F430191

General Info

Members Datasets Scaffolds Average Seq Length
385 192 770 427

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10113055|Ga0157373_101130551
Length 478
Sequence LEFGILNLKFKLIDMAIKVVIVGAGFAGLRLARKLNNKAGFEVLLIDKFNYHQFQPLFYQVATAALDASNISFPLRKAFHNSKNVRIRVEEVKQIVPEQNKIITESEALGYDILVLAMGADTNFFGNQNLTANAFPMKSTVEALQIRHRLVQNFEDALLAKDPLEYQKLMNIVITGGGPTGVEVAGALADMKRYVLPKDYPEHDFSKMNIYLLEGGPRTLGPMSEKSSEDSCRYLTKMGVTIMTNSLVKDYDGEQVLLGDGKTIPTKMVIWAAGIKGNVPEGIDKSLIVRGNRIKVDRHCKVEGTDNVYVLGDLAYMETQKYPKGHPQVASVAIAQADVLAKNLRLMESKSNRIYEFEYHDKGSMATVGRNLAVVDIPKPKLHFNGFFAWFIWMSLHLFLILGVKNKLMTFINWIYNYFTYDQNLRLIFKEFYRPKKSAPAVQSSQPEARPSQDRLPVKPVEQKNDDDDLRQAASFNR

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
172 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
173 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
174 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
189 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
190 2818991444 Filimonas endophytica 3197 Isolate Unclassified
191 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
192 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 0.52
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10113055 3300013100 Bacteria 1908
2 JGI24744J21845_10002642 3300002077 Bacteria 3657
3 rootL2_10340936 3300003322 Bacteria 2722
4 Ga0065704_10132426 3300005289 Bacteria 1613
5 Ga0065712_10127910 3300005290 Unclassified 1585
6 Ga0070676_10002090 3300005328 Bacteria 10157
7 Ga0070676_10029292 3300005328 Unclassified 3131
8 Ga0070683_100028042 3300005329 Bacteria 5085
9 Ga0070670_100072136 3300005331 Bacteria 2965
10 Ga0070670_100283406 3300005331 Unclassified 1447
11 Ga0068869_100053707 3300005334 Unclassified 2930
12 Ga0068869_100104319 3300005334 Bacteria 2149
13 Ga0070666_10000042 3300005335 Bacteria 112296
14 Ga0070666_10032628 3300005335 Bacteria 3441
15 Ga0070680_100027225 3300005336 Bacteria 4578
16 Ga0070682_100000124 3300005337 Bacteria 67529
17 Ga0068868_100002150 3300005338 Bacteria 13616
18 Ga0068868_100129699 3300005338 Bacteria 2062
19 Ga0068868_100186210 3300005338 Bacteria 1725
20 Ga0070661_100005681 3300005344 Bacteria 8592
21 Ga0070661_100122703 3300005344 Bacteria 1947
22 Ga0070668_100087609 3300005347 Unclassified 2450
23 Ga0070675_100165197 3300005354 Bacteria 1906
24 Ga0070671_100001926 3300005355 Bacteria 15908
25 Ga0070671_100013574 3300005355 Bacteria 6569
26 Ga0070674_100016436 3300005356 Bacteria 4637
27 Ga0070673_100263036 3300005364 Unclassified 1508
28 Ga0070659_100006626 3300005366 Bacteria 8368
29 Ga0070667_100001632 3300005367 Bacteria 20064
30 Ga0070667_100005157 3300005367 Bacteria 10931
31 Ga0070667_100026373 3300005367 Bacteria 4834
32 Ga0070667_100028621 3300005367 Bacteria 4639
33 Ga0070667_100111976 3300005367 Bacteria 2367
34 Ga0070667_100145211 3300005367 Bacteria 2080
35 Ga0070667_100205942 3300005367 Bacteria 1747
36 Ga0070663_100028012 3300005455 Bacteria 3831
37 Ga0070678_100017614 3300005456 Bacteria 4607
38 Ga0070678_100074018 3300005456 Bacteria 2558
39 Ga0070678_100156535 3300005456 Bacteria 1841
40 Ga0070662_100007916 3300005457 Bacteria 6910
41 Ga0070681_10140701 3300005458 Unclassified 2343
42 Ga0068867_100019440 3300005459 Bacteria 4840
43 Ga0068867_100057514 3300005459 Bacteria 2880
44 Ga0070685_10036760 3300005466 Bacteria 2770
45 Ga0070698_100001722 3300005471 Bacteria 24392
46 Ga0070698_100038718 3300005471 Bacteria 4912
47 Ga0070679_100005964 3300005530 Bacteria 11323
48 Ga0070679_100157394 3300005530 Unclassified 2246
49 Ga0070684_100002706 3300005535 Bacteria 13093
50 Ga0070684_100004020 3300005535 Bacteria 11128
51 Ga0070684_100023094 3300005535 Bacteria 5194
52 Ga0070684_100059698 3300005535 Bacteria 3335
53 Ga0070684_100184866 3300005535 Bacteria 1895
54 Ga0068853_100011059 3300005539 Bacteria 7320
55 Ga0068853_100134922 3300005539 Bacteria 2212
56 Ga0070665_100011209 3300005548 Bacteria 9064
57 Ga0068855_100106339 3300005563 Bacteria 3225
58 Ga0068855_100290164 3300005563 Bacteria 1814
59 Ga0068855_100430569 3300005563 Bacteria 1442
60 Ga0070664_100003473 3300005564 Bacteria 12721
61 Ga0070664_100097612 3300005564 Bacteria 2551
62 Ga0070664_100168742 3300005564 Bacteria 1940
63 Ga0068857_100001120 3300005577 Bacteria 20847
64 Ga0068857_100042981 3300005577 Bacteria 4009
65 Ga0068857_100051539 3300005577 Bacteria 3652
66 Ga0068857_100105244 3300005577 Bacteria 2533
67 Ga0068854_100009879 3300005578 Bacteria 6172
68 Ga0068854_100050648 3300005578 Bacteria 2973
69 Ga0068854_100150288 3300005578 Bacteria 1795
70 Ga0068856_100071023 3300005614 Bacteria 3446
71 Ga0068856_100076222 3300005614 Bacteria 3323
72 Ga0068852_100001468 3300005616 Bacteria 15943
73 Ga0068852_100029345 3300005616 Bacteria 4518
74 Ga0068852_100051305 3300005616 Bacteria 3539
75 Ga0068852_100086593 3300005616 Bacteria 2793
76 Ga0068852_100304484 3300005616 Bacteria 1543
77 Ga0068859_100000200 3300005617 Bacteria 58644
78 Ga0068859_100053343 3300005617 Bacteria 4067
79 Ga0068859_100091525 3300005617 Bacteria 3092
80 Ga0068859_100397716 3300005617 Bacteria 1473
81 Ga0068864_100016496 3300005618 Bacteria 6147
82 Ga0068864_100034372 3300005618 Bacteria 4312
83 Ga0068864_100123494 3300005618 Unclassified 2318
84 Ga0068864_100135122 3300005618 Bacteria 2220
85 Ga0068851_10012528 3300005834 Unclassified 3999
86 Ga0068863_100028336 3300005841 Bacteria 5347
87 Ga0068863_100030624 3300005841 Bacteria 5137
88 Ga0068863_100042277 3300005841 Bacteria 4330
89 Ga0068863_100096507 3300005841 Unclassified 2806
90 Ga0068858_100133394 3300005842 Bacteria 2329
91 Ga0068860_100000855 3300005843 Bacteria 33982
92 Ga0068860_100009032 3300005843 Bacteria 9922
93 Ga0068860_100009630 3300005843 Bacteria 9601
94 Ga0068860_100019426 3300005843 Bacteria 6590
95 Ga0068860_100085362 3300005843 Unclassified 3004
96 Ga0068860_100141415 3300005843 Bacteria 2313
97 Ga0068862_100025450 3300005844 Bacteria 4969
98 Ga0081539_10036867 3300005985 Bacteria 2919
99 Ga0070715_10040430 3300006163 Bacteria 1949
100 Ga0070715_10052008 3300006163 Bacteria 1766
101 Ga0075366_10005879 3300006195 Bacteria 6672
102 Ga0097621_100001776 3300006237 Bacteria 14790
103 Ga0097621_100002030 3300006237 Bacteria 13854
104 Ga0097621_100138344 3300006237 Bacteria 2079
105 Ga0097621_100282420 3300006237 Bacteria 1461
106 Ga0068871_100000063 3300006358 Bacteria 58377
107 Ga0068871_100011416 3300006358 Bacteria 6515
108 Ga0068871_100017181 3300006358 Bacteria 5469
109 Ga0068871_100117165 3300006358 Bacteria 2246
110 Ga0068871_100128299 3300006358 Bacteria 2148
111 Ga0075428_100006924 3300006844 Bacteria 12593
112 Ga0075428_100016828 3300006844 Bacteria 8075
113 Ga0075430_100155589 3300006846 Unclassified 1903
114 Ga0075431_100057528 3300006847 Unclassified 4010
115 Ga0075429_100011429 3300006880 Bacteria 7692
116 Ga0068865_100002013 3300006881 Bacteria 11995
117 Ga0068865_100170139 3300006881 Bacteria 1670
118 Ga0097620_100000200 3300006931 Bacteria 58644
119 Ga0097620_100053343 3300006931 Bacteria 4067
120 Ga0097620_100091528 3300006931 Bacteria 3092
121 Ga0097620_100397733 3300006931 Bacteria 1473
122 Ga0105240_10000037 3300009093 Bacteria 270462
123 Ga0105240_10190363 3300009093 Unclassified 2413
124 Ga0105245_10058466 3300009098 Bacteria 3470
125 Ga0105245_10081101 3300009098 Bacteria 2965
126 Ga0105247_10003739 3300009101 Bacteria 9872
127 Ga0105247_10004596 3300009101 Bacteria 8799
128 Ga0114129_10081161 3300009147 Bacteria 4508
129 Ga0105241_10008352 3300009174 Bacteria 7625
130 Ga0105241_10026934 3300009174 Bacteria 4279
131 Ga0105241_10110185 3300009174 Bacteria 2202
132 Ga0105242_10002236 3300009176 Bacteria 15267
133 Ga0105242_10033141 3300009176 Bacteria 4135
134 Ga0105237_10032263 3300009545 Bacteria 5303
135 Ga0105237_10075501 3300009545 Bacteria 3362
136 Ga0105237_10092000 3300009545 Bacteria 3023
137 Ga0105237_10246844 3300009545 Bacteria 1787
138 Ga0105249_10010845 3300009553 Bacteria 8007
139 Ga0105249_10040315 3300009553 Bacteria 4241
140 Ga0105249_10046190 3300009553 Bacteria 3963
141 Ga0105239_10005001 3300010375 Bacteria 15651
142 Ga0105239_10060996 3300010375 Bacteria 4139
143 Ga0105239_10121771 3300010375 Bacteria 2898
144 Ga0105246_10011283 3300011119 Bacteria 5544
145 Ga0105246_10102153 3300011119 Bacteria 2090
146 Ga0157373_10015569 3300013100 Bacteria 5559
147 Ga0157373_10080696 3300013100 Bacteria 2294
148 Ga0157371_10029224 3300013102 Unclassified 3989
149 Ga0157371_10042128 3300013102 Unclassified 3255
150 Ga0157371_10046424 3300013102 Bacteria 3089
151 Ga0157369_10071352 3300013105 Bacteria 3729
152 Ga0157369_10267329 3300013105 Unclassified 1783
153 Ga0157374_10075460 3300013296 Bacteria 3186
154 Ga0157374_10145703 3300013296 Bacteria 2300
155 Ga0157374_10161759 3300013296 Bacteria 2180
156 Ga0157378_10007682 3300013297 Bacteria 9409
157 Ga0157378_10010308 3300013297 Bacteria 8159
158 Ga0157378_10037371 3300013297 Bacteria 4300
159 Ga0157378_10044230 3300013297 Unclassified 3954
160 Ga0157378_10051544 3300013297 Bacteria 3662
161 Ga0157378_10079881 3300013297 Bacteria 2954
162 Ga0157378_10133515 3300013297 Unclassified 2300
163 Ga0157378_10257480 3300013297 Bacteria 1673
164 Ga0163162_10002273 3300013306 Bacteria 18036
165 Ga0163162_10004720 3300013306 Bacteria 13145
166 Ga0163162_10005320 3300013306 Bacteria 12421
167 Ga0163162_10005904 3300013306 Bacteria 11844
168 Ga0163162_10066579 3300013306 Unclassified 3651
169 Ga0163162_10142890 3300013306 Bacteria 2507
170 Ga0163162_10240411 3300013306 Bacteria 1942
171 Ga0157372_10042000 3300013307 Bacteria 5056
172 Ga0157372_10072654 3300013307 Bacteria 3877
173 Ga0157372_10091002 3300013307 Unclassified 3469
174 Ga0157372_10122507 3300013307 Bacteria 2988
175 Ga0157375_10001429 3300013308 Bacteria 20544
176 Ga0157375_10009468 3300013308 Bacteria 8553
177 Ga0157375_10109649 3300013308 Bacteria 2857
178 Ga0157375_10156072 3300013308 Bacteria 2421
179 Ga0163163_10000078 3300014325 Bacteria 107017
180 Ga0163163_10010037 3300014325 Bacteria 8494
181 Ga0163163_10034455 3300014325 Bacteria 4904
182 Ga0163163_10088287 3300014325 Bacteria 3112
183 Ga0163163_10324520 3300014325 Unclassified 1593
184 Ga0157377_10042879 3300014745 Unclassified 2515
185 Ga0157377_10062799 3300014745 Bacteria 2126
186 Ga0157376_10000481 3300014969 Bacteria 25767
187 Ga0157376_10010591 3300014969 Bacteria 6752
188 Ga0157376_10112929 3300014969 Bacteria 2395
189 Ga0163161_10010918 3300017792 Bacteria 6296
190 Ga0163161_10017765 3300017792 Bacteria 4984
191 Ga0213876_10003829 3300021384 Bacteria 8521
192 Ga0207642_10007803 3300025899 Bacteria 3631
193 Ga0207710_10004545 3300025900 Bacteria 6029
194 Ga0207688_10066933 3300025901 Bacteria 2033
195 Ga0207680_10000448 3300025903 Bacteria 19470
196 Ga0207680_10050601 3300025903 Bacteria 2480
197 Ga0207680_10068412 3300025903 Bacteria 2191
198 Ga0207647_10000094 3300025904 Bacteria 68043
199 Ga0207645_10017806 3300025907 Bacteria 4683
200 Ga0207645_10029115 3300025907 Bacteria 3561
201 Ga0207645_10036081 3300025907 Unclassified 3174
202 Ga0207643_10001857 3300025908 Bacteria 11679
203 Ga0207705_10045264 3300025909 Bacteria 3163
204 Ga0207654_10059584 3300025911 Bacteria 2227
205 Ga0207654_10117923 3300025911 Bacteria 1662
206 Ga0207695_10000092 3300025913 Bacteria 270514
207 Ga0207671_10006273 3300025914 Bacteria 10633
208 Ga0207660_10051677 3300025917 Unclassified 2923
209 Ga0207662_10076203 3300025918 Bacteria 2038
210 Ga0207662_10101209 3300025918 Bacteria 1785
211 Ga0207649_10028442 3300025920 Bacteria 3291
212 Ga0207649_10036474 3300025920 Bacteria 2961
213 Ga0207652_10067615 3300025921 Unclassified 3099
214 Ga0207650_10011124 3300025925 Bacteria 6188
215 Ga0207650_10031763 3300025925 Bacteria 3815
216 Ga0207650_10061518 3300025925 Unclassified 2804
217 Ga0207687_10088808 3300025927 Bacteria 2249
218 Ga0207687_10163931 3300025927 Bacteria 1708
219 Ga0207644_10019615 3300025931 Bacteria 4590
220 Ga0207644_10209036 3300025931 Bacteria 1542
221 Ga0207644_10246493 3300025931 Unclassified 1424
222 Ga0207690_10018594 3300025932 Bacteria 4263
223 Ga0207690_10019288 3300025932 Unclassified 4197
224 Ga0207706_10004992 3300025933 Bacteria 12392
225 Ga0207686_10001617 3300025934 Bacteria 12610
226 Ga0207686_10028123 3300025934 Bacteria 3301
227 Ga0207704_10012451 3300025938 Bacteria 4222
228 Ga0207691_10010443 3300025940 Bacteria 8907
229 Ga0207691_10031091 3300025940 Bacteria 4986
230 Ga0207691_10037661 3300025940 Bacteria 4478
231 Ga0207691_10046152 3300025940 Bacteria 4006
232 Ga0207689_10004594 3300025942 Bacteria 12492
233 Ga0207689_10018782 3300025942 Bacteria 5830
234 Ga0207689_10019465 3300025942 Bacteria 5721
235 Ga0207689_10036519 3300025942 Bacteria 4078
236 Ga0207689_10083907 3300025942 Bacteria 2619
237 Ga0207689_10115480 3300025942 Bacteria 2207
238 Ga0207661_10015703 3300025944 Bacteria 5578
239 Ga0207661_10096154 3300025944 Bacteria 2478
240 Ga0207679_10000550 3300025945 Bacteria 25168
241 Ga0207679_10015256 3300025945 Bacteria 5070
242 Ga0207679_10022602 3300025945 Bacteria 4285
243 Ga0207679_10032980 3300025945 Bacteria 3641
244 Ga0207667_10085974 3300025949 Bacteria 3255
245 Ga0207651_10039470 3300025960 Bacteria 3114
246 Ga0207712_10025420 3300025961 Bacteria 3934
247 Ga0207712_10028830 3300025961 Bacteria 3717
248 Ga0207712_10034253 3300025961 Bacteria 3440
249 Ga0207712_10141964 3300025961 Bacteria 1844
250 Ga0207640_10032814 3300025981 Unclassified 3223
251 Ga0207640_10137646 3300025981 Bacteria 1775
252 Ga0207640_10160415 3300025981 Bacteria 1663
253 Ga0207658_10074813 3300025986 Bacteria 2575
254 Ga0207658_10084852 3300025986 Bacteria 2438
255 Ga0207658_10088697 3300025986 Bacteria 2392
256 Ga0207658_10095999 3300025986 Bacteria 2311
257 Ga0207658_10121851 3300025986 Bacteria 2081
258 Ga0207677_10003096 3300026023 Bacteria 8772
259 Ga0207677_10022812 3300026023 Bacteria 3854
260 Ga0207677_10032028 3300026023 Bacteria 3375
261 Ga0207703_10006148 3300026035 Bacteria 9608
262 Ga0207639_10002438 3300026041 Bacteria 12502
263 Ga0207639_10055889 3300026041 Bacteria 3023
264 Ga0207702_10054885 3300026078 Bacteria 3377
265 Ga0207641_10000200 3300026088 Bacteria 80556
266 Ga0207641_10000418 3300026088 Bacteria 49680
267 Ga0207641_10014181 3300026088 Bacteria 6531
268 Ga0207641_10133272 3300026088 Bacteria 2234
269 Ga0207641_10147434 3300026088 Bacteria 2129
270 Ga0207641_10204305 3300026088 Bacteria 1823
271 Ga0207648_10002836 3300026089 Bacteria 18380
272 Ga0207648_10003952 3300026089 Bacteria 15418
273 Ga0207648_10029717 3300026089 Bacteria 4846
274 Ga0207648_10040717 3300026089 Bacteria 4082
275 Ga0207676_10005337 3300026095 Bacteria 9102
276 Ga0207676_10104258 3300026095 Unclassified 2358
277 Ga0207674_10005175 3300026116 Bacteria 15536
278 Ga0207674_10019902 3300026116 Bacteria 7262
279 Ga0207674_10333074 3300026116 Bacteria 1468
280 Ga0207675_100042283 3300026118 Bacteria 4254
281 Ga0207675_100083918 3300026118 Unclassified 2989
282 Ga0207675_100119599 3300026118 Bacteria 2492
283 Ga0207675_100234608 3300026118 Bacteria 1771
284 Ga0207683_10037884 3300026121 Unclassified 4200
285 Ga0207683_10232144 3300026121 Bacteria 1683
286 Ga0207698_10006254 3300026142 Bacteria 7408
287 Ga0207698_10072396 3300026142 Bacteria 2740
288 Ga0207698_10117178 3300026142 Bacteria 2246
289 Ga0268266_10171266 3300028379 Unclassified 1971
290 Ga0268266_10336738 3300028379 Bacteria 1415
291 Ga0268265_10049535 3300028380 Bacteria 3160
292 Ga0268264_10001343 3300028381 Bacteria 23104
293 Ga0268264_10015418 3300028381 Bacteria 6267
294 Ga0268264_10017050 3300028381 Bacteria 5947
295 Ga0268264_10146911 3300028381 Unclassified 2109
296 Ga0265318_10016158 3300028577 Bacteria 3088
297 Ga0307515_10000002 3300028794 Bacteria 1231751
298 Ga0307515_10000074 3300028794 Bacteria 229874
299 Ga0265338_10000563 3300028800 Bacteria 65172
300 Ga0265338_10069336 3300028800 Bacteria 3030
301 Ga0265324_10003958 3300029957 Bacteria 6856
302 Ga0265328_10046794 3300031239 Bacteria 1590
303 Ga0265320_10052319 3300031240 Bacteria 1978
304 Ga0265327_10000385 3300031251 Bacteria 83048
305 Ga0265327_10000648 3300031251 Bacteria 56244
306 Ga0307509_10032929 3300031507 Bacteria 5708
307 Ga0307509_10170450 3300031507 Bacteria 2057
308 Ga0307408_100000130 3300031548 Bacteria 83482
309 Ga0307508_10000354 3300031616 Bacteria 55733
310 Ga0265314_10034278 3300031711 Bacteria 3712
311 Ga0307414_10000082 3300032004 Bacteria 87561
312 Ga0307414_10143547 3300032004 Bacteria 1872
313 Ga0307411_10003688 3300032005 Bacteria 7172
314 Ga0373955_0047394 3300035172 Bacteria 2327
315 Ga0395901_0005018 3300038443 Bacteria 13365
316 Ga0436365_0473715 3300039437 Bacteria 54513
317 Ga0451577_0019338 3300042876 Bacteria 6263
318 Ga0451577_0035444 3300042876 Bacteria 4495
319 Ga0466972_0000046 3300044658 Bacteria 127926
320 Ga0453683_0103148 3300044673 Bacteria 1791
321 Ga0453684_0012316 3300044712 Bacteria 14153
322 Ga0453684_0021588 3300044712 Bacteria 9606
323 Ga0453684_0029634 3300044712 Bacteria 7760
324 Ga0453684_0049322 3300044712 Bacteria 5554
325 Ga0453684_0093674 3300044712 Bacteria 3699
326 Ga0453684_0100853 3300044712 Bacteria 3533
327 Ga0453684_0323883 3300044712 Bacteria 1744
328 Ga0453684_0499028 3300044712 Unclassified 1348
329 Ga0466970_0029642 3300044765 Bacteria 2882
330 Ga0451576_0001299 3300045051 Bacteria 43263
331 Ga0451576_0010497 3300045051 Bacteria 10618
332 Ga0451576_0034940 3300045051 Bacteria 5335
333 Ga0495650_0019482 3300046471 Bacteria 3337
334 Ga0495628_0029489 3300046516 Bacteria 4447
335 Ga0495630_0064269 3300046517 Bacteria 2757
336 Ga0495643_0016475 3300046522 Bacteria 4341
337 Ga0495587_0030292 3300046536 Bacteria 3282
338 Ga0495667_0088669 3300046559 Bacteria 2005
339 Ga0495668_0001660 3300046616 Bacteria 20744
340 Ga0495634_0080292 3300046642 Bacteria 2135
341 Ga0495672_0026506 3300047320 Unclassified 3698
342 Ga0495672_0092231 3300047320 Unclassified 1661
343 Ga0495686_0000265 3300047472 Bacteria 93838
344 Ga0496101_0008092 3300048904 Bacteria 6858
345 Ga0496104_0356015 3300048907 Bacteria 1376
346 Ga0496124_0165502 3300048927 Bacteria 1719
347 Ga0501298_000638 3300049521 Bacteria 4824
348 Ga0501032_0000933 3300049569 Bacteria 23653
349 Ga0501034_0000043 3300049571 Bacteria 229049
350 Ga0501034_0134831 3300049571 Bacteria 2450
351 Ga0501036_0184569 3300049572 Bacteria 1755
352 Ga0501037_0008518 3300049573 Bacteria 7523
353 Ga0501038_0010723 3300049574 Bacteria 8377
354 Ga0501038_0057932 3300049574 Bacteria 3324
355 Ga0501043_0013687 3300049579 Bacteria 6350
356 Ga0501043_0021605 3300049579 Bacteria 5046
357 Ga0501046_0004351 3300049580 Bacteria 12892
358 Ga0501047_0028837 3300049581 Bacteria 5354
359 Ga0501068_0070659 3300049584 Bacteria 2130
360 Ga0501073_0000542 3300049589 Bacteria 26583
361 Ga0501074_0000668 3300049590 Bacteria 21402
362 Ga0501217_002334 3300049661 Bacteria 3722
363 Ga0501240_007862 3300049673 Unclassified 1352
364 Ga0501219_000086 3300049703 Bacteria 15961
365 Ga0501221_000438 3300049704 Bacteria 6465
366 Ga0501079_0096383 3300049741 Bacteria 2293
367 Ga0501035_0028023 3300049822 Bacteria 5144
368 Ga0501044_0078089 3300049823 Bacteria 3355
369 Ga0501284_00211 3300050005 Bacteria 3591
370 nmdc:mga0k408_36366_c1 3300050493 Bacteria 2826
371 nmdc:mga09592_5730_c1 3300050508 Bacteria 10128
372 nmdc:mga08y16_177269_c1 3300050511 Bacteria 2213
373 nmdc:mga08y16_278404_c1 3300050511 Bacteria 1726
374 Ga0495619_0130045 3300053085 Bacteria 1730
375 Ga0500641_0034137 3300053096 Bacteria 2023
376 Ga0500562_000096 3300053108 Bacteria 33894
377 Ga0500568_0001611 3300053139 Bacteria 14278
378 Ga0500588_0000493 3300053146 Bacteria 6269
379 Ga0500616_0014970 3300053153 Bacteria 4445
380 Ga0500616_0032481 3300053153 Unclassified 2854
381 Ga0500622_0000214 3300053156 Bacteria 61277
382 Ga0500611_000043 3300053727 Bacteria 58183
383 2819589083 2818991444 Bacteria 6968812
384 2919693552 2919692658 Bacteria 5943958
385 2929156395 2929154850 Bacteria 6753285
386 Ga0157373_10113055
387 JGI24744J21845_10002642
388 rootL2_10340936
389 Ga0065704_10132426
390 Ga0065712_10127910
391 Ga0070676_10002090
392 Ga0070676_10029292
393 Ga0070683_100028042
394 Ga0070670_100072136
395 Ga0070670_100283406
396 Ga0068869_100053707
397 Ga0068869_100104319
398 Ga0070666_10000042
399 Ga0070666_10032628
400 Ga0070680_100027225
401 Ga0070682_100000124
402 Ga0068868_100002150
403 Ga0068868_100129699
404 Ga0068868_100186210
405 Ga0070661_100005681
406 Ga0070661_100122703
407 Ga0070668_100087609
408 Ga0070675_100165197
409 Ga0070671_100001926
410 Ga0070671_100013574
411 Ga0070674_100016436
412 Ga0070673_100263036
413 Ga0070659_100006626
414 Ga0070667_100001632
415 Ga0070667_100005157
416 Ga0070667_100026373
417 Ga0070667_100028621
418 Ga0070667_100111976
419 Ga0070667_100145211
420 Ga0070667_100205942
421 Ga0070663_100028012
422 Ga0070678_100017614
423 Ga0070678_100074018
424 Ga0070678_100156535
425 Ga0070662_100007916
426 Ga0070681_10140701
427 Ga0068867_100019440
428 Ga0068867_100057514
429 Ga0070685_10036760
430 Ga0070698_100001722
431 Ga0070698_100038718
432 Ga0070679_100005964
433 Ga0070679_100157394
434 Ga0070684_100002706
435 Ga0070684_100004020
436 Ga0070684_100023094
437 Ga0070684_100059698
438 Ga0070684_100184866
439 Ga0068853_100011059
440 Ga0068853_100134922
441 Ga0070665_100011209
442 Ga0068855_100106339
443 Ga0068855_100290164
444 Ga0068855_100430569
445 Ga0070664_100003473
446 Ga0070664_100097612
447 Ga0070664_100168742
448 Ga0068857_100001120
449 Ga0068857_100042981
450 Ga0068857_100051539
451 Ga0068857_100105244
452 Ga0068854_100009879
453 Ga0068854_100050648
454 Ga0068854_100150288
455 Ga0068856_100071023
456 Ga0068856_100076222
457 Ga0068852_100001468
458 Ga0068852_100029345
459 Ga0068852_100051305
460 Ga0068852_100086593
461 Ga0068852_100304484
462 Ga0068859_100000200
463 Ga0068859_100053343
464 Ga0068859_100091525
465 Ga0068859_100397716
466 Ga0068864_100016496
467 Ga0068864_100034372
468 Ga0068864_100123494
469 Ga0068864_100135122
470 Ga0068851_10012528
471 Ga0068863_100028336
472 Ga0068863_100030624
473 Ga0068863_100042277
474 Ga0068863_100096507
475 Ga0068858_100133394
476 Ga0068860_100000855
477 Ga0068860_100009032
478 Ga0068860_100009630
479 Ga0068860_100019426
480 Ga0068860_100085362
481 Ga0068860_100141415
482 Ga0068862_100025450
483 Ga0081539_10036867
484 Ga0070715_10040430
485 Ga0070715_10052008
486 Ga0075366_10005879
487 Ga0097621_100001776
488 Ga0097621_100002030
489 Ga0097621_100138344
490 Ga0097621_100282420
491 Ga0068871_100000063
492 Ga0068871_100011416
493 Ga0068871_100017181
494 Ga0068871_100117165
495 Ga0068871_100128299
496 Ga0075428_100006924
497 Ga0075428_100016828
498 Ga0075430_100155589
499 Ga0075431_100057528
500 Ga0075429_100011429
501 Ga0068865_100002013
502 Ga0068865_100170139
503 Ga0097620_100000200
504 Ga0097620_100053343
505 Ga0097620_100091528
506 Ga0097620_100397733
507 Ga0105240_10000037
508 Ga0105240_10190363
509 Ga0105245_10058466
510 Ga0105245_10081101
511 Ga0105247_10003739
512 Ga0105247_10004596
513 Ga0114129_10081161
514 Ga0105241_10008352
515 Ga0105241_10026934
516 Ga0105241_10110185
517 Ga0105242_10002236
518 Ga0105242_10033141
519 Ga0105237_10032263
520 Ga0105237_10075501
521 Ga0105237_10092000
522 Ga0105237_10246844
523 Ga0105249_10010845
524 Ga0105249_10040315
525 Ga0105249_10046190
526 Ga0105239_10005001
527 Ga0105239_10060996
528 Ga0105239_10121771
529 Ga0105246_10011283
530 Ga0105246_10102153
531 Ga0157373_10015569
532 Ga0157373_10080696
533 Ga0157371_10029224
534 Ga0157371_10042128
535 Ga0157371_10046424
536 Ga0157369_10071352
537 Ga0157369_10267329
538 Ga0157374_10075460
539 Ga0157374_10145703
540 Ga0157374_10161759
541 Ga0157378_10007682
542 Ga0157378_10010308
543 Ga0157378_10037371
544 Ga0157378_10044230
545 Ga0157378_10051544
546 Ga0157378_10079881
547 Ga0157378_10133515
548 Ga0157378_10257480
549 Ga0163162_10002273
550 Ga0163162_10004720
551 Ga0163162_10005320
552 Ga0163162_10005904
553 Ga0163162_10066579
554 Ga0163162_10142890
555 Ga0163162_10240411
556 Ga0157372_10042000
557 Ga0157372_10072654
558 Ga0157372_10091002
559 Ga0157372_10122507
560 Ga0157375_10001429
561 Ga0157375_10009468
562 Ga0157375_10109649
563 Ga0157375_10156072
564 Ga0163163_10000078
565 Ga0163163_10010037
566 Ga0163163_10034455
567 Ga0163163_10088287
568 Ga0163163_10324520
569 Ga0157377_10042879
570 Ga0157377_10062799
571 Ga0157376_10000481
572 Ga0157376_10010591
573 Ga0157376_10112929
574 Ga0163161_10010918
575 Ga0163161_10017765
576 Ga0213876_10003829
577 Ga0207642_10007803
578 Ga0207710_10004545
579 Ga0207688_10066933
580 Ga0207680_10000448
581 Ga0207680_10050601
582 Ga0207680_10068412
583 Ga0207647_10000094
584 Ga0207645_10017806
585 Ga0207645_10029115
586 Ga0207645_10036081
587 Ga0207643_10001857
588 Ga0207705_10045264
589 Ga0207654_10059584
590 Ga0207654_10117923
591 Ga0207695_10000092
592 Ga0207671_10006273
593 Ga0207660_10051677
594 Ga0207662_10076203
595 Ga0207662_10101209
596 Ga0207649_10028442
597 Ga0207649_10036474
598 Ga0207652_10067615
599 Ga0207650_10011124
600 Ga0207650_10031763
601 Ga0207650_10061518
602 Ga0207687_10088808
603 Ga0207687_10163931
604 Ga0207644_10019615
605 Ga0207644_10209036
606 Ga0207644_10246493
607 Ga0207690_10018594
608 Ga0207690_10019288
609 Ga0207706_10004992
610 Ga0207686_10001617
611 Ga0207686_10028123
612 Ga0207704_10012451
613 Ga0207691_10010443
614 Ga0207691_10031091
615 Ga0207691_10037661
616 Ga0207691_10046152
617 Ga0207689_10004594
618 Ga0207689_10018782
619 Ga0207689_10019465
620 Ga0207689_10036519
621 Ga0207689_10083907
622 Ga0207689_10115480
623 Ga0207661_10015703
624 Ga0207661_10096154
625 Ga0207679_10000550
626 Ga0207679_10015256
627 Ga0207679_10022602
628 Ga0207679_10032980
629 Ga0207667_10085974
630 Ga0207651_10039470
631 Ga0207712_10025420
632 Ga0207712_10028830
633 Ga0207712_10034253
634 Ga0207712_10141964
635 Ga0207640_10032814
636 Ga0207640_10137646
637 Ga0207640_10160415
638 Ga0207658_10074813
639 Ga0207658_10084852
640 Ga0207658_10088697
641 Ga0207658_10095999
642 Ga0207658_10121851
643 Ga0207677_10003096
644 Ga0207677_10022812
645 Ga0207677_10032028
646 Ga0207703_10006148
647 Ga0207639_10002438
648 Ga0207639_10055889
649 Ga0207702_10054885
650 Ga0207641_10000200
651 Ga0207641_10000418
652 Ga0207641_10014181
653 Ga0207641_10133272
654 Ga0207641_10147434
655 Ga0207641_10204305
656 Ga0207648_10002836
657 Ga0207648_10003952
658 Ga0207648_10029717
659 Ga0207648_10040717
660 Ga0207676_10005337
661 Ga0207676_10104258
662 Ga0207674_10005175
663 Ga0207674_10019902
664 Ga0207674_10333074
665 Ga0207675_100042283
666 Ga0207675_100083918
667 Ga0207675_100119599
668 Ga0207675_100234608
669 Ga0207683_10037884
670 Ga0207683_10232144
671 Ga0207698_10006254
672 Ga0207698_10072396
673 Ga0207698_10117178
674 Ga0268266_10171266
675 Ga0268266_10336738
676 Ga0268265_10049535
677 Ga0268264_10001343
678 Ga0268264_10015418
679 Ga0268264_10017050
680 Ga0268264_10146911
681 Ga0265318_10016158
682 Ga0307515_10000002
683 Ga0307515_10000074
684 Ga0265338_10000563
685 Ga0265338_10069336
686 Ga0265324_10003958
687 Ga0265328_10046794
688 Ga0265320_10052319
689 Ga0265327_10000385
690 Ga0265327_10000648
691 Ga0307509_10032929
692 Ga0307509_10170450
693 Ga0307408_100000130
694 Ga0307508_10000354
695 Ga0265314_10034278
696 Ga0307414_10000082
697 Ga0307414_10143547
698 Ga0307411_10003688
699 Ga0373955_0047394
700 Ga0395901_0005018
701 Ga0436365_0473715
702 Ga0451577_0019338
703 Ga0451577_0035444
704 Ga0466972_0000046
705 Ga0453683_0103148
706 Ga0453684_0012316
707 Ga0453684_0021588
708 Ga0453684_0029634
709 Ga0453684_0049322
710 Ga0453684_0093674
711 Ga0453684_0100853
712 Ga0453684_0323883
713 Ga0453684_0499028
714 Ga0466970_0029642
715 Ga0451576_0001299
716 Ga0451576_0010497
717 Ga0451576_0034940
718 Ga0495650_0019482
719 Ga0495628_0029489
720 Ga0495630_0064269
721 Ga0495643_0016475
722 Ga0495587_0030292
723 Ga0495667_0088669
724 Ga0495668_0001660
725 Ga0495634_0080292
726 Ga0495672_0026506
727 Ga0495672_0092231
728 Ga0495686_0000265
729 Ga0496101_0008092
730 Ga0496104_0356015
731 Ga0496124_0165502
732 Ga0501298_000638
733 Ga0501032_0000933
734 Ga0501034_0000043
735 Ga0501034_0134831
736 Ga0501036_0184569
737 Ga0501037_0008518
738 Ga0501038_0010723
739 Ga0501038_0057932
740 Ga0501043_0013687
741 Ga0501043_0021605
742 Ga0501046_0004351
743 Ga0501047_0028837
744 Ga0501068_0070659
745 Ga0501073_0000542
746 Ga0501074_0000668
747 Ga0501217_002334
748 Ga0501240_007862
749 Ga0501219_000086
750 Ga0501221_000438
751 Ga0501079_0096383
752 Ga0501035_0028023
753 Ga0501044_0078089
754 Ga0501284_00211
755 nmdc:mga0k408_36366_c1
756 nmdc:mga09592_5730_c1
757 nmdc:mga08y16_177269_c1
758 nmdc:mga08y16_278404_c1
759 Ga0495619_0130045
760 Ga0500641_0034137
761 Ga0500562_000096
762 Ga0500568_0001611
763 Ga0500588_0000493
764 Ga0500616_0014970
765 Ga0500616_0032481
766 Ga0500622_0000214
767 Ga0500611_000043
768 2819589083
769 2919693552
770 2929156395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

21

51

0.95

PF22366

NDH2_C

NDH2 C-terminal domain

361

421

0.95

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

17

337

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5na1-assembly1.cif.gz_A nadh:quinone oxidoreductase (ndh-ii) from staphylococcus aureus - holoprotein structure - 2.32 a resolution 0.9155 2 394
4nwz-assembly1.cif.gz_A structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution 0.9076 2 397
4g73-assembly1.cif.gz_B crystal structure of ndh with nadh and quinone 0.9064 2 412
5na4-assembly1.cif.gz_A nadh:quinone oxidoreductase (ndh-ii) from staphylococcus aureus - e172s mutant 0.9027 2 397
4g74-assembly1.cif.gz_A crystal structure of ndh with quinone 0.9002 2 412
ID Description Score Start End Superfamily
af_Q6YZ09_48_354_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9371 2 267 3.50.50.100
af_P95200_9_428_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9295 2 406 3.50.50.100
af_Q55CD9_31_450_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9291 2 405 3.50.50.100
af_Q54GF3_119_512_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9275 2 301 3.50.50.100
af_I1KLC9_45_406_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9246 2 302 3.50.50.100
ID Description Score Start End GO Terms
AF-A0A7C4Y5C3-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9946 1 266 GO:0003954
GO:0006116
AF-A0A4Q5WU76-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9934 1 213 GO:0003954
GO:0006116
AF-A0A3B9EVJ3-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9921 2 268 GO:0003954
GO:0006116
AF-A0A519TDB5-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.992 2 290 GO:0003954
GO:0006116
AF-A0A7C4Y5C3-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9909 1 266 GO:0003954
GO:0006116

Map