F430271

General Info

Members Datasets Scaffolds Average Seq Length
385 218 770 132

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0690808|Ga0466963_0690808_12_437
Length 141
Sequence MAELFGPDMPLTDIPIFSMLRTRLEWAQSRQRVLAENVANSDTPNFRPRDLVPPKFDSLSAGAPRVQLATTESGHIPGLGAAGGDAFRTEREGAYDVRPTGNAVNLEDEMIKVAANQMDYQSVTALYTRSLNLLKTAIGKA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
213 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
214 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
215 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.83
Nodule 0
Rhizoplane 2.86
Rhizosphere 86.75
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0690808 3300044694 Bacteria 720
2 Ga0070658_10046282 3300005327 Bacteria 3520
3 Ga0070658_10060468 3300005327 Bacteria 3085
4 Ga0070658_10435621 3300005327 Bacteria 1128
5 Ga0070683_100292809 3300005329 Bacteria 1548
6 Ga0070680_100003355 3300005336 Bacteria 11953
7 Ga0070680_100006680 3300005336 Bacteria 8780
8 Ga0070660_100169240 3300005339 Bacteria 1764
9 Ga0070661_100262722 3300005344 Bacteria 1335
10 Ga0070661_100475798 3300005344 Bacteria 997
11 Ga0070659_100027792 3300005366 Bacteria 4361
12 Ga0070709_10480569 3300005434 Bacteria 941
13 Ga0070714_100034541 3300005435 Bacteria 4234
14 Ga0070714_100071193 3300005435 Bacteria 3006
15 Ga0070714_101848402 3300005435 Bacteria 590
16 Ga0070713_102105227 3300005436 Bacteria 547
17 Ga0070710_10312673 3300005437 Bacteria 1029
18 Ga0070711_100447224 3300005439 Bacteria 1057
19 Ga0070681_10198469 3300005458 Bacteria 1925
20 Ga0070681_10659364 3300005458 Bacteria 961
21 Ga0070679_100092737 3300005530 Bacteria 3007
22 Ga0070679_100118223 3300005530 Bacteria 2635
23 Ga0070679_100318237 3300005530 Bacteria 1505
24 Ga0070679_100495010 3300005530 Bacteria 1166
25 Ga0068855_100022437 3300005563 Bacteria 7567
26 Ga0068855_100041711 3300005563 Bacteria 5438
27 Ga0068855_100164434 3300005563 Bacteria 2516
28 Ga0068855_101709151 3300005563 Bacteria 641
29 Ga0068857_100266682 3300005577 Bacteria 1573
30 Ga0068854_100356205 3300005578 Bacteria 1199
31 Ga0068856_100164913 3300005614 Bacteria 2227
32 Ga0068856_100435378 3300005614 Bacteria 1331
33 Ga0068856_100695769 3300005614 Bacteria 1037
34 Ga0068852_100035922 3300005616 Bacteria 4140
35 Ga0068852_102347459 3300005616 Bacteria 554
36 Ga0068861_101558172 3300005719 Bacteria 650
37 Ga0081455_10855372 3300005937 Bacteria 568
38 Ga0070717_11282377 3300006028 Bacteria 666
39 Ga0075368_10283665 3300006042 Bacteria 712
40 Ga0075363_100639899 3300006048 Bacteria 639
41 Ga0070715_10486282 3300006163 Bacteria 704
42 Ga0070716_101465940 3300006173 Bacteria 557
43 Ga0070712_100339516 3300006175 Bacteria 1226
44 Ga0075367_10364833 3300006178 Bacteria 912
45 Ga0075367_10574999 3300006178 Bacteria 716
46 Ga0075367_10689451 3300006178 Bacteria 650
47 Ga0075366_10466257 3300006195 Bacteria 780
48 Ga0075370_10207655 3300006353 Bacteria 1156
49 Ga0075434_100069935 3300006871 Bacteria 3500
50 Ga0075434_102348061 3300006871 Bacteria 536
51 Ga0075429_100180468 3300006880 Bacteria 1850
52 Ga0075435_101516061 3300007076 Bacteria 588
53 Ga0099795_10000385 3300007788 Bacteria 8012
54 Ga0105240_10028630 3300009093 Bacteria 7272
55 Ga0105240_10789368 3300009093 Bacteria 1029
56 Ga0111539_10124404 3300009094 Bacteria 3022
57 Ga0111539_12394552 3300009094 Bacteria 612
58 Ga0105247_11465643 3300009101 Bacteria 555
59 Ga0114129_10020079 3300009147 Bacteria 9509
60 Ga0114129_10469536 3300009147 Bacteria 1648
61 Ga0105237_10150210 3300009545 Bacteria 2326
62 Ga0105238_10031150 3300009551 Bacteria 5429
63 Ga0105238_10876035 3300009551 Bacteria 916
64 Ga0099796_10001383 3300010159 Bacteria 4849
65 Ga0099796_10323043 3300010159 Unclassified 659
66 Ga0157371_10052092 3300013102 Bacteria 2907
67 Ga0157371_10606482 3300013102 Bacteria 814
68 Ga0157370_10025572 3300013104 Bacteria 5843
69 Ga0157370_11774176 3300013104 Bacteria 554
70 Ga0157369_11000578 3300013105 Bacteria 856
71 Ga0157378_10175972 3300013297 Bacteria 2010
72 Ga0157372_10410096 3300013307 Bacteria 1579
73 Ga0157372_11532340 3300013307 Bacteria 768
74 Ga0163163_11870092 3300014325 Bacteria 660
75 Ga0206356_10120254 3300020070 Bacteria 745
76 Ga0206353_10244068 3300020082 Bacteria 628
77 Ga0206353_10478658 3300020082 Bacteria 868
78 Ga0213875_10083212 3300021388 Bacteria 1493
79 Ga0209758_1066322 3300025297 Bacteria 1160
80 Ga0207692_10138361 3300025898 Bacteria 1382
81 Ga0207699_10334936 3300025906 Bacteria 1065
82 Ga0207705_10057145 3300025909 Bacteria 2814
83 Ga0207705_10067364 3300025909 Bacteria 2591
84 Ga0207705_10282975 3300025909 Bacteria 1270
85 Ga0207707_10014456 3300025912 Bacteria 6875
86 Ga0207707_10090669 3300025912 Bacteria 2671
87 Ga0207695_10178278 3300025913 Bacteria 2047
88 Ga0207695_10381671 3300025913 Bacteria 1295
89 Ga0207693_10411496 3300025915 Bacteria 1057
90 Ga0207663_10074868 3300025916 Bacteria 2195
91 Ga0207663_10206033 3300025916 Bacteria 1422
92 Ga0207660_10021504 3300025917 Bacteria 4338
93 Ga0207660_10034282 3300025917 Bacteria 3517
94 Ga0207657_10322038 3300025919 Bacteria 1222
95 Ga0207649_10156041 3300025920 Bacteria 1577
96 Ga0207649_10481835 3300025920 Bacteria 941
97 Ga0207649_10502876 3300025920 Bacteria 922
98 Ga0207652_10005948 3300025921 Bacteria 9871
99 Ga0207652_10017331 3300025921 Bacteria 5894
100 Ga0207652_10194199 3300025921 Bacteria 1826
101 Ga0207694_10126108 3300025924 Bacteria 2048
102 Ga0207700_10044410 3300025928 Bacteria 3271
103 Ga0207700_12006012 3300025928 Bacteria 505
104 Ga0207664_10165620 3300025929 Bacteria 1888
105 Ga0207664_10183127 3300025929 Bacteria 1799
106 Ga0207664_10930494 3300025929 Bacteria 780
107 Ga0207665_10095941 3300025939 Bacteria 2062
108 Ga0207665_10531196 3300025939 Bacteria 912
109 Ga0207661_10063330 3300025944 Bacteria 2995
110 Ga0207661_10143521 3300025944 Bacteria 2057
111 Ga0207667_10008346 3300025949 Bacteria 12310
112 Ga0207667_10083972 3300025949 Bacteria 3297
113 Ga0207667_10201848 3300025949 Bacteria 2040
114 Ga0207667_10378277 3300025949 Bacteria 1443
115 Ga0207667_10492473 3300025949 Bacteria 1244
116 Ga0207640_10029854 3300025981 Bacteria 3351
117 Ga0207702_10374417 3300026078 Bacteria 1368
118 Ga0207702_10755942 3300026078 Bacteria 960
119 Ga0207674_10260133 3300026116 Bacteria 1683
120 Ga0207698_10770294 3300026142 Bacteria 962
121 Ga0207698_11081361 3300026142 Bacteria 814
122 Ga0209179_1000387 3300027512 Bacteria 4348
123 Ga0265318_10056989 3300028577 Bacteria 1460
124 Ga0265338_10006337 3300028800 Bacteria 15116
125 Ga0265338_10209629 3300028800 Bacteria 1463
126 Ga0265338_10257907 3300028800 Bacteria 1283
127 Ga0265330_10279935 3300031235 Bacteria 703
128 Ga0265320_10150495 3300031240 Bacteria 1051
129 Ga0265325_10005357 3300031241 Bacteria 7934
130 Ga0265325_10124624 3300031241 Bacteria 1239
131 Ga0265325_10145267 3300031241 Bacteria 1125
132 Ga0265325_10385357 3300031241 Bacteria 615
133 Ga0265325_10477034 3300031241 Bacteria 542
134 Ga0265340_10023229 3300031247 Bacteria 3163
135 Ga0265340_10138823 3300031247 Bacteria 1112
136 Ga0265340_10558439 3300031247 Bacteria 504
137 Ga0265339_10001451 3300031249 Bacteria 17559
138 Ga0265339_10042812 3300031249 Bacteria 2506
139 Ga0265339_10509254 3300031249 Bacteria 555
140 Ga0265331_10057932 3300031250 Bacteria 1836
141 Ga0307408_100286477 3300031548 Bacteria 1374
142 Ga0265313_10000366 3300031595 Bacteria 49088
143 Ga0265313_10013962 3300031595 Bacteria 4781
144 Ga0265313_10104797 3300031595 Bacteria 1250
145 Ga0307508_10706992 3300031616 Bacteria 618
146 Ga0316579_10003088 3300031691 Bacteria 6422
147 Ga0265314_10001247 3300031711 Bacteria 29026
148 Ga0265314_10011299 3300031711 Bacteria 7383
149 Ga0265314_10098088 3300031711 Bacteria 1891
150 Ga0265314_10332983 3300031711 Bacteria 841
151 Ga0265342_10001039 3300031712 Bacteria 27198
152 Ga0265342_10004932 3300031712 Bacteria 10304
153 Ga0265342_10167004 3300031712 Bacteria 1213
154 Ga0307410_10530420 3300031852 Bacteria 973
155 Ga0307410_12078649 3300031852 Bacteria 508
156 Ga0307406_10622367 3300031901 Bacteria 893
157 Ga0307406_11602345 3300031901 Unclassified 575
158 Ga0307409_100466835 3300031995 Bacteria 1222
159 Ga0307409_100496677 3300031995 Bacteria 1187
160 Ga0307411_10765848 3300032005 Bacteria 847
161 Ga0307415_100353936 3300032126 Bacteria 1237
162 Ga0373934_0020106 3300035086 Bacteria 2566
163 Ga0373934_0033729 3300035086 Bacteria 2010
164 Ga0373944_0246998 3300035089 Bacteria 658
165 Ga0373923_0145480 3300035111 Bacteria 1073
166 Ga0373923_0164067 3300035111 Bacteria 1015
167 Ga0373936_0000545 3300035113 Bacteria 12908
168 Ga0373936_0266548 3300035113 Bacteria 768
169 Ga0373953_0013515 3300035117 Bacteria 2917
170 Ga0373954_0007849 3300035118 Bacteria 4674
171 Ga0373954_0041363 3300035118 Bacteria 2149
172 Ga0373956_0005348 3300035119 Bacteria 5138
173 Ga0373956_0010173 3300035119 Bacteria 3845
174 Ga0373957_0034400 3300035120 Bacteria 1876
175 Ga0373957_0067431 3300035120 Bacteria 1395
176 Ga0373957_0148983 3300035120 Bacteria 960
177 Ga0373943_0000449 3300035170 Bacteria 17431
178 Ga0373943_0086952 3300035170 Bacteria 1613
179 Ga0373946_0140154 3300035171 Bacteria 1120
180 Ga0373946_0184392 3300035171 Bacteria 992
181 Ga0373955_0000177 3300035172 Bacteria 26296
182 Ga0373955_0008083 3300035172 Bacteria 4865
183 Ga0373961_0409249 3300035241 Bacteria 522
184 Ga0373924_0000051 3300035410 Bacteria 29889
185 Ga0373924_0039127 3300035410 Bacteria 1937
186 Ga0373935_0000018 3300035692 Bacteria 68811
187 Ga0373927_0089864 3300035695 Bacteria 1994
188 Ga0373933_0001351 3300035724 Bacteria 14455
189 Ga0373947_0000264 3300035725 Bacteria 29727
190 Ga0373947_0253355 3300035725 Bacteria 1165
191 Ga0373947_1244469 3300035725 Bacteria 507
192 Ga0373937_0000571 3300036401 Bacteria 32663
193 Ga0373937_0004518 3300036401 Bacteria 11814
194 Ga0373937_0025258 3300036401 Bacteria 5364
195 Ga0373937_0552329 3300036401 Bacteria 1094
196 Ga0373925_0000018 3300037068 Bacteria 174213
197 Ga0373925_0037613 3300037068 Bacteria 3574
198 Ga0395898_0506835 3300037466 Bacteria 1148
199 Ga0316581_0047919 3300037588 Bacteria 1308
200 Ga0436364_0100714 3300037853 Bacteria 617
201 Ga0436364_0585319 3300037853 Bacteria 1564
202 Ga0436364_0865851 3300037853 Bacteria 2163
203 Ga0395901_0196888 3300038443 Bacteria 2113
204 Ga0451837_1385630 3300041494 Bacteria 883
205 Ga0466963_0072096 3300044694 Bacteria 2326
206 Ga0466963_0178112 3300044694 Bacteria 1484
207 Ga0466971_0212747 3300044719 Bacteria 915
208 Ga0466958_0913852 3300045836 Bacteria 573
209 Ga0466967_0112948 3300045976 Bacteria 2498
210 Ga0495617_262598 3300046452 Unclassified 531
211 Ga0495592_0000001 3300046454 Bacteria 305819
212 Ga0495592_0063289 3300046454 Bacteria 2714
213 Ga0495592_0537100 3300046454 Bacteria 721
214 Ga0495629_0012920 3300046459 Bacteria 6040
215 Ga0495629_0093680 3300046459 Bacteria 2096
216 Ga0495638_0015516 3300046460 Bacteria 5114
217 Ga0495638_0054703 3300046460 Bacteria 2480
218 Ga0495638_0535736 3300046460 Bacteria 584
219 Ga0495641_0087922 3300046461 Bacteria 1390
220 Ga0495651_0004527 3300046462 Bacteria 10630
221 Ga0495651_0285050 3300046462 Bacteria 1114
222 Ga0495651_0339286 3300046462 Bacteria 996
223 Ga0495653_0000015 3300046463 Bacteria 213697
224 Ga0495653_0579785 3300046463 Bacteria 691
225 Ga0495582_0106445 3300046473 Bacteria 1573
226 Ga0495582_0500845 3300046473 Bacteria 702
227 Ga0495662_0029207 3300046476 Bacteria 2662
228 Ga0495664_0000001 3300046477 Bacteria 757730
229 Ga0495608_0000116 3300046511 Bacteria 56633
230 Ga0495608_0062859 3300046511 Bacteria 2438
231 Ga0495618_0000021 3300046514 Bacteria 129750
232 Ga0495628_0000005 3300046516 Bacteria 420969
233 Ga0495630_0001024 3300046517 Bacteria 19309
234 Ga0495630_0676537 3300046517 Bacteria 790
235 Ga0495652_0000001 3300046529 Bacteria 1045081
236 Ga0495652_1060814 3300046529 Bacteria 528
237 Ga0495640_0000006 3300046533 Bacteria 285419
238 Ga0495586_0319318 3300046535 Bacteria 891
239 Ga0495587_0000012 3300046536 Bacteria 197088
240 Ga0495645_0000004 3300046543 Bacteria 532661
241 Ga0495667_0000001 3300046559 Bacteria 834831
242 Ga0495667_0017507 3300046559 Bacteria 4840
243 Ga0495667_0148765 3300046559 Bacteria 1508
244 Ga0495667_0183719 3300046559 Bacteria 1341
245 Ga0495634_0000388 3300046642 Bacteria 42999
246 Ga0495635_0000007 3300046663 Bacteria 278786
247 Ga0495635_0022386 3300046663 Bacteria 4401
248 Ga0495635_0125063 3300046663 Bacteria 1754
249 Ga0495635_0177818 3300046663 Bacteria 1447
250 Ga0495657_0000250 3300046675 Bacteria 48717
251 Ga0495657_0041194 3300046675 Bacteria 3163
252 Ga0495599_0000002 3300046678 Bacteria 348168
253 Ga0495623_0000116 3300046679 Bacteria 48662
254 Ga0495623_0344900 3300046679 Bacteria 813
255 Ga0495646_0000049 3300046680 Bacteria 60856
256 Ga0495658_0005862 3300046683 Bacteria 6032
257 Ga0495658_0284738 3300046683 Bacteria 1043
258 Ga0495613_0089361 3300046689 Bacteria 2232
259 Ga0495613_0217940 3300046689 Bacteria 1340
260 Ga0495624_0152493 3300046690 Bacteria 1413
261 Ga0495600_0000013 3300046809 Bacteria 119404
262 Ga0495600_0194807 3300046809 Bacteria 1302
263 Ga0495600_0411878 3300046809 Bacteria 840
264 Ga0495604_0000007 3300047317 Bacteria 412174
265 Ga0495604_0003594 3300047317 Bacteria 12361
266 Ga0495674_0000001 3300047319 Bacteria 778665
267 Ga0495672_0141240 3300047320 Bacteria 1258
268 Ga0495676_0978362 3300047321 Bacteria 540
269 Ga0495680_0004250 3300047322 Bacteria 13751
270 Ga0495680_0026226 3300047322 Bacteria 4809
271 Ga0495680_0054431 3300047322 Bacteria 3107
272 Ga0495675_0000014 3300047444 Bacteria 137646
273 Ga0495675_0037936 3300047444 Bacteria 3068
274 Ga0495675_0297258 3300047444 Bacteria 960
275 Ga0495675_0653581 3300047444 Bacteria 592
276 Ga0495684_0000219 3300047471 Bacteria 44380
277 Ga0495684_0222922 3300047471 Bacteria 1382
278 Ga0495593_0000454 3300047673 Bacteria 23017
279 Ga0495593_0166964 3300047673 Bacteria 1110
280 Ga0495593_0183684 3300047673 Bacteria 1053
281 Ga0495602_0000004 3300048088 Bacteria 326932
282 Ga0495602_0064297 3300048088 Bacteria 3173
283 Ga0495602_0470765 3300048088 Bacteria 883
284 Ga0496100_0212965 3300048903 Bacteria 1414
285 Ga0496102_0645104 3300048905 Bacteria 982
286 Ga0496104_0000361 3300048907 Bacteria 40378
287 Ga0496104_0010237 3300048907 Bacteria 8374
288 Ga0496105_0060767 3300048908 Bacteria 3118
289 Ga0496105_0205620 3300048908 Bacteria 1606
290 Ga0496108_0261864 3300048911 Bacteria 1505
291 Ga0496109_0108346 3300048912 Bacteria 2582
292 Ga0496112_0362549 3300048915 Bacteria 1391
293 Ga0496114_0451140 3300048917 Bacteria 1139
294 Ga0496115_0149323 3300048918 Bacteria 1929
295 Ga0501031_0453312 3300049568 Bacteria 828
296 Ga0501032_0017773 3300049569 Bacteria 4991
297 Ga0501032_0091981 3300049569 Bacteria 2012
298 Ga0501033_0129795 3300049570 Bacteria 1826
299 Ga0501033_0424003 3300049570 Bacteria 926
300 Ga0501033_0578496 3300049570 Bacteria 772
301 Ga0501034_0068995 3300049571 Bacteria 3546
302 Ga0501034_0081042 3300049571 Bacteria 3249
303 Ga0501034_0326010 3300049571 Bacteria 1468
304 Ga0501034_0335658 3300049571 Bacteria 1442
305 Ga0501034_0965862 3300049571 Bacteria 737
306 Ga0501036_0047287 3300049572 Bacteria 3644
307 Ga0501037_0018243 3300049573 Bacteria 5170
308 Ga0501037_0344212 3300049573 Bacteria 1029
309 Ga0501038_0010995 3300049574 Bacteria 8264
310 Ga0501038_0206403 3300049574 Bacteria 1574
311 Ga0501039_0311072 3300049575 Bacteria 1238
312 Ga0501043_0126242 3300049579 Bacteria 2006
313 Ga0501043_0476298 3300049579 Bacteria 935
314 Ga0501047_0047801 3300049581 Bacteria 4133
315 Ga0501047_0088045 3300049581 Bacteria 2982
316 Ga0501047_0091740 3300049581 Bacteria 2916
317 Ga0501047_0112825 3300049581 Bacteria 2600
318 Ga0501047_0168758 3300049581 Bacteria 2058
319 Ga0501047_0461026 3300049581 Bacteria 1100
320 Ga0501047_0962253 3300049581 Bacteria 667
321 Ga0501047_1128073 3300049581 Bacteria 597
322 Ga0501067_0099199 3300049583 Bacteria 1618
323 Ga0501070_0018376 3300049586 Bacteria 5866
324 Ga0501070_0035360 3300049586 Bacteria 4175
325 Ga0501070_0040714 3300049586 Bacteria 3874
326 Ga0501070_0318657 3300049586 Bacteria 1265
327 Ga0501070_0767209 3300049586 Bacteria 759
328 Ga0501070_1239766 3300049586 Bacteria 571
329 Ga0501071_0372201 3300049587 Bacteria 1089
330 Ga0501071_0564402 3300049587 Bacteria 874
331 Ga0501072_1213534 3300049588 Unclassified 586
332 Ga0501074_0061475 3300049590 Bacteria 2706
333 Ga0501075_0391969 3300049591 Bacteria 1059
334 Ga0501080_1228668 3300049742 Bacteria 643
335 Ga0501035_0095865 3300049822 Bacteria 2607
336 Ga0501035_0444509 3300049822 Bacteria 1073
337 Ga0501035_0701268 3300049822 Bacteria 816
338 Ga0501044_0026144 3300049823 Bacteria 6182
339 Ga0501044_0338301 3300049823 Bacteria 1426
340 Ga0501044_0354231 3300049823 Bacteria 1387
341 nmdc:mga03n38_655631_c1 3300050490 Bacteria 602
342 nmdc:mga0yw44_287138_c1 3300050492 Bacteria 1100
343 nmdc:mga0yw44_671607_c1 3300050492 Bacteria 704
344 nmdc:mga0k408_287573_c1 3300050493 Bacteria 981
345 nmdc:mga06z11_409300_c1 3300050494 Bacteria 817
346 nmdc:mga05p37_37142_c1 3300050507 Bacteria 5974
347 nmdc:mga09592_111289_c1 3300050508 Bacteria 2349
348 nmdc:mga09592_1712265_c1 3300050508 Bacteria 507
349 nmdc:mga08y16_1509637_c1 3300050511 Bacteria 632
350 nmdc:mga0n895_255310_c1 3300050512 Bacteria 1779
351 nmdc:mga0n895_37825_c1 3300050512 Bacteria 4671
352 nmdc:mga0n895_545069_c1 3300050512 Bacteria 1166
353 nmdc:mga0rr50_100972_c1 3300050513 Bacteria 2267
354 nmdc:mga0rr50_1472687_c1 3300050513 Bacteria 576
355 Ga0495601_0000006 3300053077 Bacteria 373770
356 Ga0495601_0000255 3300053077 Bacteria 28587
357 Ga0495612_0000004 3300053078 Bacteria 286946
358 Ga0495595_0000006 3300053084 Bacteria 231295
359 Ga0495595_0003045 3300053084 Bacteria 6628
360 Ga0495595_0008241 3300053084 Bacteria 4280
361 Ga0495619_0000161 3300053085 Bacteria 49400
362 Ga0495619_0000240 3300053085 Bacteria 39732
363 Ga0495619_0244465 3300053085 Bacteria 1243
364 Ga0500643_006735 3300053087 Bacteria 4748
365 Ga0500643_043807 3300053087 Bacteria 1303
366 Ga0500644_0001049 3300053088 Bacteria 8235
367 Ga0500646_0038208 3300053090 Bacteria 1343
368 Ga0500651_0146297 3300053093 Bacteria 1421
369 Ga0500641_0176771 3300053096 Unclassified 917
370 Ga0500650_0142074 3300053098 Bacteria 1113
371 Ga0500572_085009 3300053111 Bacteria 996
372 Ga0500594_0056729 3300053118 Bacteria 1118
373 Ga0500595_000056 3300053119 Bacteria 83521
374 Ga0500642_0100340 3300053130 Bacteria 1346
375 Ga0500652_001412 3300053131 Bacteria 7464
376 Ga0500658_0355223 3300053134 Bacteria 672
377 Ga0500573_0192313 3300053140 Bacteria 1089
378 Ga0500573_0330939 3300053140 Bacteria 748
379 Ga0500577_0107259 3300053142 Bacteria 1149
380 Ga0500577_0140466 3300053142 Bacteria 1018
381 Ga0500588_0015632 3300053146 Bacteria 1948
382 Ga0500604_0048992 3300053151 Bacteria 1298
383 Ga0500616_0000006 3300053153 Bacteria 944738
384 Ga0500645_000384 3300053730 Bacteria 30994
385 Ga0501082_0206352 3300060353 Bacteria 1710
386 Ga0466963_0690808
387 Ga0070658_10046282
388 Ga0070658_10060468
389 Ga0070658_10435621
390 Ga0070683_100292809
391 Ga0070680_100003355
392 Ga0070680_100006680
393 Ga0070660_100169240
394 Ga0070661_100262722
395 Ga0070661_100475798
396 Ga0070659_100027792
397 Ga0070709_10480569
398 Ga0070714_100034541
399 Ga0070714_100071193
400 Ga0070714_101848402
401 Ga0070713_102105227
402 Ga0070710_10312673
403 Ga0070711_100447224
404 Ga0070681_10198469
405 Ga0070681_10659364
406 Ga0070679_100092737
407 Ga0070679_100118223
408 Ga0070679_100318237
409 Ga0070679_100495010
410 Ga0068855_100022437
411 Ga0068855_100041711
412 Ga0068855_100164434
413 Ga0068855_101709151
414 Ga0068857_100266682
415 Ga0068854_100356205
416 Ga0068856_100164913
417 Ga0068856_100435378
418 Ga0068856_100695769
419 Ga0068852_100035922
420 Ga0068852_102347459
421 Ga0068861_101558172
422 Ga0081455_10855372
423 Ga0070717_11282377
424 Ga0075368_10283665
425 Ga0075363_100639899
426 Ga0070715_10486282
427 Ga0070716_101465940
428 Ga0070712_100339516
429 Ga0075367_10364833
430 Ga0075367_10574999
431 Ga0075367_10689451
432 Ga0075366_10466257
433 Ga0075370_10207655
434 Ga0075434_100069935
435 Ga0075434_102348061
436 Ga0075429_100180468
437 Ga0075435_101516061
438 Ga0099795_10000385
439 Ga0105240_10028630
440 Ga0105240_10789368
441 Ga0111539_10124404
442 Ga0111539_12394552
443 Ga0105247_11465643
444 Ga0114129_10020079
445 Ga0114129_10469536
446 Ga0105237_10150210
447 Ga0105238_10031150
448 Ga0105238_10876035
449 Ga0099796_10001383
450 Ga0099796_10323043
451 Ga0157371_10052092
452 Ga0157371_10606482
453 Ga0157370_10025572
454 Ga0157370_11774176
455 Ga0157369_11000578
456 Ga0157378_10175972
457 Ga0157372_10410096
458 Ga0157372_11532340
459 Ga0163163_11870092
460 Ga0206356_10120254
461 Ga0206353_10244068
462 Ga0206353_10478658
463 Ga0213875_10083212
464 Ga0209758_1066322
465 Ga0207692_10138361
466 Ga0207699_10334936
467 Ga0207705_10057145
468 Ga0207705_10067364
469 Ga0207705_10282975
470 Ga0207707_10014456
471 Ga0207707_10090669
472 Ga0207695_10178278
473 Ga0207695_10381671
474 Ga0207693_10411496
475 Ga0207663_10074868
476 Ga0207663_10206033
477 Ga0207660_10021504
478 Ga0207660_10034282
479 Ga0207657_10322038
480 Ga0207649_10156041
481 Ga0207649_10481835
482 Ga0207649_10502876
483 Ga0207652_10005948
484 Ga0207652_10017331
485 Ga0207652_10194199
486 Ga0207694_10126108
487 Ga0207700_10044410
488 Ga0207700_12006012
489 Ga0207664_10165620
490 Ga0207664_10183127
491 Ga0207664_10930494
492 Ga0207665_10095941
493 Ga0207665_10531196
494 Ga0207661_10063330
495 Ga0207661_10143521
496 Ga0207667_10008346
497 Ga0207667_10083972
498 Ga0207667_10201848
499 Ga0207667_10378277
500 Ga0207667_10492473
501 Ga0207640_10029854
502 Ga0207702_10374417
503 Ga0207702_10755942
504 Ga0207674_10260133
505 Ga0207698_10770294
506 Ga0207698_11081361
507 Ga0209179_1000387
508 Ga0265318_10056989
509 Ga0265338_10006337
510 Ga0265338_10209629
511 Ga0265338_10257907
512 Ga0265330_10279935
513 Ga0265320_10150495
514 Ga0265325_10005357
515 Ga0265325_10124624
516 Ga0265325_10145267
517 Ga0265325_10385357
518 Ga0265325_10477034
519 Ga0265340_10023229
520 Ga0265340_10138823
521 Ga0265340_10558439
522 Ga0265339_10001451
523 Ga0265339_10042812
524 Ga0265339_10509254
525 Ga0265331_10057932
526 Ga0307408_100286477
527 Ga0265313_10000366
528 Ga0265313_10013962
529 Ga0265313_10104797
530 Ga0307508_10706992
531 Ga0316579_10003088
532 Ga0265314_10001247
533 Ga0265314_10011299
534 Ga0265314_10098088
535 Ga0265314_10332983
536 Ga0265342_10001039
537 Ga0265342_10004932
538 Ga0265342_10167004
539 Ga0307410_10530420
540 Ga0307410_12078649
541 Ga0307406_10622367
542 Ga0307406_11602345
543 Ga0307409_100466835
544 Ga0307409_100496677
545 Ga0307411_10765848
546 Ga0307415_100353936
547 Ga0373934_0020106
548 Ga0373934_0033729
549 Ga0373944_0246998
550 Ga0373923_0145480
551 Ga0373923_0164067
552 Ga0373936_0000545
553 Ga0373936_0266548
554 Ga0373953_0013515
555 Ga0373954_0007849
556 Ga0373954_0041363
557 Ga0373956_0005348
558 Ga0373956_0010173
559 Ga0373957_0034400
560 Ga0373957_0067431
561 Ga0373957_0148983
562 Ga0373943_0000449
563 Ga0373943_0086952
564 Ga0373946_0140154
565 Ga0373946_0184392
566 Ga0373955_0000177
567 Ga0373955_0008083
568 Ga0373961_0409249
569 Ga0373924_0000051
570 Ga0373924_0039127
571 Ga0373935_0000018
572 Ga0373927_0089864
573 Ga0373933_0001351
574 Ga0373947_0000264
575 Ga0373947_0253355
576 Ga0373947_1244469
577 Ga0373937_0000571
578 Ga0373937_0004518
579 Ga0373937_0025258
580 Ga0373937_0552329
581 Ga0373925_0000018
582 Ga0373925_0037613
583 Ga0395898_0506835
584 Ga0316581_0047919
585 Ga0436364_0100714
586 Ga0436364_0585319
587 Ga0436364_0865851
588 Ga0395901_0196888
589 Ga0451837_1385630
590 Ga0466963_0072096
591 Ga0466963_0178112
592 Ga0466971_0212747
593 Ga0466958_0913852
594 Ga0466967_0112948
595 Ga0495617_262598
596 Ga0495592_0000001
597 Ga0495592_0063289
598 Ga0495592_0537100
599 Ga0495629_0012920
600 Ga0495629_0093680
601 Ga0495638_0015516
602 Ga0495638_0054703
603 Ga0495638_0535736
604 Ga0495641_0087922
605 Ga0495651_0004527
606 Ga0495651_0285050
607 Ga0495651_0339286
608 Ga0495653_0000015
609 Ga0495653_0579785
610 Ga0495582_0106445
611 Ga0495582_0500845
612 Ga0495662_0029207
613 Ga0495664_0000001
614 Ga0495608_0000116
615 Ga0495608_0062859
616 Ga0495618_0000021
617 Ga0495628_0000005
618 Ga0495630_0001024
619 Ga0495630_0676537
620 Ga0495652_0000001
621 Ga0495652_1060814
622 Ga0495640_0000006
623 Ga0495586_0319318
624 Ga0495587_0000012
625 Ga0495645_0000004
626 Ga0495667_0000001
627 Ga0495667_0017507
628 Ga0495667_0148765
629 Ga0495667_0183719
630 Ga0495634_0000388
631 Ga0495635_0000007
632 Ga0495635_0022386
633 Ga0495635_0125063
634 Ga0495635_0177818
635 Ga0495657_0000250
636 Ga0495657_0041194
637 Ga0495599_0000002
638 Ga0495623_0000116
639 Ga0495623_0344900
640 Ga0495646_0000049
641 Ga0495658_0005862
642 Ga0495658_0284738
643 Ga0495613_0089361
644 Ga0495613_0217940
645 Ga0495624_0152493
646 Ga0495600_0000013
647 Ga0495600_0194807
648 Ga0495600_0411878
649 Ga0495604_0000007
650 Ga0495604_0003594
651 Ga0495674_0000001
652 Ga0495672_0141240
653 Ga0495676_0978362
654 Ga0495680_0004250
655 Ga0495680_0026226
656 Ga0495680_0054431
657 Ga0495675_0000014
658 Ga0495675_0037936
659 Ga0495675_0297258
660 Ga0495675_0653581
661 Ga0495684_0000219
662 Ga0495684_0222922
663 Ga0495593_0000454
664 Ga0495593_0166964
665 Ga0495593_0183684
666 Ga0495602_0000004
667 Ga0495602_0064297
668 Ga0495602_0470765
669 Ga0496100_0212965
670 Ga0496102_0645104
671 Ga0496104_0000361
672 Ga0496104_0010237
673 Ga0496105_0060767
674 Ga0496105_0205620
675 Ga0496108_0261864
676 Ga0496109_0108346
677 Ga0496112_0362549
678 Ga0496114_0451140
679 Ga0496115_0149323
680 Ga0501031_0453312
681 Ga0501032_0017773
682 Ga0501032_0091981
683 Ga0501033_0129795
684 Ga0501033_0424003
685 Ga0501033_0578496
686 Ga0501034_0068995
687 Ga0501034_0081042
688 Ga0501034_0326010
689 Ga0501034_0335658
690 Ga0501034_0965862
691 Ga0501036_0047287
692 Ga0501037_0018243
693 Ga0501037_0344212
694 Ga0501038_0010995
695 Ga0501038_0206403
696 Ga0501039_0311072
697 Ga0501043_0126242
698 Ga0501043_0476298
699 Ga0501047_0047801
700 Ga0501047_0088045
701 Ga0501047_0091740
702 Ga0501047_0112825
703 Ga0501047_0168758
704 Ga0501047_0461026
705 Ga0501047_0962253
706 Ga0501047_1128073
707 Ga0501067_0099199
708 Ga0501070_0018376
709 Ga0501070_0035360
710 Ga0501070_0040714
711 Ga0501070_0318657
712 Ga0501070_0767209
713 Ga0501070_1239766
714 Ga0501071_0372201
715 Ga0501071_0564402
716 Ga0501072_1213534
717 Ga0501074_0061475
718 Ga0501075_0391969
719 Ga0501080_1228668
720 Ga0501035_0095865
721 Ga0501035_0444509
722 Ga0501035_0701268
723 Ga0501044_0026144
724 Ga0501044_0338301
725 Ga0501044_0354231
726 nmdc:mga03n38_655631_c1
727 nmdc:mga0yw44_287138_c1
728 nmdc:mga0yw44_671607_c1
729 nmdc:mga0k408_287573_c1
730 nmdc:mga06z11_409300_c1
731 nmdc:mga05p37_37142_c1
732 nmdc:mga09592_111289_c1
733 nmdc:mga09592_1712265_c1
734 nmdc:mga08y16_1509637_c1
735 nmdc:mga0n895_255310_c1
736 nmdc:mga0n895_37825_c1
737 nmdc:mga0n895_545069_c1
738 nmdc:mga0rr50_100972_c1
739 nmdc:mga0rr50_1472687_c1
740 Ga0495601_0000006
741 Ga0495601_0000255
742 Ga0495612_0000004
743 Ga0495595_0000006
744 Ga0495595_0003045
745 Ga0495595_0008241
746 Ga0495619_0000161
747 Ga0495619_0000240
748 Ga0495619_0244465
749 Ga0500643_006735
750 Ga0500643_043807
751 Ga0500644_0001049
752 Ga0500646_0038208
753 Ga0500651_0146297
754 Ga0500641_0176771
755 Ga0500650_0142074
756 Ga0500572_085009
757 Ga0500594_0056729
758 Ga0500595_000056
759 Ga0500642_0100340
760 Ga0500652_001412
761 Ga0500658_0355223
762 Ga0500573_0192313
763 Ga0500573_0330939
764 Ga0500577_0107259
765 Ga0500577_0140466
766 Ga0500588_0015632
767 Ga0500604_0048992
768 Ga0500616_0000006
769 Ga0500645_000384
770 Ga0501082_0206352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

19

47

0.88

Map