F430504

General Info

Members Datasets Scaffolds Average Seq Length
386 134 772 637

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10008454|Ga0157369_1000845410
Length 635
Sequence MSERDKQASRSRGGDRNLFTRSGARLLSAAAAGDIGVDWPTIGNQQSPQPIPGQPQPLSVETTTDRSYTISLEGLDRIGNSSEVIAQFQQQSALYLDRKKRANAAQMERRAQADADLLGQILRSQGYYDADVEPTIQAQGQALTVALTADPGQQYQFQSVELPGLSGPEADKLRQAFSVKAGDPVVAQDVIAAGIALKIALGRLGFALAKVGEQQITVDHQTHLATLILPVDPGPVARFGAIRVTGKPPFDARHVQEIARFKPGDGFRQDKVDDLRRALIATGLLAAADIKVVPEPNGQAVDLVVDMQPAPPRTIAGELGYGTGEGISLQGSWEHRNLFPPEGALTLRGIAGTREQLAGVQFRRNNFKKRDQVLNLQLVASHTKYDAYTAKTIDIAADFERQSNIIWLKKWTWSLGTELLATDERGIFHDPTQKQTKTFLIAALPLSLAYDGSNDLLNPTKGYRLSAHVSPEYSLHGGSFGYSRAQLDASVYQPVSSNTVLAGRIRLGTIFGASALDIAPSRRFYSGGGGSVRGYGYQRIGPLDAQGDPIGGRSLAEFGLEARFRFGDLGVVPFLDGGSLTEKAAPDLRHWQLGTGVGFRYYSNFGPIRVDIGTPLNRRPGDGRIAVAVSLGQAF

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 4.66
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10008454 3300013105 Bacteria 11806
2 JGI24736J21556_1001895 3300001904 Bacteria 3725
3 JGI24740J21852_10001777 3300001979 Bacteria 9889
4 JGI24739J22299_10005420 3300001989 Bacteria 4848
5 JGI24737J22298_10004572 3300001990 Bacteria 4815
6 JGI24738J21930_10001535 3300002075 Bacteria 6372
7 JGI24744J21845_10001581 3300002077 Bacteria 4545
8 Ga0070658_10000247 3300005327 Bacteria 47860
9 Ga0070658_10001597 3300005327 Bacteria 19154
10 Ga0070658_10002061 3300005327 Bacteria 16856
11 Ga0070658_10023110 3300005327 Bacteria 4991
12 Ga0070658_10031570 3300005327 Bacteria 4254
13 Ga0070658_10060873 3300005327 Bacteria 3075
14 Ga0070658_10126301 3300005327 Bacteria 2129
15 Ga0070676_10005914 3300005328 Bacteria 6529
16 Ga0070683_100005621 3300005329 Bacteria 10478
17 Ga0070670_100075827 3300005331 Bacteria 2889
18 Ga0070666_10016360 3300005335 Bacteria 4745
19 Ga0070666_10023272 3300005335 Bacteria 4032
20 Ga0070680_100000707 3300005336 Bacteria 23165
21 Ga0070680_100003423 3300005336 Bacteria 11842
22 Ga0070680_100009222 3300005336 Bacteria 7567
23 Ga0070680_100009408 3300005336 Bacteria 7507
24 Ga0070680_100013665 3300005336 Bacteria 6330
25 Ga0070680_100058345 3300005336 Bacteria 3156
26 Ga0070682_100020258 3300005337 Bacteria 3912
27 Ga0070660_100000012 3300005339 Bacteria 123961
28 Ga0070660_100000760 3300005339 Bacteria 21407
29 Ga0070660_100001714 3300005339 Bacteria 15027
30 Ga0070660_100009409 3300005339 Bacteria 6870
31 Ga0070660_100013072 3300005339 Bacteria 5944
32 Ga0070660_100020028 3300005339 Bacteria 4910
33 Ga0070661_100000945 3300005344 Bacteria 20690
34 Ga0070661_100004237 3300005344 Bacteria 9890
35 Ga0070661_100009869 3300005344 Bacteria 6623
36 Ga0070661_100015085 3300005344 Bacteria 5452
37 Ga0070692_10001707 3300005345 Bacteria 8164
38 Ga0070692_10005390 3300005345 Bacteria 5449
39 Ga0070692_10033006 3300005345 Bacteria 2607
40 Ga0070668_100044353 3300005347 Bacteria 3412
41 Ga0070671_100000786 3300005355 Bacteria 22862
42 Ga0070671_100001188 3300005355 Bacteria 19501
43 Ga0070671_100014725 3300005355 Bacteria 6322
44 Ga0070671_100018934 3300005355 Bacteria 5597
45 Ga0070671_100029006 3300005355 Bacteria 4561
46 Ga0070671_100037937 3300005355 Bacteria 3998
47 Ga0070673_100010010 3300005364 Bacteria 6396
48 Ga0070659_100001272 3300005366 Bacteria 18288
49 Ga0070659_100017546 3300005366 Bacteria 5391
50 Ga0070659_100018758 3300005366 Bacteria 5222
51 Ga0070659_100033802 3300005366 Bacteria 3974
52 Ga0070659_100037853 3300005366 Bacteria 3761
53 Ga0070659_100111225 3300005366 Bacteria 2211
54 Ga0070667_100003546 3300005367 Bacteria 13300
55 Ga0070667_100019515 3300005367 Bacteria 5625
56 Ga0070663_100001011 3300005455 Bacteria 15326
57 Ga0070663_100011091 3300005455 Bacteria 5642
58 Ga0070663_100023645 3300005455 Bacteria 4121
59 Ga0070663_100066526 3300005455 Bacteria 2611
60 Ga0070678_100001707 3300005456 Bacteria 11796
61 Ga0070678_100018230 3300005456 Bacteria 4547
62 Ga0070678_100040309 3300005456 Bacteria 3304
63 Ga0070662_100001296 3300005457 Bacteria 15362
64 Ga0070681_10002173 3300005458 Bacteria 17844
65 Ga0070681_10096302 3300005458 Bacteria 2908
66 Ga0070679_100034191 3300005530 Bacteria 5037
67 Ga0070679_100056892 3300005530 Bacteria 3897
68 Ga0070679_100058539 3300005530 Bacteria 3839
69 Ga0068853_100080411 3300005539 Bacteria 2851
70 Ga0070672_100038415 3300005543 Bacteria 3658
71 Ga0070665_100002314 3300005548 Bacteria 21146
72 Ga0070665_100017450 3300005548 Bacteria 7206
73 Ga0068855_100000135 3300005563 Bacteria 94502
74 Ga0068855_100001750 3300005563 Bacteria 27115
75 Ga0068855_100047538 3300005563 Bacteria 5069
76 Ga0068855_100063453 3300005563 Bacteria 4311
77 Ga0070664_100001382 3300005564 Bacteria 19334
78 Ga0070664_100010967 3300005564 Bacteria 7347
79 Ga0070664_100016287 3300005564 Bacteria 6094
80 Ga0070664_100019403 3300005564 Bacteria 5595
81 Ga0068857_100013947 3300005577 Bacteria 6993
82 Ga0068854_100002927 3300005578 Bacteria 10595
83 Ga0068854_100007829 3300005578 Bacteria 6839
84 Ga0068854_100022288 3300005578 Bacteria 4311
85 Ga0068854_100026794 3300005578 Bacteria 3965
86 Ga0068854_100072856 3300005578 Bacteria 2516
87 Ga0068856_100007289 3300005614 Bacteria 10790
88 Ga0068856_100014596 3300005614 Bacteria 7590
89 Ga0068856_100039421 3300005614 Bacteria 4638
90 Ga0068856_100058497 3300005614 Bacteria 3806
91 Ga0068852_100001670 3300005616 Bacteria 15121
92 Ga0068852_100001848 3300005616 Bacteria 14394
93 Ga0068852_100004359 3300005616 Bacteria 9993
94 Ga0068852_100006893 3300005616 Bacteria 8258
95 Ga0068852_100037619 3300005616 Unclassified 4059
96 Ga0068859_100011043 3300005617 Bacteria 9087
97 Ga0068859_100011674 3300005617 Bacteria 8828
98 Ga0068859_100066534 3300005617 Bacteria 3638
99 Ga0068864_100001999 3300005618 Bacteria 16790
100 Ga0068864_100004239 3300005618 Bacteria 11799
101 Ga0068864_100026489 3300005618 Bacteria 4889
102 Ga0068864_100033350 3300005618 Bacteria 4377
103 Ga0068864_100036125 3300005618 Bacteria 4210
104 Ga0068863_100020913 3300005841 Bacteria 6250
105 Ga0068858_100001819 3300005842 Bacteria 21706
106 Ga0068858_100005781 3300005842 Bacteria 12080
107 Ga0068858_100009022 3300005842 Bacteria 9537
108 Ga0068860_100002225 3300005843 Bacteria 20416
109 Ga0068862_100021091 3300005844 Bacteria 5446
110 Ga0068862_100021282 3300005844 Bacteria 5420
111 Ga0097621_100015673 3300006237 Bacteria 5711
112 Ga0097620_100011044 3300006931 Bacteria 9087
113 Ga0097620_100011674 3300006931 Bacteria 8828
114 Ga0097620_100066533 3300006931 Bacteria 3638
115 Ga0105240_10004421 3300009093 Bacteria 21431
116 Ga0105240_10015481 3300009093 Bacteria 10368
117 Ga0105240_10019267 3300009093 Bacteria 9119
118 Ga0105240_10189732 3300009093 Bacteria 2417
119 Ga0105245_10010121 3300009098 Bacteria 8213
120 Ga0105248_10000168 3300009177 Bacteria 76376
121 Ga0105248_10001480 3300009177 Bacteria 26140
122 Ga0105248_10005033 3300009177 Bacteria 14597
123 Ga0105248_10010319 3300009177 Bacteria 10279
124 Ga0105237_10049903 3300009545 Bacteria 4205
125 Ga0105238_10020349 3300009551 Bacteria 6755
126 Ga0157373_10003364 3300013100 Bacteria 12090
127 Ga0157373_10031684 3300013100 Bacteria 3806
128 Ga0157371_10003202 3300013102 Bacteria 15029
129 Ga0157370_10020072 3300013104 Bacteria 6684
130 Ga0157370_10022521 3300013104 Bacteria 6269
131 Ga0157370_10034923 3300013104 Bacteria 4892
132 Ga0157369_10000185 3300013105 Bacteria 86285
133 Ga0157369_10023517 3300013105 Bacteria 6863
134 Ga0157369_10023804 3300013105 Bacteria 6819
135 Ga0157369_10024824 3300013105 Bacteria 6660
136 Ga0157369_10117487 3300013105 Bacteria 2823
137 Ga0157374_10070068 3300013296 Bacteria 3303
138 Ga0157374_10100062 3300013296 Bacteria 2778
139 Ga0157372_10004460 3300013307 Bacteria 14932
140 Ga0157372_10023500 3300013307 Bacteria 6683
141 Ga0157372_10101241 3300013307 Bacteria 3289
142 Ga0157372_10180589 3300013307 Bacteria 2443
143 Ga0157375_10002694 3300013308 Bacteria 15380
144 Ga0163163_10002906 3300014325 Bacteria 14496
145 Ga0157379_10023869 3300014968 Bacteria 5429
146 Ga0213875_10003888 3300021388 Bacteria 8357
147 Ga0207682_10003716 3300025893 Bacteria 6573
148 Ga0207688_10009556 3300025901 Bacteria 5278
149 Ga0207680_10021429 3300025903 Bacteria 3496
150 Ga0207647_10004451 3300025904 Bacteria 10383
151 Ga0207647_10008216 3300025904 Bacteria 7500
152 Ga0207647_10009956 3300025904 Bacteria 6733
153 Ga0207647_10010666 3300025904 Bacteria 6477
154 Ga0207645_10009456 3300025907 Bacteria 6740
155 Ga0207705_10000003 3300025909 Bacteria 709270
156 Ga0207705_10000050 3300025909 Bacteria 170078
157 Ga0207705_10000578 3300025909 Bacteria 30673
158 Ga0207705_10000617 3300025909 Bacteria 29732
159 Ga0207705_10001308 3300025909 Bacteria 19980
160 Ga0207705_10014635 3300025909 Bacteria 5643
161 Ga0207705_10024682 3300025909 Bacteria 4289
162 Ga0207705_10026523 3300025909 Bacteria 4132
163 Ga0207695_10017848 3300025913 Bacteria 8226
164 Ga0207660_10000491 3300025917 Bacteria 26376
165 Ga0207660_10011725 3300025917 Bacteria 5715
166 Ga0207660_10012884 3300025917 Bacteria 5476
167 Ga0207660_10024043 3300025917 Bacteria 4121
168 Ga0207657_10000038 3300025919 Bacteria 123940
169 Ga0207657_10000121 3300025919 Bacteria 78211
170 Ga0207657_10000471 3300025919 Bacteria 42534
171 Ga0207657_10000576 3300025919 Bacteria 38985
172 Ga0207657_10002094 3300025919 Bacteria 21586
173 Ga0207657_10002128 3300025919 Bacteria 21447
174 Ga0207657_10002159 3300025919 Bacteria 21321
175 Ga0207657_10003113 3300025919 Bacteria 17743
176 Ga0207657_10008276 3300025919 Bacteria 10586
177 Ga0207657_10014079 3300025919 Bacteria 7827
178 Ga0207657_10020246 3300025919 Bacteria 6294
179 Ga0207657_10026859 3300025919 Bacteria 5280
180 Ga0207657_10038989 3300025919 Bacteria 4224
181 Ga0207657_10050172 3300025919 Bacteria 3632
182 Ga0207649_10000187 3300025920 Bacteria 50808
183 Ga0207649_10002482 3300025920 Bacteria 10310
184 Ga0207649_10003927 3300025920 Bacteria 8107
185 Ga0207649_10015133 3300025920 Bacteria 4331
186 Ga0207649_10016772 3300025920 Bacteria 4141
187 Ga0207649_10023258 3300025920 Bacteria 3587
188 Ga0207652_10004731 3300025921 Bacteria 11037
189 Ga0207652_10028955 3300025921 Bacteria 4625
190 Ga0207652_10078607 3300025921 Bacteria 2881
191 Ga0207652_10079762 3300025921 Bacteria 2860
192 Ga0207681_10021369 3300025923 Bacteria 4113
193 Ga0207694_10009416 3300025924 Bacteria 7366
194 Ga0207694_10016364 3300025924 Bacteria 5599
195 Ga0207694_10042700 3300025924 Bacteria 3498
196 Ga0207650_10009136 3300025925 Bacteria 6773
197 Ga0207650_10009783 3300025925 Bacteria 6555
198 Ga0207650_10016557 3300025925 Bacteria 5156
199 Ga0207644_10000741 3300025931 Bacteria 20675
200 Ga0207644_10003708 3300025931 Bacteria 9900
201 Ga0207644_10026049 3300025931 Bacteria 4026
202 Ga0207690_10002005 3300025932 Bacteria 12470
203 Ga0207690_10010623 3300025932 Bacteria 5483
204 Ga0207706_10000061 3300025933 Bacteria 109447
205 Ga0207706_10000480 3300025933 Bacteria 42754
206 Ga0207706_10005527 3300025933 Bacteria 11784
207 Ga0207706_10008262 3300025933 Bacteria 9605
208 Ga0207706_10008935 3300025933 Bacteria 9224
209 Ga0207706_10010336 3300025933 Bacteria 8530
210 Ga0207706_10086573 3300025933 Bacteria 2754
211 Ga0207691_10025291 3300025940 Bacteria 5575
212 Ga0207691_10098911 3300025940 Unclassified 2605
213 Ga0207711_10000044 3300025941 Bacteria 157113
214 Ga0207711_10001567 3300025941 Bacteria 21131
215 Ga0207711_10004458 3300025941 Bacteria 11935
216 Ga0207711_10081586 3300025941 Bacteria 2826
217 Ga0207661_10000125 3300025944 Bacteria 48789
218 Ga0207661_10004204 3300025944 Bacteria 10069
219 Ga0207679_10000631 3300025945 Bacteria 23451
220 Ga0207679_10011943 3300025945 Bacteria 5644
221 Ga0207679_10108750 3300025945 Unclassified 2184
222 Ga0207667_10001013 3300025949 Bacteria 35783
223 Ga0207667_10005967 3300025949 Bacteria 14826
224 Ga0207667_10019863 3300025949 Bacteria 7486
225 Ga0207667_10021254 3300025949 Bacteria 7193
226 Ga0207667_10024405 3300025949 Bacteria 6638
227 Ga0207667_10046504 3300025949 Bacteria 4595
228 Ga0207667_10093227 3300025949 Bacteria 3110
229 Ga0207712_10021139 3300025961 Bacteria 4269
230 Ga0207640_10003065 3300025981 Bacteria 9004
231 Ga0207640_10005496 3300025981 Bacteria 6909
232 Ga0207640_10031424 3300025981 Bacteria 3281
233 Ga0207658_10003825 3300025986 Bacteria 10601
234 Ga0207658_10006286 3300025986 Bacteria 8113
235 Ga0207658_10040424 3300025986 Bacteria 3371
236 Ga0207677_10001069 3300026023 Bacteria 14951
237 Ga0207677_10010808 3300026023 Bacteria 5177
238 Ga0207639_10000373 3300026041 Bacteria 30956
239 Ga0207639_10002088 3300026041 Bacteria 13446
240 Ga0207639_10043581 3300026041 Bacteria 3370
241 Ga0207678_10002446 3300026067 Bacteria 16879
242 Ga0207678_10002961 3300026067 Bacteria 15380
243 Ga0207678_10005673 3300026067 Bacteria 11154
244 Ga0207678_10050555 3300026067 Bacteria 3591
245 Ga0207678_10067099 3300026067 Bacteria 3079
246 Ga0207702_10004861 3300026078 Bacteria 11833
247 Ga0207702_10005552 3300026078 Bacteria 11015
248 Ga0207702_10028271 3300026078 Bacteria 4659
249 Ga0207702_10029229 3300026078 Bacteria 4585
250 Ga0207702_10034964 3300026078 Bacteria 4202
251 Ga0207641_10002884 3300026088 Bacteria 15571
252 Ga0207641_10055244 3300026088 Bacteria 3371
253 Ga0207648_10002037 3300026089 Bacteria 22055
254 Ga0207676_10002924 3300026095 Bacteria 12175
255 Ga0207676_10002969 3300026095 Bacteria 12105
256 Ga0207676_10010086 3300026095 Bacteria 6722
257 Ga0207676_10013791 3300026095 Bacteria 5802
258 Ga0207676_10026011 3300026095 Bacteria 4347
259 Ga0207674_10000758 3300026116 Bacteria 42236
260 Ga0207674_10002617 3300026116 Bacteria 22550
261 Ga0207674_10006253 3300026116 Bacteria 14033
262 Ga0207674_10012585 3300026116 Bacteria 9455
263 Ga0207674_10035080 3300026116 Bacteria 5237
264 Ga0207683_10020676 3300026121 Bacteria 5631
265 Ga0207698_10000798 3300026142 Bacteria 18308
266 Ga0207698_10001287 3300026142 Bacteria 14621
267 Ga0207698_10002047 3300026142 Bacteria 11893
268 Ga0207698_10003074 3300026142 Bacteria 10004
269 Ga0207698_10006334 3300026142 Bacteria 7373
270 Ga0207698_10010876 3300026142 Bacteria 5875
271 Ga0268266_10028779 3300028379 Bacteria 4722
272 Ga0268265_10020360 3300028380 Bacteria 4629
273 Ga0268264_10007076 3300028381 Bacteria 9401
274 Ga0307410_10019575 3300031852 Bacteria 4121
275 Ga0307406_10020641 3300031901 Bacteria 3883
276 Ga0307416_100037248 3300032002 Bacteria 3740
277 Ga0373931_0006657 3300035691 Bacteria 5412
278 Ga0395899_0000419 3300037312 Bacteria 49177
279 Ga0395899_0038745 3300037312 Bacteria 3568
280 Ga0395899_0078945 3300037312 Bacteria 2398
281 Ga0395900_0000817 3300037418 Bacteria 41225
282 Ga0395900_0002988 3300037418 Bacteria 18402
283 Ga0395900_0003442 3300037418 Bacteria 17112
284 Ga0395900_0020258 3300037418 Bacteria 6788
285 Ga0395900_0023278 3300037418 Bacteria 6339
286 Ga0395900_0048308 3300037418 Bacteria 4383
287 Ga0395900_0050569 3300037418 Bacteria 4280
288 Ga0395900_0059692 3300037418 Bacteria 3926
289 Ga0395900_0065150 3300037418 Bacteria 3743
290 Ga0395900_0066957 3300037418 Bacteria 3691
291 Ga0395900_0079581 3300037418 Bacteria 3368
292 Ga0395900_0080275 3300037418 Bacteria 3352
293 Ga0395900_0087159 3300037418 Bacteria 3209
294 Ga0395900_0113636 3300037418 Bacteria 2779
295 Ga0395900_0117365 3300037418 Bacteria 2730
296 Ga0395898_0012294 3300037466 Bacteria 8853
297 Ga0395898_0015567 3300037466 Bacteria 7798
298 Ga0395898_0017963 3300037466 Bacteria 7216
299 Ga0395898_0019218 3300037466 Bacteria 6955
300 Ga0395898_0026832 3300037466 Bacteria 5789
301 Ga0395898_0041197 3300037466 Bacteria 4562
302 Ga0395898_0084245 3300037466 Bacteria 3064
303 Ga0395898_0095275 3300037466 Bacteria 2860
304 Ga0395898_0106781 3300037466 Bacteria 2685
305 Ga0395905_0000092 3300037471 Bacteria 149300
306 Ga0395905_0004217 3300037471 Bacteria 15031
307 Ga0395905_0006512 3300037471 Bacteria 11745
308 Ga0395905_0008306 3300037471 Bacteria 10243
309 Ga0395905_0010835 3300037471 Bacteria 8831
310 Ga0395905_0011462 3300037471 Bacteria 8567
311 Ga0395905_0016929 3300037471 Bacteria 6924
312 Ga0395905_0017087 3300037471 Bacteria 6889
313 Ga0395905_0018494 3300037471 Bacteria 6613
314 Ga0395905_0019509 3300037471 Bacteria 6426
315 Ga0395905_0021545 3300037471 Bacteria 6093
316 Ga0395905_0024776 3300037471 Bacteria 5662
317 Ga0395905_0030352 3300037471 Bacteria 5094
318 Ga0395905_0042841 3300037471 Bacteria 4246
319 Ga0395905_0074640 3300037471 Bacteria 3178
320 Ga0395905_0076289 3300037471 Unclassified 3141
321 Ga0395905_0131306 3300037471 Bacteria 2355
322 Ga0436364_0130435 3300037853 Bacteria 29193
323 Ga0395901_0000030 3300038443 Bacteria 241916
324 Ga0395901_0000188 3300038443 Bacteria 78908
325 Ga0395901_0010244 3300038443 Bacteria 9496
326 Ga0395901_0010666 3300038443 Bacteria 9313
327 Ga0395901_0018151 3300038443 Bacteria 7180
328 Ga0395901_0018706 3300038443 Bacteria 7076
329 Ga0395901_0021992 3300038443 Bacteria 6537
330 Ga0395901_0025225 3300038443 Bacteria 6103
331 Ga0395901_0026876 3300038443 Bacteria 5908
332 Ga0395901_0029594 3300038443 Bacteria 5640
333 Ga0395901_0034407 3300038443 Bacteria 5232
334 Ga0395901_0049734 3300038443 Bacteria 4356
335 Ga0395901_0050129 3300038443 Unclassified 4338
336 Ga0395901_0059429 3300038443 Bacteria 3977
337 Ga0395901_0060885 3300038443 Bacteria 3928
338 Ga0395901_0074938 3300038443 Bacteria 3530
339 Ga0395901_0121690 3300038443 Bacteria 2742
340 Ga0395901_0122021 3300038443 Bacteria 2739
341 Ga0395901_0171789 3300038443 Bacteria 2274
342 Ga0395901_0228478 3300038443 Bacteria 1943
343 Ga0450889_000116 3300042144 Bacteria 7855
344 Ga0466966_0000004 3300044684 Bacteria 223594
345 Ga0466966_0059449 3300044684 Bacteria 2414
346 Ga0466961_0001994 3300044693 Bacteria 12706
347 Ga0466963_0007364 3300044694 Bacteria 6556
348 Ga0466963_0010090 3300044694 Bacteria 5711
349 Ga0466963_0053646 3300044694 Bacteria 2677
350 Ga0466970_0003633 3300044765 Bacteria 7522
351 Ga0466970_0013043 3300044765 Bacteria 4259
352 Ga0466970_0021678 3300044765 Bacteria 3348
353 Ga0466957_0001592 3300044842 Bacteria 11931
354 Ga0466957_0007833 3300044842 Bacteria 6054
355 Ga0466957_0026157 3300044842 Bacteria 3461
356 Ga0466959_0009854 3300045049 Bacteria 6808
357 Ga0466959_0058842 3300045049 Bacteria 2799
358 Ga0466958_0001099 3300045836 Bacteria 12466
359 Ga0466967_0006968 3300045976 Bacteria 8088
360 Ga0466967_0020833 3300045976 Bacteria 5310
361 Ga0466967_0052434 3300045976 Bacteria 3580
362 Ga0495598_0000516 3300046537 Bacteria 7164
363 Ga0495621_0000519 3300046539 Bacteria 9514
364 Ga0495668_0002564 3300046616 Bacteria 14767
365 Ga0495670_0007845 3300046691 Bacteria 5250
366 Ga0496100_0011823 3300048903 Bacteria 4981
367 Ga0496102_0033435 3300048905 Bacteria 4622
368 Ga0496103_0019777 3300048906 Bacteria 4042
369 Ga0496106_0004488 3300048909 Bacteria 10354
370 Ga0496106_0035412 3300048909 Bacteria 3733
371 Ga0496107_0023180 3300048910 Bacteria 4388
372 Ga0496107_0065755 3300048910 Bacteria 2629
373 Ga0496108_0005509 3300048911 Bacteria 10241
374 Ga0496108_0007467 3300048911 Bacteria 8861
375 Ga0496108_0091813 3300048911 Bacteria 2581
376 Ga0496109_0019485 3300048912 Bacteria 5986
377 Ga0496110_0058303 3300048913 Bacteria 3401
378 Ga0496111_0000588 3300048914 Bacteria 19077
379 Ga0496112_0001074 3300048915 Bacteria 20212
380 Ga0496113_0000358 3300048916 Bacteria 21890
381 Ga0496113_0014659 3300048916 Bacteria 5357
382 Ga0496113_0019945 3300048916 Bacteria 4702
383 Ga0496114_0000019 3300048917 Bacteria 244365
384 Ga0501080_0009041 3300049742 Bacteria 9068
385 Ga0500658_0000041 3300053134 Bacteria 77435
386 Ga0466962_0004650 3300061719 Bacteria 6593
387 Ga0157369_10008454
388 JGI24736J21556_1001895
389 JGI24740J21852_10001777
390 JGI24739J22299_10005420
391 JGI24737J22298_10004572
392 JGI24738J21930_10001535
393 JGI24744J21845_10001581
394 Ga0070658_10000247
395 Ga0070658_10001597
396 Ga0070658_10002061
397 Ga0070658_10023110
398 Ga0070658_10031570
399 Ga0070658_10060873
400 Ga0070658_10126301
401 Ga0070676_10005914
402 Ga0070683_100005621
403 Ga0070670_100075827
404 Ga0070666_10016360
405 Ga0070666_10023272
406 Ga0070680_100000707
407 Ga0070680_100003423
408 Ga0070680_100009222
409 Ga0070680_100009408
410 Ga0070680_100013665
411 Ga0070680_100058345
412 Ga0070682_100020258
413 Ga0070660_100000012
414 Ga0070660_100000760
415 Ga0070660_100001714
416 Ga0070660_100009409
417 Ga0070660_100013072
418 Ga0070660_100020028
419 Ga0070661_100000945
420 Ga0070661_100004237
421 Ga0070661_100009869
422 Ga0070661_100015085
423 Ga0070692_10001707
424 Ga0070692_10005390
425 Ga0070692_10033006
426 Ga0070668_100044353
427 Ga0070671_100000786
428 Ga0070671_100001188
429 Ga0070671_100014725
430 Ga0070671_100018934
431 Ga0070671_100029006
432 Ga0070671_100037937
433 Ga0070673_100010010
434 Ga0070659_100001272
435 Ga0070659_100017546
436 Ga0070659_100018758
437 Ga0070659_100033802
438 Ga0070659_100037853
439 Ga0070659_100111225
440 Ga0070667_100003546
441 Ga0070667_100019515
442 Ga0070663_100001011
443 Ga0070663_100011091
444 Ga0070663_100023645
445 Ga0070663_100066526
446 Ga0070678_100001707
447 Ga0070678_100018230
448 Ga0070678_100040309
449 Ga0070662_100001296
450 Ga0070681_10002173
451 Ga0070681_10096302
452 Ga0070679_100034191
453 Ga0070679_100056892
454 Ga0070679_100058539
455 Ga0068853_100080411
456 Ga0070672_100038415
457 Ga0070665_100002314
458 Ga0070665_100017450
459 Ga0068855_100000135
460 Ga0068855_100001750
461 Ga0068855_100047538
462 Ga0068855_100063453
463 Ga0070664_100001382
464 Ga0070664_100010967
465 Ga0070664_100016287
466 Ga0070664_100019403
467 Ga0068857_100013947
468 Ga0068854_100002927
469 Ga0068854_100007829
470 Ga0068854_100022288
471 Ga0068854_100026794
472 Ga0068854_100072856
473 Ga0068856_100007289
474 Ga0068856_100014596
475 Ga0068856_100039421
476 Ga0068856_100058497
477 Ga0068852_100001670
478 Ga0068852_100001848
479 Ga0068852_100004359
480 Ga0068852_100006893
481 Ga0068852_100037619
482 Ga0068859_100011043
483 Ga0068859_100011674
484 Ga0068859_100066534
485 Ga0068864_100001999
486 Ga0068864_100004239
487 Ga0068864_100026489
488 Ga0068864_100033350
489 Ga0068864_100036125
490 Ga0068863_100020913
491 Ga0068858_100001819
492 Ga0068858_100005781
493 Ga0068858_100009022
494 Ga0068860_100002225
495 Ga0068862_100021091
496 Ga0068862_100021282
497 Ga0097621_100015673
498 Ga0097620_100011044
499 Ga0097620_100011674
500 Ga0097620_100066533
501 Ga0105240_10004421
502 Ga0105240_10015481
503 Ga0105240_10019267
504 Ga0105240_10189732
505 Ga0105245_10010121
506 Ga0105248_10000168
507 Ga0105248_10001480
508 Ga0105248_10005033
509 Ga0105248_10010319
510 Ga0105237_10049903
511 Ga0105238_10020349
512 Ga0157373_10003364
513 Ga0157373_10031684
514 Ga0157371_10003202
515 Ga0157370_10020072
516 Ga0157370_10022521
517 Ga0157370_10034923
518 Ga0157369_10000185
519 Ga0157369_10023517
520 Ga0157369_10023804
521 Ga0157369_10024824
522 Ga0157369_10117487
523 Ga0157374_10070068
524 Ga0157374_10100062
525 Ga0157372_10004460
526 Ga0157372_10023500
527 Ga0157372_10101241
528 Ga0157372_10180589
529 Ga0157375_10002694
530 Ga0163163_10002906
531 Ga0157379_10023869
532 Ga0213875_10003888
533 Ga0207682_10003716
534 Ga0207688_10009556
535 Ga0207680_10021429
536 Ga0207647_10004451
537 Ga0207647_10008216
538 Ga0207647_10009956
539 Ga0207647_10010666
540 Ga0207645_10009456
541 Ga0207705_10000003
542 Ga0207705_10000050
543 Ga0207705_10000578
544 Ga0207705_10000617
545 Ga0207705_10001308
546 Ga0207705_10014635
547 Ga0207705_10024682
548 Ga0207705_10026523
549 Ga0207695_10017848
550 Ga0207660_10000491
551 Ga0207660_10011725
552 Ga0207660_10012884
553 Ga0207660_10024043
554 Ga0207657_10000038
555 Ga0207657_10000121
556 Ga0207657_10000471
557 Ga0207657_10000576
558 Ga0207657_10002094
559 Ga0207657_10002128
560 Ga0207657_10002159
561 Ga0207657_10003113
562 Ga0207657_10008276
563 Ga0207657_10014079
564 Ga0207657_10020246
565 Ga0207657_10026859
566 Ga0207657_10038989
567 Ga0207657_10050172
568 Ga0207649_10000187
569 Ga0207649_10002482
570 Ga0207649_10003927
571 Ga0207649_10015133
572 Ga0207649_10016772
573 Ga0207649_10023258
574 Ga0207652_10004731
575 Ga0207652_10028955
576 Ga0207652_10078607
577 Ga0207652_10079762
578 Ga0207681_10021369
579 Ga0207694_10009416
580 Ga0207694_10016364
581 Ga0207694_10042700
582 Ga0207650_10009136
583 Ga0207650_10009783
584 Ga0207650_10016557
585 Ga0207644_10000741
586 Ga0207644_10003708
587 Ga0207644_10026049
588 Ga0207690_10002005
589 Ga0207690_10010623
590 Ga0207706_10000061
591 Ga0207706_10000480
592 Ga0207706_10005527
593 Ga0207706_10008262
594 Ga0207706_10008935
595 Ga0207706_10010336
596 Ga0207706_10086573
597 Ga0207691_10025291
598 Ga0207691_10098911
599 Ga0207711_10000044
600 Ga0207711_10001567
601 Ga0207711_10004458
602 Ga0207711_10081586
603 Ga0207661_10000125
604 Ga0207661_10004204
605 Ga0207679_10000631
606 Ga0207679_10011943
607 Ga0207679_10108750
608 Ga0207667_10001013
609 Ga0207667_10005967
610 Ga0207667_10019863
611 Ga0207667_10021254
612 Ga0207667_10024405
613 Ga0207667_10046504
614 Ga0207667_10093227
615 Ga0207712_10021139
616 Ga0207640_10003065
617 Ga0207640_10005496
618 Ga0207640_10031424
619 Ga0207658_10003825
620 Ga0207658_10006286
621 Ga0207658_10040424
622 Ga0207677_10001069
623 Ga0207677_10010808
624 Ga0207639_10000373
625 Ga0207639_10002088
626 Ga0207639_10043581
627 Ga0207678_10002446
628 Ga0207678_10002961
629 Ga0207678_10005673
630 Ga0207678_10050555
631 Ga0207678_10067099
632 Ga0207702_10004861
633 Ga0207702_10005552
634 Ga0207702_10028271
635 Ga0207702_10029229
636 Ga0207702_10034964
637 Ga0207641_10002884
638 Ga0207641_10055244
639 Ga0207648_10002037
640 Ga0207676_10002924
641 Ga0207676_10002969
642 Ga0207676_10010086
643 Ga0207676_10013791
644 Ga0207676_10026011
645 Ga0207674_10000758
646 Ga0207674_10002617
647 Ga0207674_10006253
648 Ga0207674_10012585
649 Ga0207674_10035080
650 Ga0207683_10020676
651 Ga0207698_10000798
652 Ga0207698_10001287
653 Ga0207698_10002047
654 Ga0207698_10003074
655 Ga0207698_10006334
656 Ga0207698_10010876
657 Ga0268266_10028779
658 Ga0268265_10020360
659 Ga0268264_10007076
660 Ga0307410_10019575
661 Ga0307406_10020641
662 Ga0307416_100037248
663 Ga0373931_0006657
664 Ga0395899_0000419
665 Ga0395899_0038745
666 Ga0395899_0078945
667 Ga0395900_0000817
668 Ga0395900_0002988
669 Ga0395900_0003442
670 Ga0395900_0020258
671 Ga0395900_0023278
672 Ga0395900_0048308
673 Ga0395900_0050569
674 Ga0395900_0059692
675 Ga0395900_0065150
676 Ga0395900_0066957
677 Ga0395900_0079581
678 Ga0395900_0080275
679 Ga0395900_0087159
680 Ga0395900_0113636
681 Ga0395900_0117365
682 Ga0395898_0012294
683 Ga0395898_0015567
684 Ga0395898_0017963
685 Ga0395898_0019218
686 Ga0395898_0026832
687 Ga0395898_0041197
688 Ga0395898_0084245
689 Ga0395898_0095275
690 Ga0395898_0106781
691 Ga0395905_0000092
692 Ga0395905_0004217
693 Ga0395905_0006512
694 Ga0395905_0008306
695 Ga0395905_0010835
696 Ga0395905_0011462
697 Ga0395905_0016929
698 Ga0395905_0017087
699 Ga0395905_0018494
700 Ga0395905_0019509
701 Ga0395905_0021545
702 Ga0395905_0024776
703 Ga0395905_0030352
704 Ga0395905_0042841
705 Ga0395905_0074640
706 Ga0395905_0076289
707 Ga0395905_0131306
708 Ga0436364_0130435
709 Ga0395901_0000030
710 Ga0395901_0000188
711 Ga0395901_0010244
712 Ga0395901_0010666
713 Ga0395901_0018151
714 Ga0395901_0018706
715 Ga0395901_0021992
716 Ga0395901_0025225
717 Ga0395901_0026876
718 Ga0395901_0029594
719 Ga0395901_0034407
720 Ga0395901_0049734
721 Ga0395901_0050129
722 Ga0395901_0059429
723 Ga0395901_0060885
724 Ga0395901_0074938
725 Ga0395901_0121690
726 Ga0395901_0122021
727 Ga0395901_0171789
728 Ga0395901_0228478
729 Ga0450889_000116
730 Ga0466966_0000004
731 Ga0466966_0059449
732 Ga0466961_0001994
733 Ga0466963_0007364
734 Ga0466963_0010090
735 Ga0466963_0053646
736 Ga0466970_0003633
737 Ga0466970_0013043
738 Ga0466970_0021678
739 Ga0466957_0001592
740 Ga0466957_0007833
741 Ga0466957_0026157
742 Ga0466959_0009854
743 Ga0466959_0058842
744 Ga0466958_0001099
745 Ga0466967_0006968
746 Ga0466967_0020833
747 Ga0466967_0052434
748 Ga0495598_0000516
749 Ga0495621_0000519
750 Ga0495668_0002564
751 Ga0495670_0007845
752 Ga0496100_0011823
753 Ga0496102_0033435
754 Ga0496103_0019777
755 Ga0496106_0004488
756 Ga0496106_0035412
757 Ga0496107_0023180
758 Ga0496107_0065755
759 Ga0496108_0005509
760 Ga0496108_0007467
761 Ga0496108_0091813
762 Ga0496109_0019485
763 Ga0496110_0058303
764 Ga0496111_0000588
765 Ga0496112_0001074
766 Ga0496113_0000358
767 Ga0496113_0014659
768 Ga0496113_0019945
769 Ga0496114_0000019
770 Ga0501080_0009041
771 Ga0500658_0000041
772 Ga0466962_0004650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01103

Omp85

Omp85 superfamily domain

321

635

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q6b-assembly1.cif.gz_A the high-resolution and new form crystal structure of bama potra4-5 from e.coli 0.8039 149 303
3q6b-assembly1.cif.gz_A the high-resolution and new form crystal structure of bama potra4-5 from e.coli 0.7951 149 303
4n74-assembly1.cif.gz_A crystal structure of outer membrane protein tama beta-barrel domain in e.coli 0.7826 306 627
6izs-assembly1.cif.gz_A crystal structure of haemophilus influenzae bama potra4 0.781 148 229
4n74-assembly1.cif.gz_A crystal structure of outer membrane protein tama beta-barrel domain in e.coli 0.774 306 627
ID Description Score Start End Superfamily
5aywA05 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8426 232 306 3.10.20.310
4k3bA05 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8385 232 306 3.10.20.310
4pk1A01 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8288 150 227 3.10.20.310
5aywA05 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8142 232 306 3.10.20.310
3mc8A03 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.803 234 306 3.10.20.310
ID Description Score Start End GO Terms
AF-A0A077AS02-F1-model_v4 Bacterial surface antigen (D15) domain-containing protein 0.8049 328 630 GO:0019867
AF-A0A077AS02-F1-model_v4 Bacterial surface antigen (D15) domain-containing protein 0.8002 328 630 GO:0019867
AF-A0A4Q3JCY9-F1-model_v4 deleted 0.7789 438 630
AF-A0A2W6Y2I4-F1-model_v4 Metallophosphoesterase 0.7769 308 625
AF-A0A2X4YLK8-F1-model_v4 deleted 0.772 338 627

Map