506683 347
166 3300025927 Ga0207687_10005071 Ga0207687_100050713 347
167 3300025944 Ga0207661_10082419 Ga0207661_100824194 347
168 3300026089 Ga0207648_10383671 Ga0207648_103836711 347
169 3300026116 Ga0207674_10217016 Ga0207674_102170162 347
170 3300026118 Ga0207675_100265843 Ga0207675_1002658432 347
171 3300026142 Ga0207698_10041836 Ga0207698_100418363 347
172 3300050511 nmdc:mga08y16_6027_c1 nmdc:mga08y16_6027_c1_3040_4101 347
173 3300005328 Ga0070676_10004530 Ga0070676_100045302 348
174 3300005333 Ga0070677_10019609 Ga0070677_100196093 348
175 3300005354 Ga0070675_100008348 Ga0070675_1000083486 348
176 3300005354 Ga0070675_100022991 Ga0070675_1000229914 348
177 3300005354 Ga0070675_100058422 Ga0070675_1000584222 348
178 3300005356 Ga0070674_100092045 Ga0070674_1000920452 348
179 3300005364 Ga0070673_100003354 Ga0070673_1000033547 348
180 3300005364 Ga0070673_100056929 Ga0070673_1000569294 348
181 3300005364 Ga0070673_100240117 Ga0070673_1002401172 348
182 3300005440 Ga0070705_100125902 Ga0070705_1001259022 348
183 3300005456 Ga0070678_100270602 Ga0070678_1002706022 348
184 3300005459 Ga0068867_100001024 Ga0068867_1000010248 348
185 3300005543 Ga0070672_100125295 Ga0070672_1001252952 348
186 3300005578 Ga0068854_100144128 Ga0068854_1001441282 348
187 3300005617 Ga0068859_100066850 Ga0068859_1000668504 348
188 3300005618 Ga0068864_100290773 Ga0068864_1002907731 348
189 3300005718 Ga0068866_10007041 Ga0068866_100070415 348
190 3300005842 Ga0068858_100057008 Ga0068858_1000570084 348
191 3300005843 Ga0068860_100039674 Ga0068860_1000396742 348
192 3300005843 Ga0068860_100309853 Ga0068860_1003098532 348
193 3300006881 Ga0068865_100009035 Ga0068865_1000090354 348
194 3300006931 Ga0097620_100066853 Ga0097620_1000668533 348
195 3300009148 Ga0105243_10016558 Ga0105243_100165581 348
196 3300009174 Ga0105241_10092294 Ga0105241_100922942 348
197 3300014326 Ga0157380_10181368 Ga0157380_101813682 348
198 3300025893 Ga0207682_10011423 Ga0207682_100114232 348
199 3300025899 Ga0207642_10024382 Ga0207642_100243822 348
200 3300025907 Ga0207645_10003847 Ga0207645_100038478 348
201 3300025908 Ga0207643_10198083 Ga0207643_101980831 348
202 3300025912 Ga0207707_10194566 Ga0207707_101945662 348
203 3300025923 Ga0207681_10032211 Ga0207681_100322113 348
204 3300025926 Ga0207659_10004025 Ga0207659_100040252 348
205 3300025926 Ga0207659_10066663 Ga0207659_100666633 348
206 3300025929 Ga0207664_10106623 Ga0207664_101066232 348
207 3300025935 Ga0207709_10003849 Ga0207709_100038493 348
208 3300025938 Ga0207704_10002729 Ga0207704_100027296 348
209 3300025960 Ga0207651_10017493 Ga0207651_100174934 348
210 3300025960 Ga0207651_10118057 Ga0207651_101180573 348
211 3300026035 Ga0207703_10167121 Ga0207703_101671212 348
212 3300026089 Ga0207648_10000587 Ga0207648_1000058729 348
213 3300026116 Ga0207674_10195185 Ga0207674_101951852 348
214 3300026118 Ga0207675_100037277 Ga0207675_1000372771 348
215 3300026121 Ga0207683_10031838 Ga0207683_100318382 348
216 3300026121 Ga0207683_10305769 Ga0207683_103057692 348
217 3300028381 Ga0268264_10187167 Ga0268264_101871672 348
218 3300028800 Ga0265338_10180092 Ga0265338_101800922 348
219 3300046475 Ga0495639_0008037 Ga0495639_0008037_2958_4028 348
220 3300046642 Ga0495634_0010869 Ga0495634_0010869_2794_3864 348
221 3300046664 Ga0495659_0012790 Ga0495659_0012790_1614_2660 348
222 3300047318 Ga0495636_0013778 Ga0495636_0013778_1463_2521 348
223 3300005331 Ga0070670_100013919 Ga0070670_1000139194 349
224 3300005355 Ga0070671_100073655 Ga0070671_1000736552 349
225 3300005459 Ga0068867_100249733 Ga0068867_1002497331 349
226 3300005543 Ga0070672_100034300 Ga0070672_1000343003 349
227 3300005564 Ga0070664_100034498 Ga0070664_1000344983 349
228 3300005577 Ga0068857_100224937 Ga0068857_1002249371 349
229 3300005615 Ga0070702_100195378 Ga0070702_1001953781 349
230 3300014325 Ga0163163_10001162 Ga0163163_100011626 349
231 3300025925 Ga0207650_10015340 Ga0207650_100153402 349
232 3300025945 Ga0207679_10121526 Ga0207679_101215262 349
233 3300027876 Ga0209974_10019582 Ga0209974_100195822 349
234 3300036401 Ga0373937_0186790 Ga0373937_0186790_558_1619 349
235 3300046689 Ga0495613_0002244 Ga0495613_0002244_10295_11356 349
236 3300047471 Ga0495684_0122376 Ga0495684_0122376_534_1595 349
237 3300009094 Ga0111539_10000150 Ga0111539_1000015067 350
238 3300025931 Ga0207644_10070505 Ga0207644_100705053 350
239 3300027907 Ga0207428_10011638 Ga0207428_100116388 350
240 3300050511 nmdc:mga08y16_1168_c1 nmdc:mga08y16_1168_c1_5462_6529 350
241 3300006852 Ga0075433_10002365 Ga0075433_1000236511 351
242 3300006871 Ga0075434_100000516 Ga0075434_10000051630 351
243 3300007076 Ga0075435_100013799 Ga0075435_1000137994 351
244 3300009147 Ga0114129_10145391 Ga0114129_101453911 351
245 3300026075 Ga0207708_10043874 Ga0207708_100438741 351
246 3300050507 nmdc:mga05p37_118806_c1 nmdc:mga05p37_118806_c1_2024_3115 351
247 3300005353 Ga0070669_100148036 Ga0070669_1001480362 352
248 3300005354 Ga0070675_100077447 Ga0070675_1000774473 352
249 3300009094 Ga0111539_10041209 Ga0111539_100412094 352
250 3300009177 Ga0105248_10064661 Ga0105248_100646612 352
251 3300025936 Ga0207670_10193653 Ga0207670_101936532 352
252 3300025941 Ga0207711_10190124 Ga0207711_101901242 352
253 3300006844 Ga0075428_100258773 Ga0075428_1002587732 353
254 3300006880 Ga0075429_100233716 Ga0075429_1002337162 353
255 3300027907 Ga0207428_10002949 Ga0207428_1000294913 353
256 3300005328 Ga0070676_10031210 Ga0070676_100312103 354
257 3300005331 Ga0070670_100014579 Ga0070670_1000145795 354
258 3300005333 Ga0070677_10003804 Ga0070677_100038044 354
259 3300005354 Ga0070675_100032087 Ga0070675_1000320872 354
260 3300005356 Ga0070674_100002229 Ga0070674_1000022296 354
261 3300005456 Ga0070678_100236582 Ga0070678_1002365821 354
262 3300005466 Ga0070685_10037791 Ga0070685_100377912 354
263 3300006844 Ga0075428_100032412 Ga0075428_1000324126 354
264 3300006844 Ga0075428_100063518 Ga0075428_1000635182 354
265 3300009177 Ga0105248_10214645 Ga0105248_102146452 354
266 3300014326 Ga0157380_10001086 Ga0157380_100010863 354
267 3300014326 Ga0157380_10192651 Ga0157380_101926511 354
268 3300025893 Ga0207682_10005013 Ga0207682_100050133 354
269 3300025903 Ga0207680_10235629 Ga0207680_102356291 354
270 3300025926 Ga0207659_10035635 Ga0207659_100356352 354
271 3300025937 Ga0207669_10088071 Ga0207669_100880712 354
272 3300025938 Ga0207704_10173853 Ga0207704_101738532 354
273 3300025960 Ga0207651_10185289 Ga0207651_101852892 354
274 3300026121 Ga0207683_10129634 Ga0207683_101296343 354
275 3300050507 nmdc:mga05p37_240839_c1 nmdc:mga05p37_240839_c1_1033_2109 354
276 3300050508 nmdc:mga09592_43622_c1 nmdc:mga09592_43622_c1_1614_2690 354
277 3300050509 nmdc:mga0qj67_80330_c1 nmdc:mga0qj67_80330_c1_1000_2076 354
278 3300050511 nmdc:mga08y16_170332_c1 nmdc:mga08y16_170332_c1_1106_2182 354
279 3300050511 nmdc:mga08y16_64992_c1 nmdc:mga08y16_64992_c1_1572_2642 354
280 3300005353 Ga0070669_100281725 Ga0070669_1002817251 355
281 3300005354 Ga0070675_100000652 Ga0070675_1000006522 355
282 3300005364 Ga0070673_100011417 Ga0070673_1000114171 355
283 3300005367 Ga0070667_100025418 Ga0070667_1000254183 355
284 3300005466 Ga0070685_10126628 Ga0070685_101266281 355
285 3300005543 Ga0070672_100081590 Ga0070672_1000815902 355
286 3300005617 Ga0068859_100046378 Ga0068859_1000463783 355
287 3300005841 Ga0068863_100005948 Ga0068863_1000059489 355
288 3300005842 Ga0068858_100047492 Ga0068858_1000474923 355
289 3300005843 Ga0068860_100002099 Ga0068860_10000209917 355
290 3300006237 Ga0097621_100140978 Ga0097621_1001409782 355
291 3300006871 Ga0075434_100004686 Ga0075434_1000046864 355
292 3300006931 Ga0097620_100046379 Ga0097620_1000463793 355
293 3300009094 Ga0111539_10320100 Ga0111539_103201002 355
294 3300009147 Ga0114129_10000330 Ga0114129_1000033031 355
295 3300009177 Ga0105248_10000121 Ga0105248_100001212 355
296 3300013296 Ga0157374_10050690 Ga0157374_100506903 355
297 3300013306 Ga0163162_10008477 Ga0163162_100084777 355
298 3300013308 Ga0157375_10001362 Ga0157375_1000136216 355
299 3300014325 Ga0163163_10246740 Ga0163163_102467401 355
300 3300014968 Ga0157379_10000921 Ga0157379_100009215 355
301 3300017792 Ga0163161_10145772 Ga0163161_101457721 355
302 3300025926 Ga0207659_10010259 Ga0207659_100102594 355
303 3300025940 Ga0207691_10084874 Ga0207691_100848743 355
304 3300025941 Ga0207711_10014535 Ga0207711_100145356 355
305 3300025960 Ga0207651_10020778 Ga0207651_100207782 355
306 3300026035 Ga0207703_10046278 Ga0207703_100462782 355
307 3300026088 Ga0207641_10001690 Ga0207641_100016905 355
308 3300028381 Ga0268264_10038860 Ga0268264_100388602 355
309 3300050507 nmdc:mga05p37_3762_c1 nmdc:mga05p37_3762_c1_4157_5254 355
310 3300050511 nmdc:mga08y16_170086_c1 nmdc:mga08y16_170086_c1_79_1176 355
311 3300050515 nmdc:mga0a205_46015_c1 nmdc:mga0a205_46015_c1_1650_2747 355
312 3300005295 Ga0065707_10120822 Ga0065707_101208222 356
313 3300025923 Ga0207681_10089313 Ga0207681_100893132 356
314 3300001977 JGI24746J21847_1003567 JGI24746J21847_10035673 357
315 3300005293 Ga0065715_10007355 Ga0065715_100073554 357
316 3300005295 Ga0065707_10121766 Ga0065707_101217663 357
317 3300005328 Ga0070676_10019294 Ga0070676_100192944 357
318 3300005330 Ga0070690_100017819 Ga0070690_1000178191 357
319 3300005334 Ga0068869_100022926 Ga0068869_1000229263 357
320 3300005335 Ga0070666_10009835 Ga0070666_100098353 357
321 3300005338 Ga0068868_100098574 Ga0068868_1000985743 357
322 3300005340 Ga0070689_100010751 Ga0070689_1000107514 357
323 3300005344 Ga0070661_100006468 Ga0070661_1000064683 357
324 3300005347 Ga0070668_100055843 Ga0070668_1000558433 357
325 3300005353 Ga0070669_100031883 Ga0070669_1000318834 357
326 3300005355 Ga0070671_100025275 Ga0070671_1000252754 357
327 3300005364 Ga0070673_100004182 Ga0070673_1000041826 357
328 3300005365 Ga0070688_100031464 Ga0070688_1000314643 357
329 3300005367 Ga0070667_100012855 Ga0070667_1000128553 357
330 3300005438 Ga0070701_10055671 Ga0070701_100556712 357
331 3300005441 Ga0070700_100187418 Ga0070700_1001874182 357
332 3300005444 Ga0070694_100072156 Ga0070694_1000721562 357
333 3300005456 Ga0070678_100071450 Ga0070678_1000714503 357
334 3300005457 Ga0070662_100024290 Ga0070662_1000242902 357
335 3300005466 Ga0070685_10003653 Ga0070685_100036531 357
336 3300005539 Ga0068853_100438431 Ga0068853_1004384311 357
337 3300005543 Ga0070672_100017439 Ga0070672_1000174393 357
338 3300005544 Ga0070686_100036185 Ga0070686_1000361853 357
339 3300005548 Ga0070665_100059497 Ga0070665_1000594974 357
340 3300005549 Ga0070704_100041075 Ga0070704_1000410752 357
341 3300005564 Ga0070664_100029137 Ga0070664_1000291374 357
342 3300005617 Ga0068859_100067309 Ga0068859_1000673092 357
343 3300005841 Ga0068863_100026662 Ga0068863_1000266622 357
344 3300005842 Ga0068858_100034635 Ga0068858_1000346351 357
345 3300005843 Ga0068860_100022822 Ga0068860_1000228224 357
346 3300005844 Ga0068862_100003413 Ga0068862_1000034135 357
347 3300006237 Ga0097621_100026072 Ga0097621_1000260724 357
348 3300006358 Ga0068871_100051741 Ga0068871_1000517412 357
349 3300006852 Ga0075433_10004935 Ga0075433_100049359 357
350 3300006871 Ga0075434_100052276 Ga0075434_1000522764 357
351 3300006931 Ga0097620_100067305 Ga0097620_1000673052 357
352 3300007076 Ga0075435_100084156 Ga0075435_1000841563 357
353 3300009094 Ga0111539_10069520 Ga0111539_100695203 357
354 3300009094 Ga0111539_10075140 Ga0111539_100751404 357
355 3300009098 Ga0105245_10102288 Ga0105245_101022883 357
356 3300009177 Ga0105248_10082420 Ga0105248_100824204 357
357 3300009553 Ga0105249_10022225 Ga0105249_100222255 357
358 3300013308 Ga0157375_10215279 Ga0157375_102152791 357
359 3300014968 Ga0157379_10030047 Ga0157379_100300474 357
360 3300017792 Ga0163161_10023056 Ga0163161_100230562 357
361 3300025315 Ga0207697_10006987 Ga0207697_100069873 357
362 3300025893 Ga0207682_10001725 Ga0207682_100017252 357
363 3300025901 Ga0207688_10005050 Ga0207688_100050504 357
364 3300025907 Ga0207645_10015457 Ga0207645_100154574 357
365 3300025918 Ga0207662_10002860 Ga0207662_100028606 357
366 3300025920 Ga0207649_10047623 Ga0207649_100476233 357
367 3300025923 Ga0207681_10299629 Ga0207681_102996291 357
368 3300025926 Ga0207659_10030106 Ga0207659_100301061 357
369 3300025940 Ga0207691_10012307 Ga0207691_100123074 357
370 3300025941 Ga0207711_10122015 Ga0207711_101220152 357
371 3300025942 Ga0207689_10003005 Ga0207689_1000300510 357
372 3300025945 Ga0207679_10007017 Ga0207679_100070173 357
373 3300025961 Ga0207712_10029626 Ga0207712_100296264 357
374 3300026023 Ga0207677_10030616 Ga0207677_100306164 357
375 3300026041 Ga0207639_10410677 Ga0207639_104106771 357
376 3300026075 Ga0207708_10049944 Ga0207708_100499442 357
377 3300026088 Ga0207641_10039147 Ga0207641_100391474 357
378 3300026121 Ga0207683_10009197 Ga0207683_100091971 357
379 3300028380 Ga0268265_10054691 Ga0268265_100546913 357
380 3300028380 Ga0268265_10105716 Ga0268265_101057162 357
381 3300048911 Ga0496108_0072818 Ga0496108_0072818_344_1417 357
382 3300048912 Ga0496109_0038753 Ga0496109_0038753_895_1968 357
383 3300048916 Ga0496113_0211757 Ga0496113_0211757_431_1504 357
384 3300050511 nmdc:mga08y16_105838_c1 nmdc:mga08y16_105838_c1_1160_2236 357

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wkw-assembly1.cif.gz_B alcaligenes esterase complexed with product analogue 0.8035 32 348
2wkw-assembly1.cif.gz_B alcaligenes esterase complexed with product analogue 0.7915 32 348
7yd2-assembly1.cif.gz_B sule_p44r_s209a 0.7134 32 347
4q34-assembly1.cif.gz_A-2 crystal structure of a putative esterase (bdi_1566) from parabacteroides distasonis atcc 8503 at 1.60 a resolution 0.7108 32 347
8goy-assembly1.cif.gz_B sule p44r 0.7089 33 347
ID Description Score Start End Superfamily
2wkwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8045 32 348 3.40.50.1820
2wkwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7926 32 348 3.40.50.1820
af_Q7T387_10_213_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7001 71 346 3.40.50.1820
4q34A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6962 32 347 3.40.50.1820
4q34A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6879 32 347 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1V3IMU4-F1-model_v4 Alpha/beta hydrolase 0.8737 256 346
AF-A0A2G4KAC5-F1-model_v4 Uncharacterized protein 0.8734 237 357
AF-A0A537BQV8-F1-model_v4 Esterase 0.8692 221 347
AF-A0A845KIE6-F1-model_v4 deleted 0.8589 238 346
AF-K1T2T6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.8344 238 347

Feature Viewer

pLDDT pTM Quality
70.94 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map