F430286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 385 | 173 | 770 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300046500|Ga0495596_0008903|Ga0495596_0008903_3692_4375 |
| Length | 227 |
| Sequence | MKQLFMFCQVYPIEPNIYSGLRRCFGERNQDHYRMTIMKIKHIIALLATAASSAAFAADTYTIEPNHTYPSFEADHMGGLSFWRGKFTKTAGTITLDRAARTGAVEITIDTDSIDFGNAKLNEHVMSPEMFDVVKYPKAVYKSASIQFKGDKPAIVNGDLTLHGVTRPVKLVIDHFKCMPHPMFKREVCGANAVATFNRSDFGISYGTQMGFSPEVKLAIQVEALKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 22 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 23 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 27 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 29 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 38 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 39 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 40 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 41 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 45 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 46 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 47 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 50 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 68 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 72 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 73 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 74 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 75 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 76 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 147 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 150 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 151 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 152 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 153 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 154 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 155 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 160 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 161 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 162 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 163 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 164 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 165 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 166 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 167 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 168 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 169 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 170 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 171 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 172 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 173 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.58 |
| Metatranscriptomes | 0.78 |
| Isolates | 3.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.38 |
| Nodule | 1.56 |
| Rhizoplane | 1.3 |
| Rhizosphere | 84.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495596_0008903 | 3300046500 | Bacteria | 4440 |
| 2 | JGI25155J39150_1000142 | 3300002704 | Bacteria | 33693 |
| 3 | JGI25155J39150_1000219 | 3300002704 | Bacteria | 22984 |
| 4 | JGI25156J39149_1000497 | 3300002705 | Bacteria | 23452 |
| 5 | JGI25156J39149_1003054 | 3300002705 | Bacteria | 5671 |
| 6 | JGI25162J39368_1005347 | 3300002737 | Bacteria | 2559 |
| 7 | JGI25154J39366_1000423 | 3300002738 | Bacteria | 22650 |
| 8 | JGI25154J39366_1000432 | 3300002738 | Bacteria | 22245 |
| 9 | JGI25157J39369_1000158 | 3300002741 | Bacteria | 56328 |
| 10 | JGI25157J39369_1000203 | 3300002741 | Bacteria | 49480 |
| 11 | Ga0006758J48902_1012612 | 3300003300 | Bacteria | 707 |
| 12 | Ga0006770J48903_1051480 | 3300003305 | Bacteria | 624 |
| 13 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 14 | Ga0055526_1015070 | 3300003771 | Bacteria | 3127 |
| 15 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 16 | Ga0070666_10015072 | 3300005335 | Bacteria | 4926 |
| 17 | Ga0070669_100005576 | 3300005353 | Bacteria | 9091 |
| 18 | Ga0070671_100000025 | 3300005355 | Bacteria | 121912 |
| 19 | Ga0070688_100004285 | 3300005365 | Bacteria | 7416 |
| 20 | Ga0070667_100000394 | 3300005367 | Bacteria | 47270 |
| 21 | Ga0070685_10000005 | 3300005466 | Bacteria | 190119 |
| 22 | Ga0070665_100150604 | 3300005548 | Bacteria | 2329 |
| 23 | Ga0068855_100106549 | 3300005563 | Bacteria | 3222 |
| 24 | Ga0068857_100623394 | 3300005577 | Bacteria | 1021 |
| 25 | Ga0068859_100041050 | 3300005617 | Bacteria | 4648 |
| 26 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 27 | Ga0068861_100004915 | 3300005719 | Bacteria | 9003 |
| 28 | Ga0068863_101042396 | 3300005841 | Unclassified | 821 |
| 29 | Ga0068860_100000326 | 3300005843 | Bacteria | 64692 |
| 30 | Ga0068862_100068501 | 3300005844 | Bacteria | 3061 |
| 31 | Ga0070712_100003941 | 3300006175 | Bacteria | 9138 |
| 32 | Ga0075370_10239156 | 3300006353 | Bacteria | 1075 |
| 33 | Ga0097620_100041051 | 3300006931 | Bacteria | 4648 |
| 34 | Ga0105251_10015285 | 3300009011 | Bacteria | 4203 |
| 35 | Ga0105251_10076868 | 3300009011 | Bacteria | 1549 |
| 36 | Ga0105240_10003355 | 3300009093 | Bacteria | 24916 |
| 37 | Ga0105238_10035298 | 3300009551 | Bacteria | 5084 |
| 38 | Ga0157373_10065917 | 3300013100 | Bacteria | 2562 |
| 39 | Ga0163162_10507823 | 3300013306 | Bacteria | 1336 |
| 40 | Ga0163162_10651076 | 3300013306 | Bacteria | 1177 |
| 41 | Ga0163163_10000136 | 3300014325 | Bacteria | 75532 |
| 42 | Ga0157380_10004535 | 3300014326 | Bacteria | 9640 |
| 43 | Ga0157380_10458164 | 3300014326 | Bacteria | 1227 |
| 44 | Ga0182008_10022337 | 3300014497 | Bacteria | 3241 |
| 45 | Ga0182006_1003847 | 3300015261 | Bacteria | 7537 |
| 46 | Ga0182007_10027096 | 3300015262 | Bacteria | 1979 |
| 47 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 48 | Ga0209435_100214 | 3300025206 | Bacteria | 16487 |
| 49 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 50 | Ga0209437_100084 | 3300025233 | Bacteria | 255423 |
| 51 | Ga0209437_101166 | 3300025233 | Bacteria | 7812 |
| 52 | Ga0209258_100560 | 3300025242 | Bacteria | 32331 |
| 53 | Ga0209646_1000032 | 3300025246 | Bacteria | 375315 |
| 54 | Ga0209646_1000114 | 3300025246 | Bacteria | 152958 |
| 55 | Ga0209646_1000283 | 3300025246 | Bacteria | 44163 |
| 56 | Ga0209026_1000062 | 3300025250 | Bacteria | 213298 |
| 57 | Ga0209026_1001071 | 3300025250 | Bacteria | 13234 |
| 58 | Ga0209026_1008799 | 3300025250 | Bacteria | 2060 |
| 59 | Ga0209759_1000054 | 3300025256 | Bacteria | 211422 |
| 60 | Ga0209759_1000548 | 3300025256 | Bacteria | 38674 |
| 61 | Ga0209759_1026395 | 3300025256 | Bacteria | 1218 |
| 62 | Ga0209455_1012314 | 3300025272 | Bacteria | 2054 |
| 63 | Ga0209025_1004468 | 3300025294 | Bacteria | 12144 |
| 64 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 65 | Ga0209051_1025547 | 3300025303 | Bacteria | 2400 |
| 66 | Ga0207713_1061014 | 3300025735 | Bacteria | 1437 |
| 67 | Ga0207680_10007523 | 3300025903 | Bacteria | 5318 |
| 68 | Ga0207695_10001902 | 3300025913 | Bacteria | 32583 |
| 69 | Ga0207693_10019007 | 3300025915 | Bacteria | 5469 |
| 70 | Ga0207681_10000156 | 3300025923 | Bacteria | 56382 |
| 71 | Ga0207694_10083481 | 3300025924 | Bacteria | 2512 |
| 72 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 73 | Ga0207644_10000312 | 3300025931 | Bacteria | 31641 |
| 74 | Ga0207711_10002080 | 3300025941 | Bacteria | 18084 |
| 75 | Ga0207711_10008967 | 3300025941 | Bacteria | 8363 |
| 76 | Ga0207667_10087097 | 3300025949 | Bacteria | 3231 |
| 77 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 78 | Ga0207641_10190748 | 3300026088 | Bacteria | 1883 |
| 79 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 80 | Ga0207674_10193579 | 3300026116 | Bacteria | 1983 |
| 81 | Ga0207675_100006059 | 3300026118 | Bacteria | 11506 |
| 82 | Ga0207698_10002422 | 3300026142 | Bacteria | 11040 |
| 83 | Ga0209282_1000063 | 3300027666 | Bacteria | 93789 |
| 84 | Ga0268266_10060143 | 3300028379 | Bacteria | 3274 |
| 85 | Ga0268265_10001641 | 3300028380 | Bacteria | 18332 |
| 86 | Ga0268264_10000123 | 3300028381 | Bacteria | 189361 |
| 87 | Ga0265314_10098343 | 3300031711 | Bacteria | 1888 |
| 88 | Ga0307406_10311556 | 3300031901 | Bacteria | 1214 |
| 89 | Ga0395905_0000589 | 3300037471 | Bacteria | 48792 |
| 90 | Ga0450904_000854 | 3300042139 | Bacteria | 5015 |
| 91 | Ga0439459_0135096 | 3300042438 | Bacteria | 633 |
| 92 | Ga0495617_000012 | 3300046452 | Bacteria | 295916 |
| 93 | Ga0495617_008715 | 3300046452 | Bacteria | 3491 |
| 94 | Ga0495627_000118 | 3300046453 | Bacteria | 99480 |
| 95 | Ga0495603_0045499 | 3300046455 | Bacteria | 2617 |
| 96 | Ga0495590_0000030 | 3300046457 | Bacteria | 146237 |
| 97 | Ga0495590_0027219 | 3300046457 | Bacteria | 2006 |
| 98 | Ga0495629_0350841 | 3300046459 | Bacteria | 1006 |
| 99 | Ga0495638_0000105 | 3300046460 | Bacteria | 134384 |
| 100 | Ga0495651_0156487 | 3300046462 | Bacteria | 1637 |
| 101 | Ga0495653_0148065 | 3300046463 | Bacteria | 1643 |
| 102 | Ga0495650_0000099 | 3300046471 | Bacteria | 215347 |
| 103 | Ga0495650_0000213 | 3300046471 | Bacteria | 123910 |
| 104 | Ga0495650_0003278 | 3300046471 | Bacteria | 11987 |
| 105 | Ga0495580_0013872 | 3300046472 | Bacteria | 6136 |
| 106 | Ga0495580_0057052 | 3300046472 | Bacteria | 2749 |
| 107 | Ga0495580_0140293 | 3300046472 | Bacteria | 1675 |
| 108 | Ga0495582_0188117 | 3300046473 | Bacteria | 1177 |
| 109 | Ga0495605_0000040 | 3300046474 | Bacteria | 193955 |
| 110 | Ga0495605_0000072 | 3300046474 | Bacteria | 133731 |
| 111 | Ga0495605_0027676 | 3300046474 | Bacteria | 2935 |
| 112 | Ga0495605_0118435 | 3300046474 | Bacteria | 1202 |
| 113 | Ga0495605_0158535 | 3300046474 | Bacteria | 1005 |
| 114 | Ga0495605_0181183 | 3300046474 | Bacteria | 926 |
| 115 | Ga0495639_0034332 | 3300046475 | Bacteria | 2268 |
| 116 | Ga0495584_0000381 | 3300046491 | Bacteria | 30594 |
| 117 | Ga0495584_0007663 | 3300046491 | Bacteria | 5625 |
| 118 | Ga0495584_0016136 | 3300046491 | Bacteria | 3810 |
| 119 | Ga0495584_0018145 | 3300046491 | Bacteria | 3577 |
| 120 | Ga0495584_0089558 | 3300046491 | Bacteria | 1551 |
| 121 | Ga0495585_0000531 | 3300046492 | Bacteria | 36056 |
| 122 | Ga0495585_0000742 | 3300046492 | Bacteria | 29008 |
| 123 | Ga0495585_0051712 | 3300046492 | Bacteria | 2276 |
| 124 | Ga0495585_0074964 | 3300046492 | Bacteria | 1840 |
| 125 | Ga0495585_0123889 | 3300046492 | Bacteria | 1365 |
| 126 | Ga0495585_0169984 | 3300046492 | Bacteria | 1126 |
| 127 | Ga0495585_0240977 | 3300046492 | Bacteria | 905 |
| 128 | Ga0495594_0009587 | 3300046499 | Bacteria | 5005 |
| 129 | Ga0495594_0137793 | 3300046499 | Bacteria | 1383 |
| 130 | Ga0495594_0274684 | 3300046499 | Bacteria | 960 |
| 131 | Ga0495596_0000029 | 3300046500 | Bacteria | 103615 |
| 132 | Ga0495596_0000243 | 3300046500 | Bacteria | 36829 |
| 133 | Ga0495596_0001487 | 3300046500 | Bacteria | 13398 |
| 134 | Ga0495596_0003835 | 3300046500 | Bacteria | 7475 |
| 135 | Ga0495596_0004139 | 3300046500 | Bacteria | 7133 |
| 136 | Ga0495596_0008897 | 3300046500 | Bacteria | 4441 |
| 137 | Ga0495596_0017721 | 3300046500 | Bacteria | 2944 |
| 138 | Ga0495596_0034377 | 3300046500 | Bacteria | 2013 |
| 139 | Ga0495607_0001726 | 3300046501 | Bacteria | 18722 |
| 140 | Ga0495607_0003190 | 3300046501 | Bacteria | 12670 |
| 141 | Ga0495607_0005992 | 3300046501 | Bacteria | 8618 |
| 142 | Ga0495607_0015552 | 3300046501 | Bacteria | 4929 |
| 143 | Ga0495607_0292840 | 3300046501 | Bacteria | 768 |
| 144 | Ga0495607_0352359 | 3300046501 | Bacteria | 679 |
| 145 | Ga0495583_0000202 | 3300046506 | Bacteria | 100020 |
| 146 | Ga0495583_0070195 | 3300046506 | Bacteria | 1541 |
| 147 | Ga0495583_0093194 | 3300046506 | Bacteria | 1294 |
| 148 | Ga0495583_0190658 | 3300046506 | Bacteria | 836 |
| 149 | Ga0495606_0000316 | 3300046507 | Bacteria | 83307 |
| 150 | Ga0495606_0002713 | 3300046507 | Bacteria | 19956 |
| 151 | Ga0495606_0058502 | 3300046507 | Bacteria | 2477 |
| 152 | Ga0495606_0158039 | 3300046507 | Bacteria | 1325 |
| 153 | Ga0495606_0167586 | 3300046507 | Bacteria | 1277 |
| 154 | Ga0495606_0181806 | 3300046507 | Bacteria | 1212 |
| 155 | Ga0495610_0160590 | 3300046512 | Bacteria | 950 |
| 156 | Ga0495616_0000034 | 3300046513 | Bacteria | 129394 |
| 157 | Ga0495616_0000195 | 3300046513 | Bacteria | 50559 |
| 158 | Ga0495616_0000388 | 3300046513 | Bacteria | 34173 |
| 159 | Ga0495616_0005661 | 3300046513 | Bacteria | 7652 |
| 160 | Ga0495616_0012532 | 3300046513 | Bacteria | 4810 |
| 161 | Ga0495616_0019800 | 3300046513 | Bacteria | 3669 |
| 162 | Ga0495616_0230667 | 3300046513 | Bacteria | 802 |
| 163 | Ga0495616_0269061 | 3300046513 | Bacteria | 727 |
| 164 | Ga0495628_0006086 | 3300046516 | Bacteria | 10550 |
| 165 | Ga0495631_0004538 | 3300046518 | Bacteria | 7376 |
| 166 | Ga0495631_0004913 | 3300046518 | Bacteria | 7044 |
| 167 | Ga0495631_0020774 | 3300046518 | Bacteria | 3063 |
| 168 | Ga0495631_0053700 | 3300046518 | Bacteria | 1758 |
| 169 | Ga0495631_0082686 | 3300046518 | Bacteria | 1384 |
| 170 | Ga0495632_0000033 | 3300046519 | Bacteria | 164240 |
| 171 | Ga0495632_0000086 | 3300046519 | Bacteria | 95327 |
| 172 | Ga0495632_0000156 | 3300046519 | Bacteria | 70702 |
| 173 | Ga0495632_0000853 | 3300046519 | Bacteria | 26790 |
| 174 | Ga0495637_0015198 | 3300046520 | Bacteria | 3614 |
| 175 | Ga0495637_0027323 | 3300046520 | Bacteria | 2555 |
| 176 | Ga0495637_0063924 | 3300046520 | Bacteria | 1502 |
| 177 | Ga0495643_0000181 | 3300046522 | Bacteria | 100368 |
| 178 | Ga0495643_0000742 | 3300046522 | Bacteria | 37024 |
| 179 | Ga0495643_0000937 | 3300046522 | Bacteria | 30281 |
| 180 | Ga0495643_0006199 | 3300046522 | Bacteria | 7936 |
| 181 | Ga0495643_0006905 | 3300046522 | Bacteria | 7391 |
| 182 | Ga0495643_0079419 | 3300046522 | Bacteria | 1710 |
| 183 | Ga0495643_0267024 | 3300046522 | Bacteria | 792 |
| 184 | Ga0495644_0002270 | 3300046523 | Bacteria | 7688 |
| 185 | Ga0495644_0033422 | 3300046523 | Bacteria | 1943 |
| 186 | Ga0495644_0046599 | 3300046523 | Bacteria | 1629 |
| 187 | Ga0495644_0102851 | 3300046523 | Bacteria | 1081 |
| 188 | Ga0495648_0000008 | 3300046524 | Bacteria | 336584 |
| 189 | Ga0495648_0000116 | 3300046524 | Bacteria | 98123 |
| 190 | Ga0495648_0000505 | 3300046524 | Bacteria | 41982 |
| 191 | Ga0495648_0003863 | 3300046524 | Bacteria | 12994 |
| 192 | Ga0495648_0005481 | 3300046524 | Bacteria | 10528 |
| 193 | Ga0495648_0007837 | 3300046524 | Bacteria | 8495 |
| 194 | Ga0495648_0019819 | 3300046524 | Bacteria | 4712 |
| 195 | Ga0495648_0037553 | 3300046524 | Bacteria | 3110 |
| 196 | Ga0495648_0064574 | 3300046524 | Bacteria | 2156 |
| 197 | Ga0495663_0001491 | 3300046525 | Bacteria | 7361 |
| 198 | Ga0495666_0000508 | 3300046526 | Bacteria | 17311 |
| 199 | Ga0495666_0019873 | 3300046526 | Bacteria | 3331 |
| 200 | Ga0495642_0000010 | 3300046528 | Bacteria | 136557 |
| 201 | Ga0495642_0000218 | 3300046528 | Bacteria | 33005 |
| 202 | Ga0495642_0000459 | 3300046528 | Bacteria | 21479 |
| 203 | Ga0495642_0002734 | 3300046528 | Bacteria | 7077 |
| 204 | Ga0495642_0004046 | 3300046528 | Bacteria | 5722 |
| 205 | Ga0495642_0014391 | 3300046528 | Bacteria | 3065 |
| 206 | Ga0495652_0014252 | 3300046529 | Bacteria | 7138 |
| 207 | Ga0495652_0060251 | 3300046529 | Bacteria | 3208 |
| 208 | Ga0495654_0005595 | 3300046530 | Bacteria | 7271 |
| 209 | Ga0495654_0031129 | 3300046530 | Bacteria | 2709 |
| 210 | Ga0495654_0102061 | 3300046530 | Bacteria | 1319 |
| 211 | Ga0495665_0018745 | 3300046531 | Bacteria | 3717 |
| 212 | Ga0495587_0096906 | 3300046536 | Bacteria | 1701 |
| 213 | Ga0495609_0000044 | 3300046538 | Bacteria | 161642 |
| 214 | Ga0495609_0000760 | 3300046538 | Bacteria | 24241 |
| 215 | Ga0495609_0003410 | 3300046538 | Bacteria | 9117 |
| 216 | Ga0495609_0006742 | 3300046538 | Bacteria | 5818 |
| 217 | Ga0495609_0008303 | 3300046538 | Bacteria | 5092 |
| 218 | Ga0495609_0008565 | 3300046538 | Bacteria | 5001 |
| 219 | Ga0495609_0031688 | 3300046538 | Bacteria | 2402 |
| 220 | Ga0495609_0031751 | 3300046538 | Bacteria | 2399 |
| 221 | Ga0495609_0229239 | 3300046538 | Bacteria | 769 |
| 222 | Ga0495621_0248984 | 3300046539 | Bacteria | 725 |
| 223 | Ga0495597_0000310 | 3300046542 | Bacteria | 43852 |
| 224 | Ga0495597_0000532 | 3300046542 | Bacteria | 31535 |
| 225 | Ga0495597_0002234 | 3300046542 | Bacteria | 12647 |
| 226 | Ga0495597_0003418 | 3300046542 | Bacteria | 9274 |
| 227 | Ga0495597_0012024 | 3300046542 | Bacteria | 4183 |
| 228 | Ga0495597_0014564 | 3300046542 | Bacteria | 3741 |
| 229 | Ga0495597_0055426 | 3300046542 | Bacteria | 1738 |
| 230 | Ga0495645_0013862 | 3300046543 | Bacteria | 5714 |
| 231 | Ga0495645_0026559 | 3300046543 | Bacteria | 4204 |
| 232 | Ga0495622_0000129 | 3300046557 | Bacteria | 65178 |
| 233 | Ga0495622_0000188 | 3300046557 | Bacteria | 49618 |
| 234 | Ga0495622_0015182 | 3300046557 | Bacteria | 3580 |
| 235 | Ga0495633_0000810 | 3300046558 | Bacteria | 27687 |
| 236 | Ga0495633_0033213 | 3300046558 | Bacteria | 2489 |
| 237 | Ga0495633_0088160 | 3300046558 | Bacteria | 1443 |
| 238 | Ga0495656_0002173 | 3300046615 | Bacteria | 6485 |
| 239 | Ga0495656_0088622 | 3300046615 | Bacteria | 1411 |
| 240 | Ga0495668_0000532 | 3300046616 | Bacteria | 47353 |
| 241 | Ga0495668_0001032 | 3300046616 | Bacteria | 29505 |
| 242 | Ga0495668_0002189 | 3300046616 | Bacteria | 16712 |
| 243 | Ga0495668_0018421 | 3300046616 | Bacteria | 4034 |
| 244 | Ga0495668_0084823 | 3300046616 | Bacteria | 1737 |
| 245 | Ga0495611_0009078 | 3300046648 | Bacteria | 4205 |
| 246 | Ga0495611_0074015 | 3300046648 | Bacteria | 1559 |
| 247 | Ga0495625_0000278 | 3300046660 | Bacteria | 79607 |
| 248 | Ga0495625_0004513 | 3300046660 | Bacteria | 13131 |
| 249 | Ga0495625_0010704 | 3300046660 | Bacteria | 7554 |
| 250 | Ga0495625_0065254 | 3300046660 | Bacteria | 2567 |
| 251 | Ga0495625_0070132 | 3300046660 | Bacteria | 2461 |
| 252 | Ga0495625_0130141 | 3300046660 | Bacteria | 1705 |
| 253 | Ga0495625_0196589 | 3300046660 | Bacteria | 1333 |
| 254 | Ga0495625_0620226 | 3300046660 | Bacteria | 647 |
| 255 | Ga0495659_0015081 | 3300046664 | Bacteria | 2537 |
| 256 | Ga0495659_0063114 | 3300046664 | Bacteria | 1373 |
| 257 | Ga0495661_0000426 | 3300046665 | Bacteria | 44529 |
| 258 | Ga0495661_0002490 | 3300046665 | Bacteria | 14173 |
| 259 | Ga0495661_0003899 | 3300046665 | Bacteria | 10894 |
| 260 | Ga0495661_0014844 | 3300046665 | Bacteria | 5211 |
| 261 | Ga0495661_0018907 | 3300046665 | Bacteria | 4522 |
| 262 | Ga0495661_0020199 | 3300046665 | Bacteria | 4352 |
| 263 | Ga0495661_0021810 | 3300046665 | Bacteria | 4170 |
| 264 | Ga0495661_0094194 | 3300046665 | Bacteria | 1698 |
| 265 | Ga0495661_0171847 | 3300046665 | Bacteria | 1155 |
| 266 | Ga0495661_0218289 | 3300046665 | Bacteria | 989 |
| 267 | Ga0495588_0007145 | 3300046674 | Bacteria | 5066 |
| 268 | Ga0495588_0096258 | 3300046674 | Bacteria | 1553 |
| 269 | Ga0495588_0116899 | 3300046674 | Bacteria | 1405 |
| 270 | Ga0495588_0241704 | 3300046674 | Bacteria | 952 |
| 271 | Ga0495646_0041520 | 3300046680 | Bacteria | 2826 |
| 272 | Ga0495669_0000203 | 3300046684 | Bacteria | 36277 |
| 273 | Ga0495669_0005584 | 3300046684 | Bacteria | 5246 |
| 274 | Ga0495624_0423041 | 3300046690 | Bacteria | 799 |
| 275 | Ga0495670_0007699 | 3300046691 | Bacteria | 5296 |
| 276 | Ga0495670_0046029 | 3300046691 | Bacteria | 2179 |
| 277 | Ga0495670_0054588 | 3300046691 | Bacteria | 2002 |
| 278 | Ga0495670_0124454 | 3300046691 | Bacteria | 1341 |
| 279 | Ga0495670_0183464 | 3300046691 | Bacteria | 1105 |
| 280 | Ga0495671_0000092 | 3300046692 | Bacteria | 85232 |
| 281 | Ga0495671_0000484 | 3300046692 | Bacteria | 30964 |
| 282 | Ga0495671_0008571 | 3300046692 | Bacteria | 5742 |
| 283 | Ga0495671_0229364 | 3300046692 | Bacteria | 898 |
| 284 | Ga0495649_0004095 | 3300046694 | Bacteria | 9587 |
| 285 | Ga0495589_0000035 | 3300046794 | Bacteria | 161642 |
| 286 | Ga0495589_0000115 | 3300046794 | Bacteria | 75796 |
| 287 | Ga0495589_0004233 | 3300046794 | Bacteria | 7673 |
| 288 | Ga0495589_0025674 | 3300046794 | Bacteria | 2989 |
| 289 | Ga0495589_0070164 | 3300046794 | Bacteria | 1713 |
| 290 | Ga0495589_0083746 | 3300046794 | Bacteria | 1550 |
| 291 | Ga0495660_0000218 | 3300046810 | Bacteria | 57673 |
| 292 | Ga0495660_0005717 | 3300046810 | Bacteria | 7425 |
| 293 | Ga0495660_0071518 | 3300046810 | Bacteria | 1839 |
| 294 | Ga0495660_0125431 | 3300046810 | Bacteria | 1293 |
| 295 | Ga0495604_0036542 | 3300047317 | Bacteria | 3872 |
| 296 | Ga0495604_0182836 | 3300047317 | Bacteria | 1465 |
| 297 | Ga0495636_0035897 | 3300047318 | Bacteria | 2042 |
| 298 | Ga0495636_0037369 | 3300047318 | Bacteria | 2005 |
| 299 | Ga0495636_0045189 | 3300047318 | Bacteria | 1835 |
| 300 | Ga0495636_0049026 | 3300047318 | Bacteria | 1766 |
| 301 | Ga0495636_0077999 | 3300047318 | Bacteria | 1422 |
| 302 | Ga0495636_0204239 | 3300047318 | Bacteria | 903 |
| 303 | Ga0495672_0000285 | 3300047320 | Bacteria | 70145 |
| 304 | Ga0495672_0000322 | 3300047320 | Bacteria | 63657 |
| 305 | Ga0495672_0001570 | 3300047320 | Bacteria | 22373 |
| 306 | Ga0495676_0038304 | 3300047321 | Bacteria | 3982 |
| 307 | Ga0495676_0040419 | 3300047321 | Bacteria | 3849 |
| 308 | Ga0495683_0005791 | 3300047323 | Bacteria | 6807 |
| 309 | Ga0495683_0038507 | 3300047323 | Bacteria | 2421 |
| 310 | Ga0495683_0071384 | 3300047323 | Bacteria | 1704 |
| 311 | Ga0495683_0103550 | 3300047323 | Bacteria | 1366 |
| 312 | Ga0495683_0151052 | 3300047323 | Bacteria | 1081 |
| 313 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 314 | Ga0495687_000066 | 3300047443 | Bacteria | 161642 |
| 315 | Ga0495687_000086 | 3300047443 | Bacteria | 143855 |
| 316 | Ga0495687_007981 | 3300047443 | Bacteria | 6138 |
| 317 | Ga0495677_0000013 | 3300047445 | Bacteria | 138372 |
| 318 | Ga0495677_0000985 | 3300047445 | Bacteria | 11464 |
| 319 | Ga0495677_0004324 | 3300047445 | Bacteria | 5459 |
| 320 | Ga0495677_0011948 | 3300047445 | Bacteria | 3169 |
| 321 | Ga0495677_0014205 | 3300047445 | Bacteria | 2900 |
| 322 | Ga0495677_0022951 | 3300047445 | Bacteria | 2265 |
| 323 | Ga0495677_0025590 | 3300047445 | Bacteria | 2141 |
| 324 | Ga0495677_0048132 | 3300047445 | Bacteria | 1566 |
| 325 | Ga0495685_020792 | 3300047447 | Bacteria | 2256 |
| 326 | Ga0495685_115529 | 3300047447 | Bacteria | 882 |
| 327 | Ga0495673_0005766 | 3300047469 | Bacteria | 7422 |
| 328 | Ga0495681_0000016 | 3300047470 | Bacteria | 181322 |
| 329 | Ga0495681_0010130 | 3300047470 | Bacteria | 5732 |
| 330 | Ga0495681_0030386 | 3300047470 | Bacteria | 2751 |
| 331 | Ga0495681_0035504 | 3300047470 | Bacteria | 2474 |
| 332 | Ga0495686_0000054 | 3300047472 | Bacteria | 259400 |
| 333 | Ga0495686_0000464 | 3300047472 | Bacteria | 60897 |
| 334 | Ga0495602_0192540 | 3300048088 | Bacteria | 1562 |
| 335 | Ga0495615_0008848 | 3300048090 | Bacteria | 1959 |
| 336 | Ga0495615_0044623 | 3300048090 | Bacteria | 1120 |
| 337 | Ga0495615_0109375 | 3300048090 | Bacteria | 789 |
| 338 | Ga0495626_0000011 | 3300048091 | Bacteria | 260928 |
| 339 | Ga0495626_0000071 | 3300048091 | Bacteria | 136767 |
| 340 | Ga0495626_0000974 | 3300048091 | Bacteria | 24662 |
| 341 | Ga0495626_0001290 | 3300048091 | Bacteria | 20449 |
| 342 | Ga0495626_0004939 | 3300048091 | Bacteria | 8002 |
| 343 | Ga0495626_0006446 | 3300048091 | Bacteria | 6683 |
| 344 | Ga0495626_0007720 | 3300048091 | Bacteria | 5962 |
| 345 | Ga0495626_0010381 | 3300048091 | Bacteria | 4971 |
| 346 | Ga0495626_0014101 | 3300048091 | Bacteria | 4134 |
| 347 | Ga0495626_0028622 | 3300048091 | Bacteria | 2699 |
| 348 | Ga0495626_0036488 | 3300048091 | Bacteria | 2341 |
| 349 | Ga0495626_0156070 | 3300048091 | Bacteria | 959 |
| 350 | Ga0496102_0000279 | 3300048905 | Bacteria | 65185 |
| 351 | Ga0496103_0001678 | 3300048906 | Bacteria | 14484 |
| 352 | Ga0496104_0428969 | 3300048907 | Bacteria | 1234 |
| 353 | Ga0496104_0656401 | 3300048907 | Bacteria | 958 |
| 354 | Ga0496105_1001154 | 3300048908 | Bacteria | 625 |
| 355 | Ga0496116_0010763 | 3300048919 | Bacteria | 7634 |
| 356 | Ga0496116_0038637 | 3300048919 | Bacteria | 3311 |
| 357 | Ga0496118_0089671 | 3300048921 | Bacteria | 2122 |
| 358 | Ga0496122_0000513 | 3300048925 | Bacteria | 80013 |
| 359 | Ga0496123_0000145 | 3300048926 | Bacteria | 144475 |
| 360 | Ga0496125_0001481 | 3300048928 | Bacteria | 33868 |
| 361 | Ga0496125_0032436 | 3300048928 | Bacteria | 4640 |
| 362 | Ga0495678_000035 | 3300049459 | Bacteria | 200957 |
| 363 | Ga0495678_000780 | 3300049459 | Bacteria | 28573 |
| 364 | Ga0495678_007909 | 3300049459 | Bacteria | 5452 |
| 365 | Ga0495678_014909 | 3300049459 | Bacteria | 3598 |
| 366 | Ga0495682_0000365 | 3300049460 | Bacteria | 32900 |
| 367 | Ga0495682_0000677 | 3300049460 | Bacteria | 22419 |
| 368 | Ga0495682_0138824 | 3300049460 | Bacteria | 868 |
| 369 | Ga0501315_045732 | 3300049531 | Bacteria | 675 |
| 370 | nmdc:mga0qj67_694188_c1 | 3300050509 | Bacteria | 810 |
| 371 | Ga0500618_001616 | 3300053125 | Bacteria | 9759 |
| 372 | 2511249159 | 2511231003 | Bacteria | 5606035 |
| 373 | 2513954338 | 2513237150 | Bacteria | 6553639 |
| 374 | 2514040938 | 2513237165 | Bacteria | 6771773 |
| 375 | 2550692418 | 2548876994 | Bacteria | 4904866 |
| 376 | 2644027962 | 2643221603 | Bacteria | 6147767 |
| 377 | 2819592562 | 2818991445 | Bacteria | 4955017 |
| 378 | 2842714023 | 2842711865 | Bacteria | 7155354 |
| 379 | 2858689478 | 2858688981 | Bacteria | 8184122 |
| 380 | 2884812349 | 2884811622 | Bacteria | 5552861 |
| 381 | 2884838949 | 2884836552 | Bacteria | 5219991 |
| 382 | 2884855241 | 2884852848 | Bacteria | 5221161 |
| 383 | 2896156090 | 2896154374 | Bacteria | 5221518 |
| 384 | 2901312288 | 2901300506 | Bacteria | 8463898 |
| 385 | 644748913 | 644736347 | Bacteria | 6476522 |
| 386 | Ga0495596_0008903 | |||
| 387 | JGI25155J39150_1000142 | |||
| 388 | JGI25155J39150_1000219 | |||
| 389 | JGI25156J39149_1000497 | |||
| 390 | JGI25156J39149_1003054 | |||
| 391 | JGI25162J39368_1005347 | |||
| 392 | JGI25154J39366_1000423 | |||
| 393 | JGI25154J39366_1000432 | |||
| 394 | JGI25157J39369_1000158 | |||
| 395 | JGI25157J39369_1000203 | |||
| 396 | Ga0006758J48902_1012612 | |||
| 397 | Ga0006770J48903_1051480 | |||
| 398 | Ga0055532_1000005 | |||
| 399 | Ga0055526_1015070 | |||
| 400 | Ga0070670_100000002 | |||
| 401 | Ga0070666_10015072 | |||
| 402 | Ga0070669_100005576 | |||
| 403 | Ga0070671_100000025 | |||
| 404 | Ga0070688_100004285 | |||
| 405 | Ga0070667_100000394 | |||
| 406 | Ga0070685_10000005 | |||
| 407 | Ga0070665_100150604 | |||
| 408 | Ga0068855_100106549 | |||
| 409 | Ga0068857_100623394 | |||
| 410 | Ga0068859_100041050 | |||
| 411 | Ga0068864_100000003 | |||
| 412 | Ga0068861_100004915 | |||
| 413 | Ga0068863_101042396 | |||
| 414 | Ga0068860_100000326 | |||
| 415 | Ga0068862_100068501 | |||
| 416 | Ga0070712_100003941 | |||
| 417 | Ga0075370_10239156 | |||
| 418 | Ga0097620_100041051 | |||
| 419 | Ga0105251_10015285 | |||
| 420 | Ga0105251_10076868 | |||
| 421 | Ga0105240_10003355 | |||
| 422 | Ga0105238_10035298 | |||
| 423 | Ga0157373_10065917 | |||
| 424 | Ga0163162_10507823 | |||
| 425 | Ga0163162_10651076 | |||
| 426 | Ga0163163_10000136 | |||
| 427 | Ga0157380_10004535 | |||
| 428 | Ga0157380_10458164 | |||
| 429 | Ga0182008_10022337 | |||
| 430 | Ga0182006_1003847 | |||
| 431 | Ga0182007_10027096 | |||
| 432 | Ga0209435_100004 | |||
| 433 | Ga0209435_100214 | |||
| 434 | Ga0209147_100011 | |||
| 435 | Ga0209437_100084 | |||
| 436 | Ga0209437_101166 | |||
| 437 | Ga0209258_100560 | |||
| 438 | Ga0209646_1000032 | |||
| 439 | Ga0209646_1000114 | |||
| 440 | Ga0209646_1000283 | |||
| 441 | Ga0209026_1000062 | |||
| 442 | Ga0209026_1001071 | |||
| 443 | Ga0209026_1008799 | |||
| 444 | Ga0209759_1000054 | |||
| 445 | Ga0209759_1000548 | |||
| 446 | Ga0209759_1026395 | |||
| 447 | Ga0209455_1012314 | |||
| 448 | Ga0209025_1004468 | |||
| 449 | Ga0209564_1000006 | |||
| 450 | Ga0209051_1025547 | |||
| 451 | Ga0207713_1061014 | |||
| 452 | Ga0207680_10007523 | |||
| 453 | Ga0207695_10001902 | |||
| 454 | Ga0207693_10019007 | |||
| 455 | Ga0207681_10000156 | |||
| 456 | Ga0207694_10083481 | |||
| 457 | Ga0207650_10000003 | |||
| 458 | Ga0207644_10000312 | |||
| 459 | Ga0207711_10002080 | |||
| 460 | Ga0207711_10008967 | |||
| 461 | Ga0207667_10087097 | |||
| 462 | Ga0207658_10000004 | |||
| 463 | Ga0207641_10190748 | |||
| 464 | Ga0207676_10000003 | |||
| 465 | Ga0207674_10193579 | |||
| 466 | Ga0207675_100006059 | |||
| 467 | Ga0207698_10002422 | |||
| 468 | Ga0209282_1000063 | |||
| 469 | Ga0268266_10060143 | |||
| 470 | Ga0268265_10001641 | |||
| 471 | Ga0268264_10000123 | |||
| 472 | Ga0265314_10098343 | |||
| 473 | Ga0307406_10311556 | |||
| 474 | Ga0395905_0000589 | |||
| 475 | Ga0450904_000854 | |||
| 476 | Ga0439459_0135096 | |||
| 477 | Ga0495617_000012 | |||
| 478 | Ga0495617_008715 | |||
| 479 | Ga0495627_000118 | |||
| 480 | Ga0495603_0045499 | |||
| 481 | Ga0495590_0000030 | |||
| 482 | Ga0495590_0027219 | |||
| 483 | Ga0495629_0350841 | |||
| 484 | Ga0495638_0000105 | |||
| 485 | Ga0495651_0156487 | |||
| 486 | Ga0495653_0148065 | |||
| 487 | Ga0495650_0000099 | |||
| 488 | Ga0495650_0000213 | |||
| 489 | Ga0495650_0003278 | |||
| 490 | Ga0495580_0013872 | |||
| 491 | Ga0495580_0057052 | |||
| 492 | Ga0495580_0140293 | |||
| 493 | Ga0495582_0188117 | |||
| 494 | Ga0495605_0000040 | |||
| 495 | Ga0495605_0000072 | |||
| 496 | Ga0495605_0027676 | |||
| 497 | Ga0495605_0118435 | |||
| 498 | Ga0495605_0158535 | |||
| 499 | Ga0495605_0181183 | |||
| 500 | Ga0495639_0034332 | |||
| 501 | Ga0495584_0000381 | |||
| 502 | Ga0495584_0007663 | |||
| 503 | Ga0495584_0016136 | |||
| 504 | Ga0495584_0018145 | |||
| 505 | Ga0495584_0089558 | |||
| 506 | Ga0495585_0000531 | |||
| 507 | Ga0495585_0000742 | |||
| 508 | Ga0495585_0051712 | |||
| 509 | Ga0495585_0074964 | |||
| 510 | Ga0495585_0123889 | |||
| 511 | Ga0495585_0169984 | |||
| 512 | Ga0495585_0240977 | |||
| 513 | Ga0495594_0009587 | |||
| 514 | Ga0495594_0137793 | |||
| 515 | Ga0495594_0274684 | |||
| 516 | Ga0495596_0000029 | |||
| 517 | Ga0495596_0000243 | |||
| 518 | Ga0495596_0001487 | |||
| 519 | Ga0495596_0003835 | |||
| 520 | Ga0495596_0004139 | |||
| 521 | Ga0495596_0008897 | |||
| 522 | Ga0495596_0017721 | |||
| 523 | Ga0495596_0034377 | |||
| 524 | Ga0495607_0001726 | |||
| 525 | Ga0495607_0003190 | |||
| 526 | Ga0495607_0005992 | |||
| 527 | Ga0495607_0015552 | |||
| 528 | Ga0495607_0292840 | |||
| 529 | Ga0495607_0352359 | |||
| 530 | Ga0495583_0000202 | |||
| 531 | Ga0495583_0070195 | |||
| 532 | Ga0495583_0093194 | |||
| 533 | Ga0495583_0190658 | |||
| 534 | Ga0495606_0000316 | |||
| 535 | Ga0495606_0002713 | |||
| 536 | Ga0495606_0058502 | |||
| 537 | Ga0495606_0158039 | |||
| 538 | Ga0495606_0167586 | |||
| 539 | Ga0495606_0181806 | |||
| 540 | Ga0495610_0160590 | |||
| 541 | Ga0495616_0000034 | |||
| 542 | Ga0495616_0000195 | |||
| 543 | Ga0495616_0000388 | |||
| 544 | Ga0495616_0005661 | |||
| 545 | Ga0495616_0012532 | |||
| 546 | Ga0495616_0019800 | |||
| 547 | Ga0495616_0230667 | |||
| 548 | Ga0495616_0269061 | |||
| 549 | Ga0495628_0006086 | |||
| 550 | Ga0495631_0004538 | |||
| 551 | Ga0495631_0004913 | |||
| 552 | Ga0495631_0020774 | |||
| 553 | Ga0495631_0053700 | |||
| 554 | Ga0495631_0082686 | |||
| 555 | Ga0495632_0000033 | |||
| 556 | Ga0495632_0000086 | |||
| 557 | Ga0495632_0000156 | |||
| 558 | Ga0495632_0000853 | |||
| 559 | Ga0495637_0015198 | |||
| 560 | Ga0495637_0027323 | |||
| 561 | Ga0495637_0063924 | |||
| 562 | Ga0495643_0000181 | |||
| 563 | Ga0495643_0000742 | |||
| 564 | Ga0495643_0000937 | |||
| 565 | Ga0495643_0006199 | |||
| 566 | Ga0495643_0006905 | |||
| 567 | Ga0495643_0079419 | |||
| 568 | Ga0495643_0267024 | |||
| 569 | Ga0495644_0002270 | |||
| 570 | Ga0495644_0033422 | |||
| 571 | Ga0495644_0046599 | |||
| 572 | Ga0495644_0102851 | |||
| 573 | Ga0495648_0000008 | |||
| 574 | Ga0495648_0000116 | |||
| 575 | Ga0495648_0000505 | |||
| 576 | Ga0495648_0003863 | |||
| 577 | Ga0495648_0005481 | |||
| 578 | Ga0495648_0007837 | |||
| 579 | Ga0495648_0019819 | |||
| 580 | Ga0495648_0037553 | |||
| 581 | Ga0495648_0064574 | |||
| 582 | Ga0495663_0001491 | |||
| 583 | Ga0495666_0000508 | |||
| 584 | Ga0495666_0019873 | |||
| 585 | Ga0495642_0000010 | |||
| 586 | Ga0495642_0000218 | |||
| 587 | Ga0495642_0000459 | |||
| 588 | Ga0495642_0002734 | |||
| 589 | Ga0495642_0004046 | |||
| 590 | Ga0495642_0014391 | |||
| 591 | Ga0495652_0014252 | |||
| 592 | Ga0495652_0060251 | |||
| 593 | Ga0495654_0005595 | |||
| 594 | Ga0495654_0031129 | |||
| 595 | Ga0495654_0102061 | |||
| 596 | Ga0495665_0018745 | |||
| 597 | Ga0495587_0096906 | |||
| 598 | Ga0495609_0000044 | |||
| 599 | Ga0495609_0000760 | |||
| 600 | Ga0495609_0003410 | |||
| 601 | Ga0495609_0006742 | |||
| 602 | Ga0495609_0008303 | |||
| 603 | Ga0495609_0008565 | |||
| 604 | Ga0495609_0031688 | |||
| 605 | Ga0495609_0031751 | |||
| 606 | Ga0495609_0229239 | |||
| 607 | Ga0495621_0248984 | |||
| 608 | Ga0495597_0000310 | |||
| 609 | Ga0495597_0000532 | |||
| 610 | Ga0495597_0002234 | |||
| 611 | Ga0495597_0003418 | |||
| 612 | Ga0495597_0012024 | |||
| 613 | Ga0495597_0014564 | |||
| 614 | Ga0495597_0055426 | |||
| 615 | Ga0495645_0013862 | |||
| 616 | Ga0495645_0026559 | |||
| 617 | Ga0495622_0000129 | |||
| 618 | Ga0495622_0000188 | |||
| 619 | Ga0495622_0015182 | |||
| 620 | Ga0495633_0000810 | |||
| 621 | Ga0495633_0033213 | |||
| 622 | Ga0495633_0088160 | |||
| 623 | Ga0495656_0002173 | |||
| 624 | Ga0495656_0088622 | |||
| 625 | Ga0495668_0000532 | |||
| 626 | Ga0495668_0001032 | |||
| 627 | Ga0495668_0002189 | |||
| 628 | Ga0495668_0018421 | |||
| 629 | Ga0495668_0084823 | |||
| 630 | Ga0495611_0009078 | |||
| 631 | Ga0495611_0074015 | |||
| 632 | Ga0495625_0000278 | |||
| 633 | Ga0495625_0004513 | |||
| 634 | Ga0495625_0010704 | |||
| 635 | Ga0495625_0065254 | |||
| 636 | Ga0495625_0070132 | |||
| 637 | Ga0495625_0130141 | |||
| 638 | Ga0495625_0196589 | |||
| 639 | Ga0495625_0620226 | |||
| 640 | Ga0495659_0015081 | |||
| 641 | Ga0495659_0063114 | |||
| 642 | Ga0495661_0000426 | |||
| 643 | Ga0495661_0002490 | |||
| 644 | Ga0495661_0003899 | |||
| 645 | Ga0495661_0014844 | |||
| 646 | Ga0495661_0018907 | |||
| 647 | Ga0495661_0020199 | |||
| 648 | Ga0495661_0021810 | |||
| 649 | Ga0495661_0094194 | |||
| 650 | Ga0495661_0171847 | |||
| 651 | Ga0495661_0218289 | |||
| 652 | Ga0495588_0007145 | |||
| 653 | Ga0495588_0096258 | |||
| 654 | Ga0495588_0116899 | |||
| 655 | Ga0495588_0241704 | |||
| 656 | Ga0495646_0041520 | |||
| 657 | Ga0495669_0000203 | |||
| 658 | Ga0495669_0005584 | |||
| 659 | Ga0495624_0423041 | |||
| 660 | Ga0495670_0007699 | |||
| 661 | Ga0495670_0046029 | |||
| 662 | Ga0495670_0054588 | |||
| 663 | Ga0495670_0124454 | |||
| 664 | Ga0495670_0183464 | |||
| 665 | Ga0495671_0000092 | |||
| 666 | Ga0495671_0000484 | |||
| 667 | Ga0495671_0008571 | |||
| 668 | Ga0495671_0229364 | |||
| 669 | Ga0495649_0004095 | |||
| 670 | Ga0495589_0000035 | |||
| 671 | Ga0495589_0000115 | |||
| 672 | Ga0495589_0004233 | |||
| 673 | Ga0495589_0025674 | |||
| 674 | Ga0495589_0070164 | |||
| 675 | Ga0495589_0083746 | |||
| 676 | Ga0495660_0000218 | |||
| 677 | Ga0495660_0005717 | |||
| 678 | Ga0495660_0071518 | |||
| 679 | Ga0495660_0125431 | |||
| 680 | Ga0495604_0036542 | |||
| 681 | Ga0495604_0182836 | |||
| 682 | Ga0495636_0035897 | |||
| 683 | Ga0495636_0037369 | |||
| 684 | Ga0495636_0045189 | |||
| 685 | Ga0495636_0049026 | |||
| 686 | Ga0495636_0077999 | |||
| 687 | Ga0495636_0204239 | |||
| 688 | Ga0495672_0000285 | |||
| 689 | Ga0495672_0000322 | |||
| 690 | Ga0495672_0001570 | |||
| 691 | Ga0495676_0038304 | |||
| 692 | Ga0495676_0040419 | |||
| 693 | Ga0495683_0005791 | |||
| 694 | Ga0495683_0038507 | |||
| 695 | Ga0495683_0071384 | |||
| 696 | Ga0495683_0103550 | |||
| 697 | Ga0495683_0151052 | |||
| 698 | Ga0495687_000002 | |||
| 699 | Ga0495687_000066 | |||
| 700 | Ga0495687_000086 | |||
| 701 | Ga0495687_007981 | |||
| 702 | Ga0495677_0000013 | |||
| 703 | Ga0495677_0000985 | |||
| 704 | Ga0495677_0004324 | |||
| 705 | Ga0495677_0011948 | |||
| 706 | Ga0495677_0014205 | |||
| 707 | Ga0495677_0022951 | |||
| 708 | Ga0495677_0025590 | |||
| 709 | Ga0495677_0048132 | |||
| 710 | Ga0495685_020792 | |||
| 711 | Ga0495685_115529 | |||
| 712 | Ga0495673_0005766 | |||
| 713 | Ga0495681_0000016 | |||
| 714 | Ga0495681_0010130 | |||
| 715 | Ga0495681_0030386 | |||
| 716 | Ga0495681_0035504 | |||
| 717 | Ga0495686_0000054 | |||
| 718 | Ga0495686_0000464 | |||
| 719 | Ga0495602_0192540 | |||
| 720 | Ga0495615_0008848 | |||
| 721 | Ga0495615_0044623 | |||
| 722 | Ga0495615_0109375 | |||
| 723 | Ga0495626_0000011 | |||
| 724 | Ga0495626_0000071 | |||
| 725 | Ga0495626_0000974 | |||
| 726 | Ga0495626_0001290 | |||
| 727 | Ga0495626_0004939 | |||
| 728 | Ga0495626_0006446 | |||
| 729 | Ga0495626_0007720 | |||
| 730 | Ga0495626_0010381 | |||
| 731 | Ga0495626_0014101 | |||
| 732 | Ga0495626_0028622 | |||
| 733 | Ga0495626_0036488 | |||
| 734 | Ga0495626_0156070 | |||
| 735 | Ga0496102_0000279 | |||
| 736 | Ga0496103_0001678 | |||
| 737 | Ga0496104_0428969 | |||
| 738 | Ga0496104_0656401 | |||
| 739 | Ga0496105_1001154 | |||
| 740 | Ga0496116_0010763 | |||
| 741 | Ga0496116_0038637 | |||
| 742 | Ga0496118_0089671 | |||
| 743 | Ga0496122_0000513 | |||
| 744 | Ga0496123_0000145 | |||
| 745 | Ga0496125_0001481 | |||
| 746 | Ga0496125_0032436 | |||
| 747 | Ga0495678_000035 | |||
| 748 | Ga0495678_000780 | |||
| 749 | Ga0495678_007909 | |||
| 750 | Ga0495678_014909 | |||
| 751 | Ga0495682_0000365 | |||
| 752 | Ga0495682_0000677 | |||
| 753 | Ga0495682_0138824 | |||
| 754 | Ga0501315_045732 | |||
| 755 | nmdc:mga0qj67_694188_c1 | |||
| 756 | Ga0500618_001616 | |||
| 757 | 2511249159 | |||
| 758 | 2513954338 | |||
| 759 | 2514040938 | |||
| 760 | 2550692418 | |||
| 761 | 2644027962 | |||
| 762 | 2819592562 | |||
| 763 | 2842714023 | |||
| 764 | 2858689478 | |||
| 765 | 2884812349 | |||
| 766 | 2884838949 | |||
| 767 | 2884855241 | |||
| 768 | 2896156090 | |||
| 769 | 2901312288 | |||
| 770 | 644748913 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ixg-assembly1.cif.gz_A | crystal structure of burkholderia cenocepacia bcnb | 0.9679 | 23 | 188 |
| 5ixg-assembly1.cif.gz_A | crystal structure of burkholderia cenocepacia bcnb | 0.9511 | 23 | 188 |
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.9205 | 23 | 188 |
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.9164 | 23 | 189 |
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.9049 | 23 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ixgA00 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9679 | 23 | 188 | 2.40.128.110 |
| 5ixgA00 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9511 | 23 | 188 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9218 | 23 | 189 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9062 | 23 | 189 | 2.40.128.110 |
| 1wubA00 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8996 | 23 | 186 | 2.40.128.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S1HC48-F1-model_v4 | Lipid/polyisoprenoid-binding YceI-like domain-containing protein | 0.9802 | 56 | 170 |
|
| AF-A0A257DAK4-F1-model_v4 | Lipid/polyisoprenoid-binding YceI-like domain-containing protein | 0.9802 | 80 | 188 |
|
| AF-A0A522S201-F1-model_v4 | Polyisoprenoid-binding protein | 0.9795 | 19 | 188 |
|
| AF-A0A2I8EWK9-F1-model_v4 | Polyisoprenoid-binding protein | 0.9784 | 19 | 189 |
|
| AF-A0A2M8DSP7-F1-model_v4 | Polyisoprenoid-binding protein | 0.9781 | 27 | 188 |
|