F430255

General Info

Members Datasets Scaffolds Average Seq Length
385 134 770 366

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000012|Ga0395899_0000012_197547_198791
Length 414
Sequence MWQEKFMQFGKGIPATAESQLCALGQRRAPHYRTANGADSFGAVMTFTLLGNPLQHWGAALAVALGATAAMYGARALALRRVSRLAPRPHTRIDHVLADMLASTYLLFIVAIAVYLGSLWLNLPGSRQLLISRVAVSALLLQLAVWGDTGLRAWRDLFRAAQAAGDGNGSRRASTTVLCFIARLALWLIMFLMLLDNLGFNITTLVASLGIGGVAVALATQNILGDLFASLSIMLDKPFEIGDFIIVGDVLGWVEHVGLKTTRVRGLGGEQVVFSNGELLRSRIHNHKRLQSRRVAFVVRAAYGTGEQLLSRIPEMVREIVTAHPDDEIAFEHCHFMRYGDWSLDFEVVYHYRSPDYFRHLDAQQAIFLELYRRFEREGIQFAHPLSVVRLADSEDAARLAQQLRTPPGPAMRH

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
6 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
7 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
8 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
9 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
10 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
19 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
20 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
21 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
22 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
23 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
24 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
25 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
26 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
27 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
28 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
29 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
30 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
31 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
32 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
33 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
34 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
35 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
36 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
37 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
38 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
39 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
40 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
41 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
42 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
43 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
44 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
45 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
46 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
47 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
48 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
49 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
50 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
51 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
52 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
53 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
54 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
55 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
56 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
57 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
58 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
59 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
60 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
61 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
62 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
63 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
64 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
65 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
66 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
67 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
68 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
69 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
70 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
71 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
72 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
75 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
76 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
77 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
78 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
79 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
80 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
93 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
94 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
110 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
111 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
112 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
117 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
127 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
131 2643221556 Massilia sp. Root1485 Isolate Unclassified
132 2643221684 Massilia sp. Root133 Isolate Unclassified
133 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
134 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 2.08
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000012 3300037312 Bacteria 517561
2 Ga0055525_1000008 3300003759 Bacteria 604287
3 Ga0070660_100052075 3300005339 Bacteria 3154
4 Ga0070660_100052082 3300005339 Bacteria 3154
5 Ga0070660_100057112 3300005339 Bacteria 3022
6 Ga0070661_100053476 3300005344 Bacteria 2956
7 Ga0070664_100124674 3300005564 Bacteria 2258
8 Ga0068857_100267061 3300005577 Bacteria 1572
9 Ga0105242_10025355 3300009176 Bacteria 4692
10 Ga0209563_100003 3300025230 Bacteria 1932942
11 Ga0209677_104448 3300025253 Bacteria 4038
12 Ga0209148_1000859 3300025254 Bacteria 21262
13 Ga0207671_10093172 3300025914 Bacteria 2272
14 Ga0207657_10002545 3300025919 Bacteria 19715
15 Ga0207657_10007863 3300025919 Bacteria 10886
16 Ga0207657_10183211 3300025919 Bacteria 1692
17 Ga0207690_10012073 3300025932 Bacteria 5165
18 Ga0207704_10138320 3300025938 Bacteria 1699
19 Ga0207679_10038314 3300025945 Bacteria 3414
20 Ga0207667_10079679 3300025949 Bacteria 3394
21 Ga0207698_10100910 3300026142 Bacteria 2392
22 Ga0316579_10034072 3300031691 Bacteria 2341
23 Ga0316576_10008354 3300031727 Bacteria 6598
24 Ga0316578_10104812 3300031728 Bacteria 1696
25 Ga0316577_10040418 3300031733 Bacteria 2608
26 Ga0316577_10083392 3300031733 Bacteria 1788
27 Ga0316580_10008174 3300032139 Bacteria 3132
28 Ga0316584_0045111 3300036712 Bacteria 3289
29 Ga0395899_0012506 3300037312 Bacteria 6502
30 Ga0395899_0020843 3300037312 Bacteria 4971
31 Ga0395899_0047762 3300037312 Bacteria 3186
32 Ga0395899_0052964 3300037312 Bacteria 3006
33 Ga0395899_0069239 3300037312 Bacteria 2584
34 Ga0395900_0000164 3300037418 Bacteria 108590
35 Ga0395900_0000177 3300037418 Bacteria 102548
36 Ga0395900_0002251 3300037418 Bacteria 21459
37 Ga0395900_0034539 3300037418 Bacteria 5208
38 Ga0395900_0061854 3300037418 Bacteria 3848
39 Ga0395900_0308146 3300037418 Bacteria 1567
40 Ga0395898_0011310 3300037466 Bacteria 9278
41 Ga0395898_0019197 3300037466 Bacteria 6959
42 Ga0395898_0029582 3300037466 Bacteria 5484
43 Ga0395898_0145821 3300037466 Bacteria 2265
44 Ga0395898_0172343 3300037466 Bacteria 2068
45 Ga0395905_0016637 3300037471 Bacteria 6991
46 Ga0395905_0083508 3300037471 Bacteria 2992
47 Ga0395905_0083708 3300037471 Bacteria 2988
48 Ga0395905_0153041 3300037471 Bacteria 2169
49 Ga0395905_0163982 3300037471 Bacteria 2088
50 Ga0395905_0361863 3300037471 Bacteria 1343
51 Ga0395901_0000226 3300038443 Bacteria 70810
52 Ga0395901_0000263 3300038443 Bacteria 65735
53 Ga0395901_0172886 3300038443 Bacteria 2266
54 Ga0395901_0254093 3300038443 Bacteria 1830
55 Ga0395901_0299154 3300038443 Bacteria 1668
56 Ga0439448_0000560 3300042005 Bacteria 8722
57 Ga0439448_0014968 3300042005 Bacteria 2345
58 Ga0439450_007972 3300042008 Bacteria 1961
59 Ga0450906_015665 3300042145 Bacteria 1376
60 Ga0466972_0001352 3300044658 Bacteria 11878
61 Ga0466981_0106832 3300044669 Bacteria 1975
62 Ga0466965_0002628 3300044683 Bacteria 7691
63 Ga0466966_0016291 3300044684 Bacteria 4915
64 Ga0466966_0028956 3300044684 Bacteria 3605
65 Ga0466961_0121754 3300044693 Bacteria 1637
66 Ga0466964_0001507 3300044706 Bacteria 7999
67 Ga0466964_0004235 3300044706 Bacteria 5282
68 Ga0466964_0046085 3300044706 Bacteria 1776
69 Ga0466968_0000193 3300044735 Bacteria 18632
70 Ga0466970_0015501 3300044765 Bacteria 3920
71 Ga0466957_0033733 3300044842 Bacteria 3071
72 Ga0466959_0022782 3300045049 Bacteria 4630
73 Ga0466959_0066559 3300045049 Bacteria 2613
74 Ga0495617_000080 3300046452 Bacteria 74677
75 Ga0495627_013061 3300046453 Bacteria 2930
76 Ga0495603_0017118 3300046455 Bacteria 4387
77 Ga0495590_0000015 3300046457 Bacteria 241989
78 Ga0495590_0000597 3300046457 Bacteria 16992
79 Ga0495590_0015954 3300046457 Bacteria 2717
80 Ga0495591_000033 3300046458 Bacteria 171402
81 Ga0495629_0175232 3300046459 Bacteria 1487
82 Ga0495638_0078852 3300046460 Bacteria 2003
83 Ga0495638_0080025 3300046460 Bacteria 1986
84 Ga0495653_0022052 3300046463 Bacteria 5154
85 Ga0495653_0025669 3300046463 Bacteria 4729
86 Ga0495653_0040820 3300046463 Bacteria 3624
87 Ga0495653_0114924 3300046463 Bacteria 1927
88 Ga0495650_0000089 3300046471 Bacteria 233415
89 Ga0495582_0007421 3300046473 Bacteria 6071
90 Ga0495605_0000227 3300046474 Bacteria 69646
91 Ga0495605_0007287 3300046474 Bacteria 6283
92 Ga0495605_0010365 3300046474 Bacteria 5218
93 Ga0495584_0000002 3300046491 Bacteria 512179
94 Ga0495584_0000287 3300046491 Bacteria 35639
95 Ga0495584_0007887 3300046491 Bacteria 5537
96 Ga0495584_0008578 3300046491 Bacteria 5292
97 Ga0495584_0009769 3300046491 Bacteria 4935
98 Ga0495584_0010662 3300046491 Bacteria 4722
99 Ga0495584_0020891 3300046491 Bacteria 3323
100 Ga0495584_0031292 3300046491 Bacteria 2693
101 Ga0495584_0037406 3300046491 Bacteria 2453
102 Ga0495584_0041900 3300046491 Bacteria 2311
103 Ga0495584_0113321 3300046491 Bacteria 1372
104 Ga0495585_0000003 3300046492 Bacteria 406344
105 Ga0495585_0000039 3300046492 Bacteria 131202
106 Ga0495585_0000257 3300046492 Bacteria 54605
107 Ga0495585_0000438 3300046492 Bacteria 39870
108 Ga0495585_0004737 3300046492 Bacteria 8758
109 Ga0495585_0005039 3300046492 Bacteria 8424
110 Ga0495585_0007236 3300046492 Bacteria 6819
111 Ga0495585_0012651 3300046492 Bacteria 4967
112 Ga0495585_0013296 3300046492 Bacteria 4820
113 Ga0495585_0015042 3300046492 Bacteria 4498
114 Ga0495585_0016041 3300046492 Bacteria 4343
115 Ga0495585_0036480 3300046492 Bacteria 2772
116 Ga0495585_0040647 3300046492 Bacteria 2610
117 Ga0495585_0047002 3300046492 Bacteria 2404
118 Ga0495585_0064378 3300046492 Bacteria 2010
119 Ga0495585_0073964 3300046492 Bacteria 1854
120 Ga0495594_0003855 3300046499 Bacteria 7704
121 Ga0495594_0014669 3300046499 Bacteria 4110
122 Ga0495594_0042471 3300046499 Bacteria 2490
123 Ga0495596_0000044 3300046500 Bacteria 90299
124 Ga0495596_0000578 3300046500 Bacteria 22865
125 Ga0495596_0000700 3300046500 Bacteria 20763
126 Ga0495596_0000826 3300046500 Bacteria 18755
127 Ga0495596_0001578 3300046500 Bacteria 13000
128 Ga0495596_0009633 3300046500 Bacteria 4245
129 Ga0495596_0026955 3300046500 Bacteria 2313
130 Ga0495596_0035438 3300046500 Bacteria 1978
131 Ga0495607_0000880 3300046501 Bacteria 28001
132 Ga0495607_0002059 3300046501 Bacteria 16822
133 Ga0495607_0004938 3300046501 Bacteria 9684
134 Ga0495607_0010252 3300046501 Bacteria 6303
135 Ga0495583_0000394 3300046506 Bacteria 66597
136 Ga0495583_0000999 3300046506 Bacteria 32381
137 Ga0495583_0001599 3300046506 Bacteria 22251
138 Ga0495583_0045646 3300046506 Bacteria 2025
139 Ga0495583_0073565 3300046506 Bacteria 1498
140 Ga0495583_0074470 3300046506 Bacteria 1486
141 Ga0495606_0003033 3300046507 Bacteria 18352
142 Ga0495606_0005979 3300046507 Bacteria 11408
143 Ga0495606_0020865 3300046507 Bacteria 4814
144 Ga0495606_0026978 3300046507 Bacteria 4080
145 Ga0495610_0007553 3300046512 Bacteria 7201
146 Ga0495616_0000510 3300046513 Bacteria 29511
147 Ga0495616_0000604 3300046513 Bacteria 27112
148 Ga0495616_0003546 3300046513 Bacteria 9971
149 Ga0495616_0006254 3300046513 Bacteria 7233
150 Ga0495616_0017256 3300046513 Bacteria 3982
151 Ga0495616_0018289 3300046513 Bacteria 3849
152 Ga0495616_0033623 3300046513 Bacteria 2669
153 Ga0495616_0079688 3300046513 Bacteria 1569
154 Ga0495620_0012981 3300046515 Bacteria 4280
155 Ga0495630_0076367 3300046517 Bacteria 2524
156 Ga0495631_0000658 3300046518 Bacteria 22317
157 Ga0495631_0005312 3300046518 Bacteria 6764
158 Ga0495631_0010143 3300046518 Bacteria 4675
159 Ga0495631_0024389 3300046518 Bacteria 2792
160 Ga0495631_0035007 3300046518 Bacteria 2248
161 Ga0495631_0035948 3300046518 Bacteria 2214
162 Ga0495631_0037985 3300046518 Bacteria 2143
163 Ga0495631_0080297 3300046518 Bacteria 1407
164 Ga0495632_0000221 3300046519 Bacteria 57926
165 Ga0495632_0001227 3300046519 Bacteria 21783
166 Ga0495632_0002215 3300046519 Bacteria 14999
167 Ga0495632_0005756 3300046519 Bacteria 8132
168 Ga0495632_0083950 3300046519 Bacteria 1516
169 Ga0495637_0000002 3300046520 Bacteria 629280
170 Ga0495637_0011152 3300046520 Bacteria 4324
171 Ga0495643_0012120 3300046522 Bacteria 5211
172 Ga0495643_0043598 3300046522 Bacteria 2440
173 Ga0495643_0059448 3300046522 Bacteria 2031
174 Ga0495644_0008703 3300046523 Bacteria 3906
175 Ga0495644_0009654 3300046523 Bacteria 3716
176 Ga0495644_0020745 3300046523 Bacteria 2507
177 Ga0495648_0000171 3300046524 Bacteria 74494
178 Ga0495648_0005144 3300046524 Bacteria 10946
179 Ga0495648_0121588 3300046524 Bacteria 1402
180 Ga0495663_0005967 3300046525 Bacteria 3371
181 Ga0495663_0045942 3300046525 Bacteria 1340
182 Ga0495666_0003856 3300046526 Bacteria 7584
183 Ga0495666_0003977 3300046526 Bacteria 7474
184 Ga0495666_0004994 3300046526 Bacteria 6711
185 Ga0495642_0000072 3300046528 Bacteria 59857
186 Ga0495642_0001991 3300046528 Bacteria 8546
187 Ga0495642_0008845 3300046528 Bacteria 3851
188 Ga0495642_0010915 3300046528 Bacteria 3482
189 Ga0495642_0052247 3300046528 Bacteria 1682
190 Ga0495642_0062162 3300046528 Bacteria 1550
191 Ga0495665_0000965 3300046531 Bacteria 15222
192 Ga0495665_0004756 3300046531 Bacteria 7332
193 Ga0495640_0023955 3300046533 Bacteria 4441
194 Ga0495586_0003424 3300046535 Bacteria 8504
195 Ga0495586_0007317 3300046535 Bacteria 5894
196 Ga0495586_0026948 3300046535 Bacteria 3075
197 Ga0495586_0049637 3300046535 Bacteria 2269
198 Ga0495587_0002125 3300046536 Bacteria 13244
199 Ga0495609_0000001 3300046538 Bacteria 1060094
200 Ga0495609_0004256 3300046538 Bacteria 7904
201 Ga0495609_0004826 3300046538 Bacteria 7271
202 Ga0495609_0005660 3300046538 Bacteria 6506
203 Ga0495609_0008485 3300046538 Bacteria 5031
204 Ga0495609_0031112 3300046538 Bacteria 2427
205 Ga0495597_0001063 3300046542 Bacteria 20950
206 Ga0495597_0067604 3300046542 Bacteria 1545
207 Ga0495622_0005130 3300046557 Bacteria 6070
208 Ga0495622_0021217 3300046557 Bacteria 3025
209 Ga0495622_0035505 3300046557 Bacteria 2325
210 Ga0495633_0000965 3300046558 Bacteria 23609
211 Ga0495633_0001199 3300046558 Bacteria 20833
212 Ga0495633_0003390 3300046558 Bacteria 10663
213 Ga0495633_0006422 3300046558 Bacteria 6971
214 Ga0495633_0015241 3300046558 Bacteria 3993
215 Ga0495633_0019293 3300046558 Bacteria 3450
216 Ga0495633_0021495 3300046558 Bacteria 3226
217 Ga0495633_0027171 3300046558 Bacteria 2799
218 Ga0495633_0036555 3300046558 Bacteria 2352
219 Ga0495656_0008684 3300046615 Bacteria 3635
220 Ga0495656_0015190 3300046615 Bacteria 2903
221 Ga0495656_0028684 3300046615 Bacteria 2234
222 Ga0495668_0002078 3300046616 Bacteria 17353
223 Ga0495668_0011740 3300046616 Bacteria 5229
224 Ga0495668_0024700 3300046616 Bacteria 3417
225 Ga0495668_0073971 3300046616 Bacteria 1871
226 Ga0495634_0009218 3300046642 Bacteria 7284
227 Ga0495611_0003111 3300046648 Bacteria 7365
228 Ga0495611_0008265 3300046648 Bacteria 4412
229 Ga0495611_0010320 3300046648 Bacteria 3950
230 Ga0495611_0029632 3300046648 Bacteria 2400
231 Ga0495625_0006275 3300046660 Bacteria 10633
232 Ga0495625_0024619 3300046660 Bacteria 4579
233 Ga0495625_0191855 3300046660 Bacteria 1353
234 Ga0495635_0003013 3300046663 Bacteria 11571
235 Ga0495661_0000175 3300046665 Bacteria 73957
236 Ga0495661_0000260 3300046665 Bacteria 60822
237 Ga0495661_0001113 3300046665 Bacteria 23589
238 Ga0495661_0001774 3300046665 Bacteria 17351
239 Ga0495661_0005200 3300046665 Bacteria 9265
240 Ga0495661_0006754 3300046665 Bacteria 8044
241 Ga0495661_0011652 3300046665 Bacteria 5959
242 Ga0495661_0014010 3300046665 Bacteria 5375
243 Ga0495661_0023772 3300046665 Bacteria 3973
244 Ga0495661_0029279 3300046665 Bacteria 3517
245 Ga0495661_0039611 3300046665 Bacteria 2927
246 Ga0495661_0049731 3300046665 Bacteria 2540
247 Ga0495661_0086534 3300046665 Bacteria 1793
248 Ga0495588_0000095 3300046674 Bacteria 175627
249 Ga0495588_0001667 3300046674 Bacteria 9466
250 Ga0495588_0013175 3300046674 Bacteria 3933
251 Ga0495588_0024292 3300046674 Bacteria 3009
252 Ga0495588_0055829 3300046674 Bacteria 2038
253 Ga0495588_0063606 3300046674 Bacteria 1913
254 Ga0495588_0065742 3300046674 Bacteria 1881
255 Ga0495588_0066801 3300046674 Bacteria 1866
256 Ga0495599_0168749 3300046678 Bacteria 1351
257 Ga0495623_0002471 3300046679 Bacteria 12266
258 Ga0495623_0044983 3300046679 Bacteria 2804
259 Ga0495623_0102606 3300046679 Bacteria 1741
260 Ga0495669_0010822 3300046684 Bacteria 3861
261 Ga0495613_0038899 3300046689 Bacteria 3527
262 Ga0495624_0003855 3300046690 Bacteria 11067
263 Ga0495670_0000207 3300046691 Bacteria 26631
264 Ga0495670_0001373 3300046691 Bacteria 11900
265 Ga0495670_0001936 3300046691 Bacteria 10207
266 Ga0495670_0048170 3300046691 Bacteria 2132
267 Ga0495670_0084667 3300046691 Bacteria 1618
268 Ga0495670_0117673 3300046691 Bacteria 1379
269 Ga0495671_0000452 3300046692 Bacteria 32378
270 Ga0495671_0016292 3300046692 Bacteria 3971
271 Ga0495671_0049949 3300046692 Bacteria 2084
272 Ga0495649_0000024 3300046694 Bacteria 175713
273 Ga0495649_0001075 3300046694 Bacteria 21335
274 Ga0495649_0034801 3300046694 Bacteria 2771
275 Ga0495589_0000029 3300046794 Bacteria 173640
276 Ga0495589_0000412 3300046794 Bacteria 32186
277 Ga0495589_0004642 3300046794 Bacteria 7301
278 Ga0495589_0004670 3300046794 Bacteria 7277
279 Ga0495589_0017582 3300046794 Bacteria 3669
280 Ga0495589_0022862 3300046794 Bacteria 3187
281 Ga0495589_0047916 3300046794 Bacteria 2116
282 Ga0495600_0051846 3300046809 Bacteria 2678
283 Ga0495660_0000033 3300046810 Bacteria 212425
284 Ga0495660_0001565 3300046810 Bacteria 15370
285 Ga0495660_0028336 3300046810 Bacteria 3165
286 Ga0495660_0030974 3300046810 Bacteria 3010
287 Ga0495660_0039644 3300046810 Bacteria 2615
288 Ga0495660_0114847 3300046810 Bacteria 1369
289 Ga0495581_0021310 3300047315 Bacteria 3758
290 Ga0495581_0133328 3300047315 Bacteria 1448
291 Ga0495604_0024003 3300047317 Bacteria 4867
292 Ga0495604_0056156 3300047317 Bacteria 3032
293 Ga0495604_0087715 3300047317 Bacteria 2316
294 Ga0495636_0010393 3300047318 Bacteria 3675
295 Ga0495674_0128101 3300047319 Bacteria 2140
296 Ga0495672_0000179 3300047320 Bacteria 91327
297 Ga0495672_0000195 3300047320 Bacteria 86608
298 Ga0495672_0001941 3300047320 Bacteria 19548
299 Ga0495672_0010017 3300047320 Bacteria 6794
300 Ga0495672_0042526 3300047320 Bacteria 2739
301 Ga0495676_0000007 3300047321 Bacteria 276148
302 Ga0495676_0026967 3300047321 Bacteria 4935
303 Ga0495676_0192169 3300047321 Bacteria 1423
304 Ga0495680_0032659 3300047322 Bacteria 4222
305 Ga0495683_0000007 3300047323 Bacteria 268546
306 Ga0495683_0000017 3300047323 Bacteria 189599
307 Ga0495683_0000876 3300047323 Bacteria 21250
308 Ga0495683_0002794 3300047323 Bacteria 10377
309 Ga0495683_0027594 3300047323 Bacteria 2903
310 Ga0495683_0136594 3300047323 Bacteria 1152
311 Ga0495687_000003 3300047443 Bacteria 859509
312 Ga0495687_000092 3300047443 Bacteria 140313
313 Ga0495687_000647 3300047443 Bacteria 39948
314 Ga0495687_000728 3300047443 Bacteria 36269
315 Ga0495675_0009216 3300047444 Bacteria 6139
316 Ga0495675_0012131 3300047444 Bacteria 5421
317 Ga0495675_0017048 3300047444 Bacteria 4598
318 Ga0495677_0000001 3300047445 Bacteria 715000
319 Ga0495677_0000174 3300047445 Bacteria 30810
320 Ga0495677_0000467 3300047445 Bacteria 17308
321 Ga0495677_0000963 3300047445 Bacteria 11611
322 Ga0495677_0001080 3300047445 Bacteria 10946
323 Ga0495677_0001590 3300047445 Bacteria 9149
324 Ga0495677_0010345 3300047445 Bacteria 3427
325 Ga0495677_0037331 3300047445 Bacteria 1774
326 Ga0495677_0050106 3300047445 Bacteria 1536
327 Ga0495679_008022 3300047446 Bacteria 4337
328 Ga0495679_015141 3300047446 Bacteria 2830
329 Ga0495679_016038 3300047446 Bacteria 2720
330 Ga0495673_0010846 3300047469 Bacteria 4931
331 Ga0495681_0000067 3300047470 Bacteria 97630
332 Ga0495681_0000716 3300047470 Bacteria 25414
333 Ga0495681_0004339 3300047470 Bacteria 9698
334 Ga0495681_0009903 3300047470 Bacteria 5820
335 Ga0495681_0010450 3300047470 Bacteria 5618
336 Ga0495681_0018780 3300047470 Bacteria 3794
337 Ga0495681_0021543 3300047470 Bacteria 3469
338 Ga0495681_0021677 3300047470 Bacteria 3455
339 Ga0495686_0000015 3300047472 Bacteria 471703
340 Ga0495686_0013007 3300047472 Bacteria 5797
341 Ga0495593_0003053 3300047673 Bacteria 10089
342 Ga0495593_0026342 3300047673 Bacteria 3211
343 Ga0495602_0047634 3300048088 Bacteria 3860
344 Ga0495614_0034483 3300048089 Bacteria 2175
345 Ga0495614_0084127 3300048089 Bacteria 1380
346 Ga0495626_0000160 3300048091 Bacteria 83120
347 Ga0495626_0002317 3300048091 Bacteria 13462
348 Ga0495626_0002928 3300048091 Bacteria 11372
349 Ga0495626_0010315 3300048091 Bacteria 4998
350 Ga0495626_0013848 3300048091 Bacteria 4179
351 Ga0495626_0017868 3300048091 Bacteria 3575
352 Ga0495626_0023676 3300048091 Bacteria 3019
353 Ga0495626_0025266 3300048091 Bacteria 2906
354 Ga0495626_0028537 3300048091 Bacteria 2704
355 Ga0495626_0035793 3300048091 Bacteria 2368
356 Ga0495626_0045354 3300048091 Bacteria 2052
357 Ga0495626_0068604 3300048091 Bacteria 1598
358 Ga0496101_0085021 3300048904 Bacteria 2343
359 Ga0496102_0000077 3300048905 Bacteria 142501
360 Ga0496107_0010026 3300048910 Bacteria 6570
361 Ga0496107_0095709 3300048910 Bacteria 2173
362 Ga0496113_0001039 3300048916 Bacteria 14977
363 Ga0496115_0007494 3300048918 Bacteria 8032
364 Ga0496115_0046356 3300048918 Bacteria 3473
365 Ga0496115_0155248 3300048918 Bacteria 1891
366 Ga0496122_0016045 3300048925 Bacteria 7118
367 Ga0496122_0018143 3300048925 Bacteria 6518
368 Ga0496123_0002611 3300048926 Bacteria 21864
369 Ga0496123_0050625 3300048926 Bacteria 2774
370 Ga0496124_0004467 3300048927 Bacteria 16319
371 Ga0496124_0029184 3300048927 Bacteria 4920
372 Ga0496124_0034614 3300048927 Bacteria 4430
373 Ga0496124_0105015 3300048927 Bacteria 2283
374 Ga0495678_000048 3300049459 Bacteria 165744
375 Ga0495682_0001049 3300049460 Bacteria 16287
376 Ga0495682_0025493 3300049460 Bacteria 2200
377 Ga0495682_0045308 3300049460 Bacteria 1607
378 Ga0495682_0061384 3300049460 Bacteria 1357
379 Ga0501047_0399116 3300049581 Bacteria 1208
380 Ga0501044_0254381 3300049823 Bacteria 1696
381 Ga0466962_0033508 3300061719 Bacteria 2457
382 2643797497 2643221556 Bacteria 7251154
383 2644473961 2643221684 Bacteria 7145183
384 2809143444 2808606418 Bacteria 6724496
385 8047679589 8047673197 Bacteria 7395230
386 Ga0395899_0000012
387 Ga0055525_1000008
388 Ga0070660_100052075
389 Ga0070660_100052082
390 Ga0070660_100057112
391 Ga0070661_100053476
392 Ga0070664_100124674
393 Ga0068857_100267061
394 Ga0105242_10025355
395 Ga0209563_100003
396 Ga0209677_104448
397 Ga0209148_1000859
398 Ga0207671_10093172
399 Ga0207657_10002545
400 Ga0207657_10007863
401 Ga0207657_10183211
402 Ga0207690_10012073
403 Ga0207704_10138320
404 Ga0207679_10038314
405 Ga0207667_10079679
406 Ga0207698_10100910
407 Ga0316579_10034072
408 Ga0316576_10008354
409 Ga0316578_10104812
410 Ga0316577_10040418
411 Ga0316577_10083392
412 Ga0316580_10008174
413 Ga0316584_0045111
414 Ga0395899_0012506
415 Ga0395899_0020843
416 Ga0395899_0047762
417 Ga0395899_0052964
418 Ga0395899_0069239
419 Ga0395900_0000164
420 Ga0395900_0000177
421 Ga0395900_0002251
422 Ga0395900_0034539
423 Ga0395900_0061854
424 Ga0395900_0308146
425 Ga0395898_0011310
426 Ga0395898_0019197
427 Ga0395898_0029582
428 Ga0395898_0145821
429 Ga0395898_0172343
430 Ga0395905_0016637
431 Ga0395905_0083508
432 Ga0395905_0083708
433 Ga0395905_0153041
434 Ga0395905_0163982
435 Ga0395905_0361863
436 Ga0395901_0000226
437 Ga0395901_0000263
438 Ga0395901_0172886
439 Ga0395901_0254093
440 Ga0395901_0299154
441 Ga0439448_0000560
442 Ga0439448_0014968
443 Ga0439450_007972
444 Ga0450906_015665
445 Ga0466972_0001352
446 Ga0466981_0106832
447 Ga0466965_0002628
448 Ga0466966_0016291
449 Ga0466966_0028956
450 Ga0466961_0121754
451 Ga0466964_0001507
452 Ga0466964_0004235
453 Ga0466964_0046085
454 Ga0466968_0000193
455 Ga0466970_0015501
456 Ga0466957_0033733
457 Ga0466959_0022782
458 Ga0466959_0066559
459 Ga0495617_000080
460 Ga0495627_013061
461 Ga0495603_0017118
462 Ga0495590_0000015
463 Ga0495590_0000597
464 Ga0495590_0015954
465 Ga0495591_000033
466 Ga0495629_0175232
467 Ga0495638_0078852
468 Ga0495638_0080025
469 Ga0495653_0022052
470 Ga0495653_0025669
471 Ga0495653_0040820
472 Ga0495653_0114924
473 Ga0495650_0000089
474 Ga0495582_0007421
475 Ga0495605_0000227
476 Ga0495605_0007287
477 Ga0495605_0010365
478 Ga0495584_0000002
479 Ga0495584_0000287
480 Ga0495584_0007887
481 Ga0495584_0008578
482 Ga0495584_0009769
483 Ga0495584_0010662
484 Ga0495584_0020891
485 Ga0495584_0031292
486 Ga0495584_0037406
487 Ga0495584_0041900
488 Ga0495584_0113321
489 Ga0495585_0000003
490 Ga0495585_0000039
491 Ga0495585_0000257
492 Ga0495585_0000438
493 Ga0495585_0004737
494 Ga0495585_0005039
495 Ga0495585_0007236
496 Ga0495585_0012651
497 Ga0495585_0013296
498 Ga0495585_0015042
499 Ga0495585_0016041
500 Ga0495585_0036480
501 Ga0495585_0040647
502 Ga0495585_0047002
503 Ga0495585_0064378
504 Ga0495585_0073964
505 Ga0495594_0003855
506 Ga0495594_0014669
507 Ga0495594_0042471
508 Ga0495596_0000044
509 Ga0495596_0000578
510 Ga0495596_0000700
511 Ga0495596_0000826
512 Ga0495596_0001578
513 Ga0495596_0009633
514 Ga0495596_0026955
515 Ga0495596_0035438
516 Ga0495607_0000880
517 Ga0495607_0002059
518 Ga0495607_0004938
519 Ga0495607_0010252
520 Ga0495583_0000394
521 Ga0495583_0000999
522 Ga0495583_0001599
523 Ga0495583_0045646
524 Ga0495583_0073565
525 Ga0495583_0074470
526 Ga0495606_0003033
527 Ga0495606_0005979
528 Ga0495606_0020865
529 Ga0495606_0026978
530 Ga0495610_0007553
531 Ga0495616_0000510
532 Ga0495616_0000604
533 Ga0495616_0003546
534 Ga0495616_0006254
535 Ga0495616_0017256
536 Ga0495616_0018289
537 Ga0495616_0033623
538 Ga0495616_0079688
539 Ga0495620_0012981
540 Ga0495630_0076367
541 Ga0495631_0000658
542 Ga0495631_0005312
543 Ga0495631_0010143
544 Ga0495631_0024389
545 Ga0495631_0035007
546 Ga0495631_0035948
547 Ga0495631_0037985
548 Ga0495631_0080297
549 Ga0495632_0000221
550 Ga0495632_0001227
551 Ga0495632_0002215
552 Ga0495632_0005756
553 Ga0495632_0083950
554 Ga0495637_0000002
555 Ga0495637_0011152
556 Ga0495643_0012120
557 Ga0495643_0043598
558 Ga0495643_0059448
559 Ga0495644_0008703
560 Ga0495644_0009654
561 Ga0495644_0020745
562 Ga0495648_0000171
563 Ga0495648_0005144
564 Ga0495648_0121588
565 Ga0495663_0005967
566 Ga0495663_0045942
567 Ga0495666_0003856
568 Ga0495666_0003977
569 Ga0495666_0004994
570 Ga0495642_0000072
571 Ga0495642_0001991
572 Ga0495642_0008845
573 Ga0495642_0010915
574 Ga0495642_0052247
575 Ga0495642_0062162
576 Ga0495665_0000965
577 Ga0495665_0004756
578 Ga0495640_0023955
579 Ga0495586_0003424
580 Ga0495586_0007317
581 Ga0495586_0026948
582 Ga0495586_0049637
583 Ga0495587_0002125
584 Ga0495609_0000001
585 Ga0495609_0004256
586 Ga0495609_0004826
587 Ga0495609_0005660
588 Ga0495609_0008485
589 Ga0495609_0031112
590 Ga0495597_0001063
591 Ga0495597_0067604
592 Ga0495622_0005130
593 Ga0495622_0021217
594 Ga0495622_0035505
595 Ga0495633_0000965
596 Ga0495633_0001199
597 Ga0495633_0003390
598 Ga0495633_0006422
599 Ga0495633_0015241
600 Ga0495633_0019293
601 Ga0495633_0021495
602 Ga0495633_0027171
603 Ga0495633_0036555
604 Ga0495656_0008684
605 Ga0495656_0015190
606 Ga0495656_0028684
607 Ga0495668_0002078
608 Ga0495668_0011740
609 Ga0495668_0024700
610 Ga0495668_0073971
611 Ga0495634_0009218
612 Ga0495611_0003111
613 Ga0495611_0008265
614 Ga0495611_0010320
615 Ga0495611_0029632
616 Ga0495625_0006275
617 Ga0495625_0024619
618 Ga0495625_0191855
619 Ga0495635_0003013
620 Ga0495661_0000175
621 Ga0495661_0000260
622 Ga0495661_0001113
623 Ga0495661_0001774
624 Ga0495661_0005200
625 Ga0495661_0006754
626 Ga0495661_0011652
627 Ga0495661_0014010
628 Ga0495661_0023772
629 Ga0495661_0029279
630 Ga0495661_0039611
631 Ga0495661_0049731
632 Ga0495661_0086534
633 Ga0495588_0000095
634 Ga0495588_0001667
635 Ga0495588_0013175
636 Ga0495588_0024292
637 Ga0495588_0055829
638 Ga0495588_0063606
639 Ga0495588_0065742
640 Ga0495588_0066801
641 Ga0495599_0168749
642 Ga0495623_0002471
643 Ga0495623_0044983
644 Ga0495623_0102606
645 Ga0495669_0010822
646 Ga0495613_0038899
647 Ga0495624_0003855
648 Ga0495670_0000207
649 Ga0495670_0001373
650 Ga0495670_0001936
651 Ga0495670_0048170
652 Ga0495670_0084667
653 Ga0495670_0117673
654 Ga0495671_0000452
655 Ga0495671_0016292
656 Ga0495671_0049949
657 Ga0495649_0000024
658 Ga0495649_0001075
659 Ga0495649_0034801
660 Ga0495589_0000029
661 Ga0495589_0000412
662 Ga0495589_0004642
663 Ga0495589_0004670
664 Ga0495589_0017582
665 Ga0495589_0022862
666 Ga0495589_0047916
667 Ga0495600_0051846
668 Ga0495660_0000033
669 Ga0495660_0001565
670 Ga0495660_0028336
671 Ga0495660_0030974
672 Ga0495660_0039644
673 Ga0495660_0114847
674 Ga0495581_0021310
675 Ga0495581_0133328
676 Ga0495604_0024003
677 Ga0495604_0056156
678 Ga0495604_0087715
679 Ga0495636_0010393
680 Ga0495674_0128101
681 Ga0495672_0000179
682 Ga0495672_0000195
683 Ga0495672_0001941
684 Ga0495672_0010017
685 Ga0495672_0042526
686 Ga0495676_0000007
687 Ga0495676_0026967
688 Ga0495676_0192169
689 Ga0495680_0032659
690 Ga0495683_0000007
691 Ga0495683_0000017
692 Ga0495683_0000876
693 Ga0495683_0002794
694 Ga0495683_0027594
695 Ga0495683_0136594
696 Ga0495687_000003
697 Ga0495687_000092
698 Ga0495687_000647
699 Ga0495687_000728
700 Ga0495675_0009216
701 Ga0495675_0012131
702 Ga0495675_0017048
703 Ga0495677_0000001
704 Ga0495677_0000174
705 Ga0495677_0000467
706 Ga0495677_0000963
707 Ga0495677_0001080
708 Ga0495677_0001590
709 Ga0495677_0010345
710 Ga0495677_0037331
711 Ga0495677_0050106
712 Ga0495679_008022
713 Ga0495679_015141
714 Ga0495679_016038
715 Ga0495673_0010846
716 Ga0495681_0000067
717 Ga0495681_0000716
718 Ga0495681_0004339
719 Ga0495681_0009903
720 Ga0495681_0010450
721 Ga0495681_0018780
722 Ga0495681_0021543
723 Ga0495681_0021677
724 Ga0495686_0000015
725 Ga0495686_0013007
726 Ga0495593_0003053
727 Ga0495593_0026342
728 Ga0495602_0047634
729 Ga0495614_0034483
730 Ga0495614_0084127
731 Ga0495626_0000160
732 Ga0495626_0002317
733 Ga0495626_0002928
734 Ga0495626_0010315
735 Ga0495626_0013848
736 Ga0495626_0017868
737 Ga0495626_0023676
738 Ga0495626_0025266
739 Ga0495626_0028537
740 Ga0495626_0035793
741 Ga0495626_0045354
742 Ga0495626_0068604
743 Ga0496101_0085021
744 Ga0496102_0000077
745 Ga0496107_0010026
746 Ga0496107_0095709
747 Ga0496113_0001039
748 Ga0496115_0007494
749 Ga0496115_0046356
750 Ga0496115_0155248
751 Ga0496122_0016045
752 Ga0496122_0018143
753 Ga0496123_0002611
754 Ga0496123_0050625
755 Ga0496124_0004467
756 Ga0496124_0029184
757 Ga0496124_0034614
758 Ga0496124_0105015
759 Ga0495678_000048
760 Ga0495682_0001049
761 Ga0495682_0025493
762 Ga0495682_0045308
763 Ga0495682_0061384
764 Ga0501047_0399116
765 Ga0501044_0254381
766 Ga0466962_0033508
767 2643797497
768 2644473961
769 2809143444
770 8047679589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00924

MS_channel_2nd

Mechanosensitive ion channel, beta-domain

222

289

0.98

PF21088

MS_channel_1st

Mechanosensitive ion channel, transmembrane helices 2/3

180

221

0.95

PF21082

MS_channel_3rd

Mechanosensitive ion channel MscS, C-terminal

295

382

0.94

Map