F430286

General Info

Members Datasets Scaffolds Average Seq Length
385 173 770 191

Family's Representative Sequence

Representative Sequence 3300046500|Ga0495596_0008903|Ga0495596_0008903_3692_4375
Length 227
Sequence MKQLFMFCQVYPIEPNIYSGLRRCFGERNQDHYRMTIMKIKHIIALLATAASSAAFAADTYTIEPNHTYPSFEADHMGGLSFWRGKFTKTAGTITLDRAARTGAVEITIDTDSIDFGNAKLNEHVMSPEMFDVVKYPKAVYKSASIQFKGDKPAIVNGDLTLHGVTRPVKLVIDHFKCMPHPMFKREVCGANAVATFNRSDFGISYGTQMGFSPEVKLAIQVEALKQ

Samples

Sample ID Description Type Environment
1 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
41 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
75 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
76 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
77 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
161 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
162 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
163 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
164 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
165 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
166 2842711865 Duganella sp. R-73148 Isolate Unclassified
167 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
168 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
169 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
170 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
171 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
172 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
173 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 0.78
Isolates 3.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 1.56
Rhizoplane 1.3
Rhizosphere 84.94
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495596_0008903 3300046500 Bacteria 4440
2 JGI25155J39150_1000142 3300002704 Bacteria 33693
3 JGI25155J39150_1000219 3300002704 Bacteria 22984
4 JGI25156J39149_1000497 3300002705 Bacteria 23452
5 JGI25156J39149_1003054 3300002705 Bacteria 5671
6 JGI25162J39368_1005347 3300002737 Bacteria 2559
7 JGI25154J39366_1000423 3300002738 Bacteria 22650
8 JGI25154J39366_1000432 3300002738 Bacteria 22245
9 JGI25157J39369_1000158 3300002741 Bacteria 56328
10 JGI25157J39369_1000203 3300002741 Bacteria 49480
11 Ga0006758J48902_1012612 3300003300 Bacteria 707
12 Ga0006770J48903_1051480 3300003305 Bacteria 624
13 Ga0055532_1000005 3300003758 Bacteria 458107
14 Ga0055526_1015070 3300003771 Bacteria 3127
15 Ga0070670_100000002 3300005331 Bacteria 568775
16 Ga0070666_10015072 3300005335 Bacteria 4926
17 Ga0070669_100005576 3300005353 Bacteria 9091
18 Ga0070671_100000025 3300005355 Bacteria 121912
19 Ga0070688_100004285 3300005365 Bacteria 7416
20 Ga0070667_100000394 3300005367 Bacteria 47270
21 Ga0070685_10000005 3300005466 Bacteria 190119
22 Ga0070665_100150604 3300005548 Bacteria 2329
23 Ga0068855_100106549 3300005563 Bacteria 3222
24 Ga0068857_100623394 3300005577 Bacteria 1021
25 Ga0068859_100041050 3300005617 Bacteria 4648
26 Ga0068864_100000003 3300005618 Bacteria 568775
27 Ga0068861_100004915 3300005719 Bacteria 9003
28 Ga0068863_101042396 3300005841 Unclassified 821
29 Ga0068860_100000326 3300005843 Bacteria 64692
30 Ga0068862_100068501 3300005844 Bacteria 3061
31 Ga0070712_100003941 3300006175 Bacteria 9138
32 Ga0075370_10239156 3300006353 Bacteria 1075
33 Ga0097620_100041051 3300006931 Bacteria 4648
34 Ga0105251_10015285 3300009011 Bacteria 4203
35 Ga0105251_10076868 3300009011 Bacteria 1549
36 Ga0105240_10003355 3300009093 Bacteria 24916
37 Ga0105238_10035298 3300009551 Bacteria 5084
38 Ga0157373_10065917 3300013100 Bacteria 2562
39 Ga0163162_10507823 3300013306 Bacteria 1336
40 Ga0163162_10651076 3300013306 Bacteria 1177
41 Ga0163163_10000136 3300014325 Bacteria 75532
42 Ga0157380_10004535 3300014326 Bacteria 9640
43 Ga0157380_10458164 3300014326 Bacteria 1227
44 Ga0182008_10022337 3300014497 Bacteria 3241
45 Ga0182006_1003847 3300015261 Bacteria 7537
46 Ga0182007_10027096 3300015262 Bacteria 1979
47 Ga0209435_100004 3300025206 Bacteria 633417
48 Ga0209435_100214 3300025206 Bacteria 16487
49 Ga0209147_100011 3300025229 Bacteria 702140
50 Ga0209437_100084 3300025233 Bacteria 255423
51 Ga0209437_101166 3300025233 Bacteria 7812
52 Ga0209258_100560 3300025242 Bacteria 32331
53 Ga0209646_1000032 3300025246 Bacteria 375315
54 Ga0209646_1000114 3300025246 Bacteria 152958
55 Ga0209646_1000283 3300025246 Bacteria 44163
56 Ga0209026_1000062 3300025250 Bacteria 213298
57 Ga0209026_1001071 3300025250 Bacteria 13234
58 Ga0209026_1008799 3300025250 Bacteria 2060
59 Ga0209759_1000054 3300025256 Bacteria 211422
60 Ga0209759_1000548 3300025256 Bacteria 38674
61 Ga0209759_1026395 3300025256 Bacteria 1218
62 Ga0209455_1012314 3300025272 Bacteria 2054
63 Ga0209025_1004468 3300025294 Bacteria 12144
64 Ga0209564_1000006 3300025295 Bacteria 1100927
65 Ga0209051_1025547 3300025303 Bacteria 2400
66 Ga0207713_1061014 3300025735 Bacteria 1437
67 Ga0207680_10007523 3300025903 Bacteria 5318
68 Ga0207695_10001902 3300025913 Bacteria 32583
69 Ga0207693_10019007 3300025915 Bacteria 5469
70 Ga0207681_10000156 3300025923 Bacteria 56382
71 Ga0207694_10083481 3300025924 Bacteria 2512
72 Ga0207650_10000003 3300025925 Bacteria 1123235
73 Ga0207644_10000312 3300025931 Bacteria 31641
74 Ga0207711_10002080 3300025941 Bacteria 18084
75 Ga0207711_10008967 3300025941 Bacteria 8363
76 Ga0207667_10087097 3300025949 Bacteria 3231
77 Ga0207658_10000004 3300025986 Bacteria 569357
78 Ga0207641_10190748 3300026088 Bacteria 1883
79 Ga0207676_10000003 3300026095 Bacteria 1123235
80 Ga0207674_10193579 3300026116 Bacteria 1983
81 Ga0207675_100006059 3300026118 Bacteria 11506
82 Ga0207698_10002422 3300026142 Bacteria 11040
83 Ga0209282_1000063 3300027666 Bacteria 93789
84 Ga0268266_10060143 3300028379 Bacteria 3274
85 Ga0268265_10001641 3300028380 Bacteria 18332
86 Ga0268264_10000123 3300028381 Bacteria 189361
87 Ga0265314_10098343 3300031711 Bacteria 1888
88 Ga0307406_10311556 3300031901 Bacteria 1214
89 Ga0395905_0000589 3300037471 Bacteria 48792
90 Ga0450904_000854 3300042139 Bacteria 5015
91 Ga0439459_0135096 3300042438 Bacteria 633
92 Ga0495617_000012 3300046452 Bacteria 295916
93 Ga0495617_008715 3300046452 Bacteria 3491
94 Ga0495627_000118 3300046453 Bacteria 99480
95 Ga0495603_0045499 3300046455 Bacteria 2617
96 Ga0495590_0000030 3300046457 Bacteria 146237
97 Ga0495590_0027219 3300046457 Bacteria 2006
98 Ga0495629_0350841 3300046459 Bacteria 1006
99 Ga0495638_0000105 3300046460 Bacteria 134384
100 Ga0495651_0156487 3300046462 Bacteria 1637
101 Ga0495653_0148065 3300046463 Bacteria 1643
102 Ga0495650_0000099 3300046471 Bacteria 215347
103 Ga0495650_0000213 3300046471 Bacteria 123910
104 Ga0495650_0003278 3300046471 Bacteria 11987
105 Ga0495580_0013872 3300046472 Bacteria 6136
106 Ga0495580_0057052 3300046472 Bacteria 2749
107 Ga0495580_0140293 3300046472 Bacteria 1675
108 Ga0495582_0188117 3300046473 Bacteria 1177
109 Ga0495605_0000040 3300046474 Bacteria 193955
110 Ga0495605_0000072 3300046474 Bacteria 133731
111 Ga0495605_0027676 3300046474 Bacteria 2935
112 Ga0495605_0118435 3300046474 Bacteria 1202
113 Ga0495605_0158535 3300046474 Bacteria 1005
114 Ga0495605_0181183 3300046474 Bacteria 926
115 Ga0495639_0034332 3300046475 Bacteria 2268
116 Ga0495584_0000381 3300046491 Bacteria 30594
117 Ga0495584_0007663 3300046491 Bacteria 5625
118 Ga0495584_0016136 3300046491 Bacteria 3810
119 Ga0495584_0018145 3300046491 Bacteria 3577
120 Ga0495584_0089558 3300046491 Bacteria 1551
121 Ga0495585_0000531 3300046492 Bacteria 36056
122 Ga0495585_0000742 3300046492 Bacteria 29008
123 Ga0495585_0051712 3300046492 Bacteria 2276
124 Ga0495585_0074964 3300046492 Bacteria 1840
125 Ga0495585_0123889 3300046492 Bacteria 1365
126 Ga0495585_0169984 3300046492 Bacteria 1126
127 Ga0495585_0240977 3300046492 Bacteria 905
128 Ga0495594_0009587 3300046499 Bacteria 5005
129 Ga0495594_0137793 3300046499 Bacteria 1383
130 Ga0495594_0274684 3300046499 Bacteria 960
131 Ga0495596_0000029 3300046500 Bacteria 103615
132 Ga0495596_0000243 3300046500 Bacteria 36829
133 Ga0495596_0001487 3300046500 Bacteria 13398
134 Ga0495596_0003835 3300046500 Bacteria 7475
135 Ga0495596_0004139 3300046500 Bacteria 7133
136 Ga0495596_0008897 3300046500 Bacteria 4441
137 Ga0495596_0017721 3300046500 Bacteria 2944
138 Ga0495596_0034377 3300046500 Bacteria 2013
139 Ga0495607_0001726 3300046501 Bacteria 18722
140 Ga0495607_0003190 3300046501 Bacteria 12670
141 Ga0495607_0005992 3300046501 Bacteria 8618
142 Ga0495607_0015552 3300046501 Bacteria 4929
143 Ga0495607_0292840 3300046501 Bacteria 768
144 Ga0495607_0352359 3300046501 Bacteria 679
145 Ga0495583_0000202 3300046506 Bacteria 100020
146 Ga0495583_0070195 3300046506 Bacteria 1541
147 Ga0495583_0093194 3300046506 Bacteria 1294
148 Ga0495583_0190658 3300046506 Bacteria 836
149 Ga0495606_0000316 3300046507 Bacteria 83307
150 Ga0495606_0002713 3300046507 Bacteria 19956
151 Ga0495606_0058502 3300046507 Bacteria 2477
152 Ga0495606_0158039 3300046507 Bacteria 1325
153 Ga0495606_0167586 3300046507 Bacteria 1277
154 Ga0495606_0181806 3300046507 Bacteria 1212
155 Ga0495610_0160590 3300046512 Bacteria 950
156 Ga0495616_0000034 3300046513 Bacteria 129394
157 Ga0495616_0000195 3300046513 Bacteria 50559
158 Ga0495616_0000388 3300046513 Bacteria 34173
159 Ga0495616_0005661 3300046513 Bacteria 7652
160 Ga0495616_0012532 3300046513 Bacteria 4810
161 Ga0495616_0019800 3300046513 Bacteria 3669
162 Ga0495616_0230667 3300046513 Bacteria 802
163 Ga0495616_0269061 3300046513 Bacteria 727
164 Ga0495628_0006086 3300046516 Bacteria 10550
165 Ga0495631_0004538 3300046518 Bacteria 7376
166 Ga0495631_0004913 3300046518 Bacteria 7044
167 Ga0495631_0020774 3300046518 Bacteria 3063
168 Ga0495631_0053700 3300046518 Bacteria 1758
169 Ga0495631_0082686 3300046518 Bacteria 1384
170 Ga0495632_0000033 3300046519 Bacteria 164240
171 Ga0495632_0000086 3300046519 Bacteria 95327
172 Ga0495632_0000156 3300046519 Bacteria 70702
173 Ga0495632_0000853 3300046519 Bacteria 26790
174 Ga0495637_0015198 3300046520 Bacteria 3614
175 Ga0495637_0027323 3300046520 Bacteria 2555
176 Ga0495637_0063924 3300046520 Bacteria 1502
177 Ga0495643_0000181 3300046522 Bacteria 100368
178 Ga0495643_0000742 3300046522 Bacteria 37024
179 Ga0495643_0000937 3300046522 Bacteria 30281
180 Ga0495643_0006199 3300046522 Bacteria 7936
181 Ga0495643_0006905 3300046522 Bacteria 7391
182 Ga0495643_0079419 3300046522 Bacteria 1710
183 Ga0495643_0267024 3300046522 Bacteria 792
184 Ga0495644_0002270 3300046523 Bacteria 7688
185 Ga0495644_0033422 3300046523 Bacteria 1943
186 Ga0495644_0046599 3300046523 Bacteria 1629
187 Ga0495644_0102851 3300046523 Bacteria 1081
188 Ga0495648_0000008 3300046524 Bacteria 336584
189 Ga0495648_0000116 3300046524 Bacteria 98123
190 Ga0495648_0000505 3300046524 Bacteria 41982
191 Ga0495648_0003863 3300046524 Bacteria 12994
192 Ga0495648_0005481 3300046524 Bacteria 10528
193 Ga0495648_0007837 3300046524 Bacteria 8495
194 Ga0495648_0019819 3300046524 Bacteria 4712
195 Ga0495648_0037553 3300046524 Bacteria 3110
196 Ga0495648_0064574 3300046524 Bacteria 2156
197 Ga0495663_0001491 3300046525 Bacteria 7361
198 Ga0495666_0000508 3300046526 Bacteria 17311
199 Ga0495666_0019873 3300046526 Bacteria 3331
200 Ga0495642_0000010 3300046528 Bacteria 136557
201 Ga0495642_0000218 3300046528 Bacteria 33005
202 Ga0495642_0000459 3300046528 Bacteria 21479
203 Ga0495642_0002734 3300046528 Bacteria 7077
204 Ga0495642_0004046 3300046528 Bacteria 5722
205 Ga0495642_0014391 3300046528 Bacteria 3065
206 Ga0495652_0014252 3300046529 Bacteria 7138
207 Ga0495652_0060251 3300046529 Bacteria 3208
208 Ga0495654_0005595 3300046530 Bacteria 7271
209 Ga0495654_0031129 3300046530 Bacteria 2709
210 Ga0495654_0102061 3300046530 Bacteria 1319
211 Ga0495665_0018745 3300046531 Bacteria 3717
212 Ga0495587_0096906 3300046536 Bacteria 1701
213 Ga0495609_0000044 3300046538 Bacteria 161642
214 Ga0495609_0000760 3300046538 Bacteria 24241
215 Ga0495609_0003410 3300046538 Bacteria 9117
216 Ga0495609_0006742 3300046538 Bacteria 5818
217 Ga0495609_0008303 3300046538 Bacteria 5092
218 Ga0495609_0008565 3300046538 Bacteria 5001
219 Ga0495609_0031688 3300046538 Bacteria 2402
220 Ga0495609_0031751 3300046538 Bacteria 2399
221 Ga0495609_0229239 3300046538 Bacteria 769
222 Ga0495621_0248984 3300046539 Bacteria 725
223 Ga0495597_0000310 3300046542 Bacteria 43852
224 Ga0495597_0000532 3300046542 Bacteria 31535
225 Ga0495597_0002234 3300046542 Bacteria 12647
226 Ga0495597_0003418 3300046542 Bacteria 9274
227 Ga0495597_0012024 3300046542 Bacteria 4183
228 Ga0495597_0014564 3300046542 Bacteria 3741
229 Ga0495597_0055426 3300046542 Bacteria 1738
230 Ga0495645_0013862 3300046543 Bacteria 5714
231 Ga0495645_0026559 3300046543 Bacteria 4204
232 Ga0495622_0000129 3300046557 Bacteria 65178
233 Ga0495622_0000188 3300046557 Bacteria 49618
234 Ga0495622_0015182 3300046557 Bacteria 3580
235 Ga0495633_0000810 3300046558 Bacteria 27687
236 Ga0495633_0033213 3300046558 Bacteria 2489
237 Ga0495633_0088160 3300046558 Bacteria 1443
238 Ga0495656_0002173 3300046615 Bacteria 6485
239 Ga0495656_0088622 3300046615 Bacteria 1411
240 Ga0495668_0000532 3300046616 Bacteria 47353
241 Ga0495668_0001032 3300046616 Bacteria 29505
242 Ga0495668_0002189 3300046616 Bacteria 16712
243 Ga0495668_0018421 3300046616 Bacteria 4034
244 Ga0495668_0084823 3300046616 Bacteria 1737
245 Ga0495611_0009078 3300046648 Bacteria 4205
246 Ga0495611_0074015 3300046648 Bacteria 1559
247 Ga0495625_0000278 3300046660 Bacteria 79607
248 Ga0495625_0004513 3300046660 Bacteria 13131
249 Ga0495625_0010704 3300046660 Bacteria 7554
250 Ga0495625_0065254 3300046660 Bacteria 2567
251 Ga0495625_0070132 3300046660 Bacteria 2461
252 Ga0495625_0130141 3300046660 Bacteria 1705
253 Ga0495625_0196589 3300046660 Bacteria 1333
254 Ga0495625_0620226 3300046660 Bacteria 647
255 Ga0495659_0015081 3300046664 Bacteria 2537
256 Ga0495659_0063114 3300046664 Bacteria 1373
257 Ga0495661_0000426 3300046665 Bacteria 44529
258 Ga0495661_0002490 3300046665 Bacteria 14173
259 Ga0495661_0003899 3300046665 Bacteria 10894
260 Ga0495661_0014844 3300046665 Bacteria 5211
261 Ga0495661_0018907 3300046665 Bacteria 4522
262 Ga0495661_0020199 3300046665 Bacteria 4352
263 Ga0495661_0021810 3300046665 Bacteria 4170
264 Ga0495661_0094194 3300046665 Bacteria 1698
265 Ga0495661_0171847 3300046665 Bacteria 1155
266 Ga0495661_0218289 3300046665 Bacteria 989
267 Ga0495588_0007145 3300046674 Bacteria 5066
268 Ga0495588_0096258 3300046674 Bacteria 1553
269 Ga0495588_0116899 3300046674 Bacteria 1405
270 Ga0495588_0241704 3300046674 Bacteria 952
271 Ga0495646_0041520 3300046680 Bacteria 2826
272 Ga0495669_0000203 3300046684 Bacteria 36277
273 Ga0495669_0005584 3300046684 Bacteria 5246
274 Ga0495624_0423041 3300046690 Bacteria 799
275 Ga0495670_0007699 3300046691 Bacteria 5296
276 Ga0495670_0046029 3300046691 Bacteria 2179
277 Ga0495670_0054588 3300046691 Bacteria 2002
278 Ga0495670_0124454 3300046691 Bacteria 1341
279 Ga0495670_0183464 3300046691 Bacteria 1105
280 Ga0495671_0000092 3300046692 Bacteria 85232
281 Ga0495671_0000484 3300046692 Bacteria 30964
282 Ga0495671_0008571 3300046692 Bacteria 5742
283 Ga0495671_0229364 3300046692 Bacteria 898
284 Ga0495649_0004095 3300046694 Bacteria 9587
285 Ga0495589_0000035 3300046794 Bacteria 161642
286 Ga0495589_0000115 3300046794 Bacteria 75796
287 Ga0495589_0004233 3300046794 Bacteria 7673
288 Ga0495589_0025674 3300046794 Bacteria 2989
289 Ga0495589_0070164 3300046794 Bacteria 1713
290 Ga0495589_0083746 3300046794 Bacteria 1550
291 Ga0495660_0000218 3300046810 Bacteria 57673
292 Ga0495660_0005717 3300046810 Bacteria 7425
293 Ga0495660_0071518 3300046810 Bacteria 1839
294 Ga0495660_0125431 3300046810 Bacteria 1293
295 Ga0495604_0036542 3300047317 Bacteria 3872
296 Ga0495604_0182836 3300047317 Bacteria 1465
297 Ga0495636_0035897 3300047318 Bacteria 2042
298 Ga0495636_0037369 3300047318 Bacteria 2005
299 Ga0495636_0045189 3300047318 Bacteria 1835
300 Ga0495636_0049026 3300047318 Bacteria 1766
301 Ga0495636_0077999 3300047318 Bacteria 1422
302 Ga0495636_0204239 3300047318 Bacteria 903
303 Ga0495672_0000285 3300047320 Bacteria 70145
304 Ga0495672_0000322 3300047320 Bacteria 63657
305 Ga0495672_0001570 3300047320 Bacteria 22373
306 Ga0495676_0038304 3300047321 Bacteria 3982
307 Ga0495676_0040419 3300047321 Bacteria 3849
308 Ga0495683_0005791 3300047323 Bacteria 6807
309 Ga0495683_0038507 3300047323 Bacteria 2421
310 Ga0495683_0071384 3300047323 Bacteria 1704
311 Ga0495683_0103550 3300047323 Bacteria 1366
312 Ga0495683_0151052 3300047323 Bacteria 1081
313 Ga0495687_000002 3300047443 Bacteria 1085770
314 Ga0495687_000066 3300047443 Bacteria 161642
315 Ga0495687_000086 3300047443 Bacteria 143855
316 Ga0495687_007981 3300047443 Bacteria 6138
317 Ga0495677_0000013 3300047445 Bacteria 138372
318 Ga0495677_0000985 3300047445 Bacteria 11464
319 Ga0495677_0004324 3300047445 Bacteria 5459
320 Ga0495677_0011948 3300047445 Bacteria 3169
321 Ga0495677_0014205 3300047445 Bacteria 2900
322 Ga0495677_0022951 3300047445 Bacteria 2265
323 Ga0495677_0025590 3300047445 Bacteria 2141
324 Ga0495677_0048132 3300047445 Bacteria 1566
325 Ga0495685_020792 3300047447 Bacteria 2256
326 Ga0495685_115529 3300047447 Bacteria 882
327 Ga0495673_0005766 3300047469 Bacteria 7422
328 Ga0495681_0000016 3300047470 Bacteria 181322
329 Ga0495681_0010130 3300047470 Bacteria 5732
330 Ga0495681_0030386 3300047470 Bacteria 2751
331 Ga0495681_0035504 3300047470 Bacteria 2474
332 Ga0495686_0000054 3300047472 Bacteria 259400
333 Ga0495686_0000464 3300047472 Bacteria 60897
334 Ga0495602_0192540 3300048088 Bacteria 1562
335 Ga0495615_0008848 3300048090 Bacteria 1959
336 Ga0495615_0044623 3300048090 Bacteria 1120
337 Ga0495615_0109375 3300048090 Bacteria 789
338 Ga0495626_0000011 3300048091 Bacteria 260928
339 Ga0495626_0000071 3300048091 Bacteria 136767
340 Ga0495626_0000974 3300048091 Bacteria 24662
341 Ga0495626_0001290 3300048091 Bacteria 20449
342 Ga0495626_0004939 3300048091 Bacteria 8002
343 Ga0495626_0006446 3300048091 Bacteria 6683
344 Ga0495626_0007720 3300048091 Bacteria 5962
345 Ga0495626_0010381 3300048091 Bacteria 4971
346 Ga0495626_0014101 3300048091 Bacteria 4134
347 Ga0495626_0028622 3300048091 Bacteria 2699
348 Ga0495626_0036488 3300048091 Bacteria 2341
349 Ga0495626_0156070 3300048091 Bacteria 959
350 Ga0496102_0000279 3300048905 Bacteria 65185
351 Ga0496103_0001678 3300048906 Bacteria 14484
352 Ga0496104_0428969 3300048907 Bacteria 1234
353 Ga0496104_0656401 3300048907 Bacteria 958
354 Ga0496105_1001154 3300048908 Bacteria 625
355 Ga0496116_0010763 3300048919 Bacteria 7634
356 Ga0496116_0038637 3300048919 Bacteria 3311
357 Ga0496118_0089671 3300048921 Bacteria 2122
358 Ga0496122_0000513 3300048925 Bacteria 80013
359 Ga0496123_0000145 3300048926 Bacteria 144475
360 Ga0496125_0001481 3300048928 Bacteria 33868
361 Ga0496125_0032436 3300048928 Bacteria 4640
362 Ga0495678_000035 3300049459 Bacteria 200957
363 Ga0495678_000780 3300049459 Bacteria 28573
364 Ga0495678_007909 3300049459 Bacteria 5452
365 Ga0495678_014909 3300049459 Bacteria 3598
366 Ga0495682_0000365 3300049460 Bacteria 32900
367 Ga0495682_0000677 3300049460 Bacteria 22419
368 Ga0495682_0138824 3300049460 Bacteria 868
369 Ga0501315_045732 3300049531 Bacteria 675
370 nmdc:mga0qj67_694188_c1 3300050509 Bacteria 810
371 Ga0500618_001616 3300053125 Bacteria 9759
372 2511249159 2511231003 Bacteria 5606035
373 2513954338 2513237150 Bacteria 6553639
374 2514040938 2513237165 Bacteria 6771773
375 2550692418 2548876994 Bacteria 4904866
376 2644027962 2643221603 Bacteria 6147767
377 2819592562 2818991445 Bacteria 4955017
378 2842714023 2842711865 Bacteria 7155354
379 2858689478 2858688981 Bacteria 8184122
380 2884812349 2884811622 Bacteria 5552861
381 2884838949 2884836552 Bacteria 5219991
382 2884855241 2884852848 Bacteria 5221161
383 2896156090 2896154374 Bacteria 5221518
384 2901312288 2901300506 Bacteria 8463898
385 644748913 644736347 Bacteria 6476522
386 Ga0495596_0008903
387 JGI25155J39150_1000142
388 JGI25155J39150_1000219
389 JGI25156J39149_1000497
390 JGI25156J39149_1003054
391 JGI25162J39368_1005347
392 JGI25154J39366_1000423
393 JGI25154J39366_1000432
394 JGI25157J39369_1000158
395 JGI25157J39369_1000203
396 Ga0006758J48902_1012612
397 Ga0006770J48903_1051480
398 Ga0055532_1000005
399 Ga0055526_1015070
400 Ga0070670_100000002
401 Ga0070666_10015072
402 Ga0070669_100005576
403 Ga0070671_100000025
404 Ga0070688_100004285
405 Ga0070667_100000394
406 Ga0070685_10000005
407 Ga0070665_100150604
408 Ga0068855_100106549
409 Ga0068857_100623394
410 Ga0068859_100041050
411 Ga0068864_100000003
412 Ga0068861_100004915
413 Ga0068863_101042396
414 Ga0068860_100000326
415 Ga0068862_100068501
416 Ga0070712_100003941
417 Ga0075370_10239156
418 Ga0097620_100041051
419 Ga0105251_10015285
420 Ga0105251_10076868
421 Ga0105240_10003355
422 Ga0105238_10035298
423 Ga0157373_10065917
424 Ga0163162_10507823
425 Ga0163162_10651076
426 Ga0163163_10000136
427 Ga0157380_10004535
428 Ga0157380_10458164
429 Ga0182008_10022337
430 Ga0182006_1003847
431 Ga0182007_10027096
432 Ga0209435_100004
433 Ga0209435_100214
434 Ga0209147_100011
435 Ga0209437_100084
436 Ga0209437_101166
437 Ga0209258_100560
438 Ga0209646_1000032
439 Ga0209646_1000114
440 Ga0209646_1000283
441 Ga0209026_1000062
442 Ga0209026_1001071
443 Ga0209026_1008799
444 Ga0209759_1000054
445 Ga0209759_1000548
446 Ga0209759_1026395
447 Ga0209455_1012314
448 Ga0209025_1004468
449 Ga0209564_1000006
450 Ga0209051_1025547
451 Ga0207713_1061014
452 Ga0207680_10007523
453 Ga0207695_10001902
454 Ga0207693_10019007
455 Ga0207681_10000156
456 Ga0207694_10083481
457 Ga0207650_10000003
458 Ga0207644_10000312
459 Ga0207711_10002080
460 Ga0207711_10008967
461 Ga0207667_10087097
462 Ga0207658_10000004
463 Ga0207641_10190748
464 Ga0207676_10000003
465 Ga0207674_10193579
466 Ga0207675_100006059
467 Ga0207698_10002422
468 Ga0209282_1000063
469 Ga0268266_10060143
470 Ga0268265_10001641
471 Ga0268264_10000123
472 Ga0265314_10098343
473 Ga0307406_10311556
474 Ga0395905_0000589
475 Ga0450904_000854
476 Ga0439459_0135096
477 Ga0495617_000012
478 Ga0495617_008715
479 Ga0495627_000118
480 Ga0495603_0045499
481 Ga0495590_0000030
482 Ga0495590_0027219
483 Ga0495629_0350841
484 Ga0495638_0000105
485 Ga0495651_0156487
486 Ga0495653_0148065
487 Ga0495650_0000099
488 Ga0495650_0000213
489 Ga0495650_0003278
490 Ga0495580_0013872
491 Ga0495580_0057052
492 Ga0495580_0140293
493 Ga0495582_0188117
494 Ga0495605_0000040
495 Ga0495605_0000072
496 Ga0495605_0027676
497 Ga0495605_0118435
498 Ga0495605_0158535
499 Ga0495605_0181183
500 Ga0495639_0034332
501 Ga0495584_0000381
502 Ga0495584_0007663
503 Ga0495584_0016136
504 Ga0495584_0018145
505 Ga0495584_0089558
506 Ga0495585_0000531
507 Ga0495585_0000742
508 Ga0495585_0051712
509 Ga0495585_0074964
510 Ga0495585_0123889
511 Ga0495585_0169984
512 Ga0495585_0240977
513 Ga0495594_0009587
514 Ga0495594_0137793
515 Ga0495594_0274684
516 Ga0495596_0000029
517 Ga0495596_0000243
518 Ga0495596_0001487
519 Ga0495596_0003835
520 Ga0495596_0004139
521 Ga0495596_0008897
522 Ga0495596_0017721
523 Ga0495596_0034377
524 Ga0495607_0001726
525 Ga0495607_0003190
526 Ga0495607_0005992
527 Ga0495607_0015552
528 Ga0495607_0292840
529 Ga0495607_0352359
530 Ga0495583_0000202
531 Ga0495583_0070195
532 Ga0495583_0093194
533 Ga0495583_0190658
534 Ga0495606_0000316
535 Ga0495606_0002713
536 Ga0495606_0058502
537 Ga0495606_0158039
538 Ga0495606_0167586
539 Ga0495606_0181806
540 Ga0495610_0160590
541 Ga0495616_0000034
542 Ga0495616_0000195
543 Ga0495616_0000388
544 Ga0495616_0005661
545 Ga0495616_0012532
546 Ga0495616_0019800
547 Ga0495616_0230667
548 Ga0495616_0269061
549 Ga0495628_0006086
550 Ga0495631_0004538
551 Ga0495631_0004913
552 Ga0495631_0020774
553 Ga0495631_0053700
554 Ga0495631_0082686
555 Ga0495632_0000033
556 Ga0495632_0000086
557 Ga0495632_0000156
558 Ga0495632_0000853
559 Ga0495637_0015198
560 Ga0495637_0027323
561 Ga0495637_0063924
562 Ga0495643_0000181
563 Ga0495643_0000742
564 Ga0495643_0000937
565 Ga0495643_0006199
566 Ga0495643_0006905
567 Ga0495643_0079419
568 Ga0495643_0267024
569 Ga0495644_0002270
570 Ga0495644_0033422
571 Ga0495644_0046599
572 Ga0495644_0102851
573 Ga0495648_0000008
574 Ga0495648_0000116
575 Ga0495648_0000505
576 Ga0495648_0003863
577 Ga0495648_0005481
578 Ga0495648_0007837
579 Ga0495648_0019819
580 Ga0495648_0037553
581 Ga0495648_0064574
582 Ga0495663_0001491
583 Ga0495666_0000508
584 Ga0495666_0019873
585 Ga0495642_0000010
586 Ga0495642_0000218
587 Ga0495642_0000459
588 Ga0495642_0002734
589 Ga0495642_0004046
590 Ga0495642_0014391
591 Ga0495652_0014252
592 Ga0495652_0060251
593 Ga0495654_0005595
594 Ga0495654_0031129
595 Ga0495654_0102061
596 Ga0495665_0018745
597 Ga0495587_0096906
598 Ga0495609_0000044
599 Ga0495609_0000760
600 Ga0495609_0003410
601 Ga0495609_0006742
602 Ga0495609_0008303
603 Ga0495609_0008565
604 Ga0495609_0031688
605 Ga0495609_0031751
606 Ga0495609_0229239
607 Ga0495621_0248984
608 Ga0495597_0000310
609 Ga0495597_0000532
610 Ga0495597_0002234
611 Ga0495597_0003418
612 Ga0495597_0012024
613 Ga0495597_0014564
614 Ga0495597_0055426
615 Ga0495645_0013862
616 Ga0495645_0026559
617 Ga0495622_0000129
618 Ga0495622_0000188
619 Ga0495622_0015182
620 Ga0495633_0000810
621 Ga0495633_0033213
622 Ga0495633_0088160
623 Ga0495656_0002173
624 Ga0495656_0088622
625 Ga0495668_0000532
626 Ga0495668_0001032
627 Ga0495668_0002189
628 Ga0495668_0018421
629 Ga0495668_0084823
630 Ga0495611_0009078
631 Ga0495611_0074015
632 Ga0495625_0000278
633 Ga0495625_0004513
634 Ga0495625_0010704
635 Ga0495625_0065254
636 Ga0495625_0070132
637 Ga0495625_0130141
638 Ga0495625_0196589
639 Ga0495625_0620226
640 Ga0495659_0015081
641 Ga0495659_0063114
642 Ga0495661_0000426
643 Ga0495661_0002490
644 Ga0495661_0003899
645 Ga0495661_0014844
646 Ga0495661_0018907
647 Ga0495661_0020199
648 Ga0495661_0021810
649 Ga0495661_0094194
650 Ga0495661_0171847
651 Ga0495661_0218289
652 Ga0495588_0007145
653 Ga0495588_0096258
654 Ga0495588_0116899
655 Ga0495588_0241704
656 Ga0495646_0041520
657 Ga0495669_0000203
658 Ga0495669_0005584
659 Ga0495624_0423041
660 Ga0495670_0007699
661 Ga0495670_0046029
662 Ga0495670_0054588
663 Ga0495670_0124454
664 Ga0495670_0183464
665 Ga0495671_0000092
666 Ga0495671_0000484
667 Ga0495671_0008571
668 Ga0495671_0229364
669 Ga0495649_0004095
670 Ga0495589_0000035
671 Ga0495589_0000115
672 Ga0495589_0004233
673 Ga0495589_0025674
674 Ga0495589_0070164
675 Ga0495589_0083746
676 Ga0495660_0000218
677 Ga0495660_0005717
678 Ga0495660_0071518
679 Ga0495660_0125431
680 Ga0495604_0036542
681 Ga0495604_0182836
682 Ga0495636_0035897
683 Ga0495636_0037369
684 Ga0495636_0045189
685 Ga0495636_0049026
686 Ga0495636_0077999
687 Ga0495636_0204239
688 Ga0495672_0000285
689 Ga0495672_0000322
690 Ga0495672_0001570
691 Ga0495676_0038304
692 Ga0495676_0040419
693 Ga0495683_0005791
694 Ga0495683_0038507
695 Ga0495683_0071384
696 Ga0495683_0103550
697 Ga0495683_0151052
698 Ga0495687_000002
699 Ga0495687_000066
700 Ga0495687_000086
701 Ga0495687_007981
702 Ga0495677_0000013
703 Ga0495677_0000985
704 Ga0495677_0004324
705 Ga0495677_0011948
706 Ga0495677_0014205
707 Ga0495677_0022951
708 Ga0495677_0025590
709 Ga0495677_0048132
710 Ga0495685_020792
711 Ga0495685_115529
712 Ga0495673_0005766
713 Ga0495681_0000016
714 Ga0495681_0010130
715 Ga0495681_0030386
716 Ga0495681_0035504
717 Ga0495686_0000054
718 Ga0495686_0000464
719 Ga0495602_0192540
720 Ga0495615_0008848
721 Ga0495615_0044623
722 Ga0495615_0109375
723 Ga0495626_0000011
724 Ga0495626_0000071
725 Ga0495626_0000974
726 Ga0495626_0001290
727 Ga0495626_0004939
728 Ga0495626_0006446
729 Ga0495626_0007720
730 Ga0495626_0010381
731 Ga0495626_0014101
732 Ga0495626_0028622
733 Ga0495626_0036488
734 Ga0495626_0156070
735 Ga0496102_0000279
736 Ga0496103_0001678
737 Ga0496104_0428969
738 Ga0496104_0656401
739 Ga0496105_1001154
740 Ga0496116_0010763
741 Ga0496116_0038637
742 Ga0496118_0089671
743 Ga0496122_0000513
744 Ga0496123_0000145
745 Ga0496125_0001481
746 Ga0496125_0032436
747 Ga0495678_000035
748 Ga0495678_000780
749 Ga0495678_007909
750 Ga0495678_014909
751 Ga0495682_0000365
752 Ga0495682_0000677
753 Ga0495682_0138824
754 Ga0501315_045732
755 nmdc:mga0qj67_694188_c1
756 Ga0500618_001616
757 2511249159
758 2513954338
759 2514040938
760 2550692418
761 2644027962
762 2819592562
763 2842714023
764 2858689478
765 2884812349
766 2884838949
767 2884855241
768 2896156090
769 2901312288
770 644748913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

61

224

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixg-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcnb 0.9679 23 188
5ixg-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcnb 0.9511 23 188
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9205 23 188
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9164 23 189
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9049 23 188
ID Description Score Start End Superfamily
5ixgA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9679 23 188 2.40.128.110
5ixgA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9511 23 188 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9218 23 189 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9062 23 189 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8996 23 186 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A7S1HC48-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9802 56 170
AF-A0A257DAK4-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9802 80 188
AF-A0A522S201-F1-model_v4 Polyisoprenoid-binding protein 0.9795 19 188
AF-A0A2I8EWK9-F1-model_v4 Polyisoprenoid-binding protein 0.9784 19 189
AF-A0A2M8DSP7-F1-model_v4 Polyisoprenoid-binding protein 0.9781 27 188

Map