F430607

General Info

Members Datasets Scaffolds Average Seq Length
386 195 772 382

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0002729|Ga0495616_0002729_2773_4011
Length 412
Sequence MWLQRSKLNDYLSLNQNIMFKHLFKLIWNKKKQNFLLITEMLVSFLVLFAVFTLMMFYYNNYKKPMGFDYQDVWVINYNNSYQTKNVDSLDLYYETLRKTIKSLPHVKEITFVSGNIPFSSRTNQGGLTFRGKHVDHLNNFTAEDYYEKVMNVTLLEGRWFNKEDVVSKNQHIIIDADLKEATFGKEPAVGKLLGNDDDKNKYKVVGVIQTIKRNGDYLNAGPGMYFRTDTGSFRWLDKILVKVDRGADAAFEGKLYKTMANYMKNANVEIEHLANKRTDANYFALVPMIILAIVSTFLVVNVALGLFGVLWYNINKRRGEIGLRRAIGATGKSVAAQLVSESMILATLALIIGTFFAAQFPLLNVFDLPAIVYIEGILLSVLFVYLLVLICSLYPGKQAAAIYPAVALHEE

Samples

Sample ID Description Type Environment
1 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
171 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
175 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
176 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
177 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
180 2738541283 Pedobacter sp. OK701 Isolate Unclassified
181 2738541284 Pedobacter sp. YR016 Isolate Unclassified
182 2738541302 Pedobacter sp. CF074 Isolate Unclassified
183 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
184 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
185 2818991437 Pedobacter terrae 518 Isolate Unclassified
186 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
187 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
188 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
189 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
190 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
191 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
192 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
193 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
194 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
195 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 0
Isolates 4.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.66
Nodule 0
Rhizoplane 0.26
Rhizosphere 76.68
Stem 0
Stem Tuber 0
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495616_0002729 3300046513 Bacteria 11555
2 SwRhRL2b_contig_1109292 2162886007 Bacteria 16391
3 SwRhRL2b_contig_1157535 2162886007 Bacteria 16452
4 JGI24740J21852_10016913 3300001979 Bacteria 2622
5 JGI24739J22299_10003069 3300001989 Bacteria 6378
6 JGI24739J22299_10010232 3300001989 Bacteria 3483
7 JGI24737J22298_10000041 3300001990 Bacteria 37211
8 JGI24737J22298_10009062 3300001990 Bacteria 3318
9 JGI24735J21928_10000001 3300002067 Bacteria 650042
10 JGI25162J39368_1000121 3300002737 Bacteria 85899
11 JGI25162J39368_1002782 3300002737 Bacteria 6189
12 JGI25164J39214_1001349 3300002772 Bacteria 6000
13 JGI25406J46586_10015506 3300003203 Bacteria 3212
14 rootH1_10026547 3300003316 Bacteria 11340
15 rootH1_10046686 3300003316 Bacteria 2390
16 rootH2_10000343 3300003320 Bacteria 102217
17 rootH2_10080304 3300003320 Bacteria 3572
18 rootH2_10181492 3300003320 Bacteria 1577
19 rootH2_10312186 3300003320 Unclassified 1601
20 rootL2_10075502 3300003322 Bacteria 4000
21 rootL2_10094435 3300003322 Bacteria 5196
22 rootL2_10105471 3300003322 Bacteria 3332
23 rootL2_10146438 3300003322 Bacteria 2742
24 rootL2_10181125 3300003322 Bacteria 4659
25 rootL2_10281801 3300003322 Bacteria 3261
26 rootH1_10001370 3300003323 Bacteria 113238
27 rootH1_10073149 3300003323 Bacteria 3510
28 rootH1_10147516 3300003323 Bacteria 4588
29 rootH1_10168855 3300003323 Unclassified 1795
30 rootH1_10190916 3300003323 Bacteria 1502
31 rootH1_10244862 3300003323 Unclassified 2830
32 JGI25160J50197_1001244 3300003354 Bacteria 12919
33 JGI25160J50197_1001283 3300003354 Bacteria 12742
34 Ga0055535_1002870 3300003761 Bacteria 5407
35 Ga0055526_1007283 3300003771 Bacteria 5792
36 Ga0055536_1000009 3300003781 Bacteria 311572
37 Ga0055528_1000572 3300003790 Bacteria 27859
38 Ga0055530_10000789 3300003791 Bacteria 26378
39 Ga0055530_10000943 3300003791 Bacteria 23778
40 Ga0065165_1000017 3300005262 Bacteria 278286
41 Ga0065714_10002263 3300005288 Bacteria 65514
42 Ga0065714_10002864 3300005288 Bacteria 54801
43 Ga0065714_10064508 3300005288 Bacteria 46035
44 Ga0065714_10071301 3300005288 Bacteria 3594
45 Ga0065714_10075273 3300005288 Bacteria 2888
46 Ga0065714_10075458 3300005288 Bacteria 2905
47 Ga0065704_10000229 3300005289 Bacteria 80338
48 Ga0065712_10095194 3300005290 Bacteria 2227
49 Ga0070658_10000080 3300005327 Bacteria 90682
50 Ga0070676_10000140 3300005328 Bacteria 27970
51 Ga0068869_100055855 3300005334 Bacteria 2878
52 Ga0070666_10000042 3300005335 Bacteria 112296
53 Ga0068868_100019165 3300005338 Bacteria 5126
54 Ga0068868_100037836 3300005338 Bacteria 3742
55 Ga0068868_100171772 3300005338 Bacteria 1795
56 Ga0070660_100004493 3300005339 Bacteria 9639
57 Ga0070661_100011648 3300005344 Bacteria 6132
58 Ga0070669_100018855 3300005353 Bacteria 4932
59 Ga0070671_100021632 3300005355 Bacteria 5253
60 Ga0070671_100059329 3300005355 Bacteria 3184
61 Ga0070674_100105546 3300005356 Bacteria 2060
62 Ga0070673_100002084 3300005364 Bacteria 12067
63 Ga0070673_100285756 3300005364 Bacteria 1448
64 Ga0070659_100075178 3300005366 Bacteria 2692
65 Ga0070667_100119427 3300005367 Bacteria 2292
66 Ga0070667_100361212 3300005367 Bacteria 1316
67 Ga0070663_100016864 3300005455 Bacteria 4753
68 Ga0070678_100008809 3300005456 Bacteria 6066
69 Ga0070662_100000081 3300005457 Bacteria 53265
70 Ga0070681_10061275 3300005458 Bacteria 3738
71 Ga0070681_10294885 3300005458 Bacteria 1531
72 Ga0070685_10181663 3300005466 Unclassified 1355
73 Ga0070679_100007702 3300005530 Bacteria 10082
74 Ga0068853_100073679 3300005539 Bacteria 2978
75 Ga0068853_100142376 3300005539 Bacteria 2153
76 Ga0070665_100000001 3300005548 Bacteria 1083363
77 Ga0070665_100000072 3300005548 Bacteria 198575
78 Ga0068855_100000090 3300005563 Bacteria 110528
79 Ga0068855_100006355 3300005563 Bacteria 14401
80 Ga0068855_100007153 3300005563 Bacteria 13546
81 Ga0068855_100013657 3300005563 Bacteria 9794
82 Ga0068855_100021064 3300005563 Bacteria 7817
83 Ga0068855_100076317 3300005563 Bacteria 3890
84 Ga0068855_100247135 3300005563 Bacteria 1991
85 Ga0068855_100281368 3300005563 Bacteria 1847
86 Ga0068857_100371564 3300005577 Bacteria 1326
87 Ga0068856_100000129 3300005614 Bacteria 76536
88 Ga0068856_100103344 3300005614 Bacteria 2843
89 Ga0068856_100405483 3300005614 Unclassified 1383
90 Ga0068852_100000281 3300005616 Bacteria 33979
91 Ga0068852_100027435 3300005616 Bacteria 4642
92 Ga0068859_100000130 3300005617 Bacteria 71018
93 Ga0068859_100010029 3300005617 Bacteria 9554
94 Ga0068864_100003460 3300005618 Bacteria 13038
95 Ga0068863_100008085 3300005841 Bacteria 10273
96 Ga0068863_100023991 3300005841 Bacteria 5821
97 Ga0068858_100003098 3300005842 Bacteria 16637
98 Ga0068860_100001453 3300005843 Bacteria 25628
99 Ga0068860_100002504 3300005843 Bacteria 19274
100 Ga0068860_100016152 3300005843 Bacteria 7285
101 Ga0068860_100042111 3300005843 Bacteria 4364
102 Ga0068860_100147165 3300005843 Bacteria 2267
103 Ga0081539_10000337 3300005985 Bacteria 103868
104 Ga0075366_10002447 3300006195 Bacteria 9508
105 Ga0097621_100000039 3300006237 Bacteria 67231
106 Ga0097621_100009477 3300006237 Bacteria 7069
107 Ga0097621_100191100 3300006237 Unclassified 1773
108 Ga0068871_100002549 3300006358 Bacteria 12434
109 Ga0097620_100000130 3300006931 Bacteria 71018
110 Ga0097620_100010029 3300006931 Bacteria 9554
111 Ga0105240_10000283 3300009093 Bacteria 99553
112 Ga0105240_10007948 3300009093 Bacteria 15307
113 Ga0105240_10008939 3300009093 Bacteria 14244
114 Ga0105240_10027114 3300009093 Bacteria 7506
115 Ga0105243_10042767 3300009148 Bacteria 3548
116 Ga0105241_10000514 3300009174 Bacteria 29151
117 Ga0105241_10001533 3300009174 Bacteria 17705
118 Ga0105241_10003973 3300009174 Bacteria 10930
119 Ga0105237_10000411 3300009545 Bacteria 60960
120 Ga0105237_10000963 3300009545 Bacteria 38740
121 Ga0105237_10001958 3300009545 Bacteria 26220
122 Ga0105237_10001962 3300009545 Bacteria 26195
123 Ga0105237_10009372 3300009545 Bacteria 10489
124 Ga0105237_10013274 3300009545 Bacteria 8642
125 Ga0105237_10023345 3300009545 Bacteria 6339
126 Ga0105237_10049826 3300009545 Bacteria 4208
127 Ga0105237_10060269 3300009545 Bacteria 3797
128 Ga0105237_10065168 3300009545 Bacteria 3640
129 Ga0105237_10133616 3300009545 Bacteria 2476
130 Ga0105238_10002377 3300009551 Bacteria 18888
131 Ga0105238_10133370 3300009551 Bacteria 2462
132 Ga0105238_10198637 3300009551 Unclassified 1981
133 Ga0105249_10004268 3300009553 Bacteria 12351
134 Ga0105249_10012134 3300009553 Bacteria 7584
135 Ga0105239_10000013 3300010375 Bacteria 327371
136 Ga0105239_10000106 3300010375 Bacteria 117256
137 Ga0105239_10000132 3300010375 Bacteria 105380
138 Ga0105239_10000528 3300010375 Bacteria 55243
139 Ga0105239_10001538 3300010375 Bacteria 30493
140 Ga0105239_10016107 3300010375 Bacteria 8271
141 Ga0105239_10039158 3300010375 Bacteria 5194
142 Ga0105239_10050174 3300010375 Bacteria 4577
143 Ga0105239_10108588 3300010375 Unclassified 3074
144 Ga0105239_10484124 3300010375 Unclassified 1406
145 Ga0105246_10021910 3300011119 Bacteria 4119
146 Ga0105246_10028879 3300011119 Bacteria 3647
147 Ga0157373_10000261 3300013100 Bacteria 42879
148 Ga0157373_10001202 3300013100 Bacteria 19803
149 Ga0157373_10025924 3300013100 Bacteria 4236
150 Ga0157373_10217506 3300013100 Bacteria 1347
151 Ga0157371_10000050 3300013102 Bacteria 183160
152 Ga0157371_10001830 3300013102 Bacteria 21442
153 Ga0157371_10001867 3300013102 Bacteria 21086
154 Ga0157371_10005170 3300013102 Bacteria 11108
155 Ga0157371_10023159 3300013102 Bacteria 4541
156 Ga0157371_10024168 3300013102 Bacteria 4439
157 Ga0157371_10060079 3300013102 Bacteria 2695
158 Ga0157371_10128389 3300013102 Bacteria 1803
159 Ga0157371_10137091 3300013102 Bacteria 1743
160 Ga0157370_10000285 3300013104 Bacteria 64200
161 Ga0157370_10005140 3300013104 Bacteria 14752
162 Ga0157370_10015299 3300013104 Bacteria 7805
163 Ga0157370_10054481 3300013104 Bacteria 3812
164 Ga0157370_10057751 3300013104 Bacteria 3688
165 Ga0157370_10161399 3300013104 Bacteria 2085
166 Ga0157370_10179892 3300013104 Bacteria 1965
167 Ga0157369_10001695 3300013105 Bacteria 26849
168 Ga0157369_10025169 3300013105 Bacteria 6608
169 Ga0157374_10000007 3300013296 Bacteria 595643
170 Ga0157374_10000135 3300013296 Bacteria 67340
171 Ga0157374_10003320 3300013296 Bacteria 13514
172 Ga0157374_10037679 3300013296 Bacteria 4440
173 Ga0157374_10096927 3300013296 Bacteria 2821
174 Ga0157374_10208456 3300013296 Bacteria 1916
175 Ga0157378_10026588 3300013297 Bacteria 5100
176 Ga0157378_10026647 3300013297 Bacteria 5095
177 Ga0157378_10035052 3300013297 Bacteria 4437
178 Ga0157378_10061117 3300013297 Bacteria 3361
179 Ga0163162_10000097 3300013306 Bacteria 79518
180 Ga0163162_10039181 3300013306 Bacteria 4734
181 Ga0163162_10041334 3300013306 Bacteria 4613
182 Ga0157372_10000011 3300013307 Bacteria 277202
183 Ga0157372_10001527 3300013307 Bacteria 25162
184 Ga0157372_10015408 3300013307 Bacteria 8193
185 Ga0157372_10030811 3300013307 Bacteria 5869
186 Ga0157372_10042097 3300013307 Bacteria 5050
187 Ga0157372_10106719 3300013307 Bacteria 3204
188 Ga0157372_10297920 3300013307 Bacteria 1876
189 Ga0157375_10084294 3300013308 Bacteria 3226
190 Ga0157375_10246899 3300013308 Bacteria 1945
191 Ga0182008_10000012 3300014497 Bacteria 297475
192 Ga0182008_10000078 3300014497 Bacteria 77087
193 Ga0182008_10026529 3300014497 Bacteria 2938
194 Ga0157377_10008154 3300014745 Bacteria 5095
195 Ga0157377_10022861 3300014745 Bacteria 3307
196 Ga0157379_10229498 3300014968 Bacteria 1682
197 Ga0157376_10000374 3300014969 Bacteria 29126
198 Ga0157376_10003324 3300014969 Bacteria 11067
199 Ga0182006_1000166 3300015261 Bacteria 69787
200 Ga0182006_1000297 3300015261 Bacteria 43680
201 Ga0182006_1003364 3300015261 Bacteria 8224
202 Ga0163161_10000215 3300017792 Bacteria 52730
203 Ga0163161_10000616 3300017792 Bacteria 28501
204 Ga0163161_10022563 3300017792 Bacteria 4433
205 Ga0163161_10022691 3300017792 Bacteria 4421
206 Ga0163161_10050594 3300017792 Bacteria 3008
207 Ga0213872_10023175 3300021361 Bacteria 2857
208 Ga0213876_10027715 3300021384 Bacteria 2987
209 Ga0207427_100125 3300025231 Bacteria 96142
210 Ga0209437_100008 3300025233 Bacteria 921142
211 Ga0209437_100017 3300025233 Bacteria 694471
212 Ga0209258_100029 3300025242 Bacteria 490648
213 Ga0209646_1002343 3300025246 Bacteria 4279
214 Ga0209646_1007623 3300025246 Unclassified 1759
215 Ga0209148_1000163 3300025254 Bacteria 137449
216 Ga0209233_1000024 3300025261 Bacteria 695418
217 Ga0209673_1000354 3300025273 Bacteria 83443
218 Ga0209676_1000001 3300025292 Bacteria 1852142
219 Ga0209564_1003201 3300025295 Bacteria 11499
220 Ga0209564_1004937 3300025295 Bacteria 7884
221 Ga0209564_1017285 3300025295 Bacteria 2820
222 Ga0209758_1003655 3300025297 Bacteria 13704
223 Ga0209758_1008482 3300025297 Bacteria 6639
224 Ga0209050_1000018 3300025298 Bacteria 723263
225 Ga0209050_1000163 3300025298 Bacteria 154895
226 Ga0207426_1000093 3300025302 Bacteria 277663
227 Ga0207426_1002304 3300025302 Bacteria 12553
228 Ga0209257_1005362 3300025304 Bacteria 9055
229 Ga0207680_10000734 3300025903 Bacteria 15445
230 Ga0207647_10000058 3300025904 Bacteria 84631
231 Ga0207645_10001698 3300025907 Bacteria 17878
232 Ga0207645_10222204 3300025907 Bacteria 1245
233 Ga0207705_10000035 3300025909 Bacteria 201649
234 Ga0207654_10001696 3300025911 Bacteria 11512
235 Ga0207654_10036076 3300025911 Unclassified 2760
236 Ga0207654_10119225 3300025911 Bacteria 1654
237 Ga0207695_10000684 3300025913 Bacteria 66519
238 Ga0207695_10005568 3300025913 Bacteria 16636
239 Ga0207695_10028675 3300025913 Bacteria 6163
240 Ga0207695_10062715 3300025913 Bacteria 3836
241 Ga0207671_10001126 3300025914 Bacteria 32182
242 Ga0207671_10002903 3300025914 Bacteria 17700
243 Ga0207671_10003445 3300025914 Bacteria 15761
244 Ga0207671_10006546 3300025914 Bacteria 10353
245 Ga0207671_10014701 3300025914 Bacteria 6173
246 Ga0207671_10041991 3300025914 Bacteria 3385
247 Ga0207671_10044923 3300025914 Bacteria 3266
248 Ga0207657_10111240 3300025919 Bacteria 2262
249 Ga0207694_10006679 3300025924 Bacteria 8765
250 Ga0207694_10276328 3300025924 Bacteria 1379
251 Ga0207644_10042891 3300025931 Bacteria 3208
252 Ga0207644_10113259 3300025931 Bacteria 2054
253 Ga0207706_10000147 3300025933 Bacteria 76792
254 Ga0207706_10003522 3300025933 Bacteria 14949
255 Ga0207704_10000076 3300025938 Bacteria 61793
256 Ga0207689_10020649 3300025942 Bacteria 5539
257 Ga0207689_10104496 3300025942 Bacteria 2327
258 Ga0207667_10000009 3300025949 Bacteria 603135
259 Ga0207667_10007095 3300025949 Bacteria 13527
260 Ga0207667_10007728 3300025949 Bacteria 12855
261 Ga0207667_10050942 3300025949 Bacteria 4367
262 Ga0207667_10075549 3300025949 Bacteria 3498
263 Ga0207651_10005400 3300025960 Bacteria 6554
264 Ga0207712_10024313 3300025961 Bacteria 4009
265 Ga0207712_10175519 3300025961 Bacteria 1679
266 Ga0207658_10111999 3300025986 Bacteria 2159
267 Ga0207658_10124730 3300025986 Bacteria 2059
268 Ga0207677_10010111 3300026023 Bacteria 5327
269 Ga0207703_10013669 3300026035 Bacteria 6326
270 Ga0207639_10003432 3300026041 Bacteria 10663
271 Ga0207702_10000300 3300026078 Bacteria 57198
272 Ga0207702_10087217 3300026078 Bacteria 2724
273 Ga0207641_10000158 3300026088 Bacteria 96378
274 Ga0207641_10007408 3300026088 Bacteria 9128
275 Ga0207648_10014282 3300026089 Bacteria 7340
276 Ga0207648_10133769 3300026089 Bacteria 2183
277 Ga0207648_10204810 3300026089 Bacteria 1751
278 Ga0207674_10039422 3300026116 Bacteria 4896
279 Ga0207674_10257904 3300026116 Unclassified 1690
280 Ga0207683_10187109 3300026121 Bacteria 1879
281 Ga0207698_10015501 3300026142 Bacteria 5105
282 Ga0207698_10017124 3300026142 Bacteria 4908
283 Ga0268266_10000089 3300028379 Bacteria 198566
284 Ga0268266_10000232 3300028379 Bacteria 95941
285 Ga0268266_10176864 3300028379 Bacteria 1941
286 Ga0268264_10001350 3300028381 Bacteria 23002
287 Ga0268264_10001875 3300028381 Bacteria 19096
288 Ga0268264_10002631 3300028381 Bacteria 15680
289 Ga0268264_10044611 3300028381 Bacteria 3678
290 Ga0268264_10059198 3300028381 Bacteria 3209
291 Ga0307517_10161873 3300028786 Bacteria 1499
292 Ga0307515_10000246 3300028794 Bacteria 134348
293 Ga0307515_10000707 3300028794 Bacteria 76907
294 Ga0307515_10000993 3300028794 Bacteria 64832
295 Ga0265338_10021839 3300028800 Bacteria 6652
296 Ga0265327_10000284 3300031251 Bacteria 100178
297 Ga0265327_10080737 3300031251 Unclassified 1607
298 Ga0307516_10000189 3300031730 Bacteria 79794
299 Ga0307407_10000017 3300031903 Bacteria 136012
300 Ga0307412_10000045 3300031911 Bacteria 165021
301 Ga0307412_10061831 3300031911 Bacteria 2519
302 Ga0307416_100000011 3300032002 Bacteria 300622
303 Ga0307414_10000533 3300032004 Bacteria 19793
304 Ga0307414_10018623 3300032004 Bacteria 4281
305 Ga0307414_10023338 3300032004 Bacteria 3922
306 Ga0307414_10187685 3300032004 Bacteria 1669
307 Ga0307507_10001380 3300033179 Bacteria 54486
308 Ga0307510_10001267 3300033180 Bacteria 27507
309 Ga0307510_10004144 3300033180 Bacteria 17022
310 Ga0395899_0000188 3300037312 Bacteria 90869
311 Ga0395899_0000888 3300037312 Bacteria 28385
312 Ga0395900_0000226 3300037418 Bacteria 88588
313 Ga0395905_0000068 3300037471 Bacteria 177163
314 Ga0395905_0261948 3300037471 Bacteria 1614
315 Ga0395901_0000136 3300038443 Bacteria 95382
316 Ga0436365_1732514 3300039437 Bacteria 16095
317 Ga0436361_0220461 3300039447 Bacteria 4788
318 Ga0466971_0041325 3300044719 Bacteria 2071
319 Ga0466957_0006005 3300044842 Bacteria 6849
320 Ga0466958_0165856 3300045836 Bacteria 1397
321 Ga0495651_0066188 3300046462 Bacteria 2759
322 Ga0495650_0000273 3300046471 Bacteria 98757
323 Ga0495585_0000132 3300046492 Bacteria 80905
324 Ga0495606_0000130 3300046507 Bacteria 127805
325 Ga0495606_0037906 3300046507 Bacteria 3268
326 Ga0495606_0104098 3300046507 Bacteria 1723
327 Ga0495610_0000151 3300046512 Bacteria 76854
328 Ga0495610_0002033 3300046512 Bacteria 17292
329 Ga0495616_0011882 3300046513 Bacteria 4963
330 Ga0495631_0040214 3300046518 Bacteria 2072
331 Ga0495644_0004180 3300046523 Bacteria 5678
332 Ga0495648_0018174 3300046524 Bacteria 4993
333 Ga0495648_0057090 3300046524 Bacteria 2344
334 Ga0495652_0064503 3300046529 Bacteria 3080
335 Ga0495609_0010661 3300046538 Bacteria 4399
336 Ga0495633_0000035 3300046558 Bacteria 185403
337 Ga0495668_0000032 3300046616 Bacteria 254951
338 Ga0495668_0000513 3300046616 Bacteria 48303
339 Ga0495625_0000036 3300046660 Bacteria 221680
340 Ga0495625_0000227 3300046660 Bacteria 88834
341 Ga0495625_0000358 3300046660 Bacteria 69690
342 Ga0495625_0047392 3300046660 Bacteria 3098
343 Ga0495661_0010531 3300046665 Bacteria 6306
344 Ga0495649_0000017 3300046694 Bacteria 221685
345 Ga0495660_0014818 3300046810 Bacteria 4508
346 Ga0495687_000001 3300047443 Bacteria 1215582
347 Ga0495687_002988 3300047443 Bacteria 12791
348 Ga0495687_004359 3300047443 Bacteria 9627
349 Ga0495677_0035251 3300047445 Bacteria 1826
350 Ga0495686_0000083 3300047472 Bacteria 198933
351 Ga0496122_0006506 3300048925 Bacteria 13380
352 Ga0496123_0012248 3300048926 Bacteria 7334
353 Ga0496125_0042544 3300048928 Bacteria 3867
354 Ga0495682_0041521 3300049460 Bacteria 1686
355 Ga0501034_0016036 3300049571 Bacteria 7689
356 nmdc:mga0k408_1683_c1 3300050493 Bacteria 11936
357 Ga0500644_0000528 3300053088 Bacteria 16038
358 Ga0500646_0017834 3300053090 Unclassified 1865
359 Ga0500583_0000197 3300053092 Bacteria 23017
360 Ga0500583_0056032 3300053092 Bacteria 1845
361 Ga0500651_0000646 3300053093 Bacteria 17380
362 Ga0500608_000502 3300053122 Bacteria 14608
363 Ga0500608_062231 3300053122 Bacteria 1782
364 Ga0500618_000004 3300053125 Bacteria 293180
365 Ga0500618_030954 3300053125 Bacteria 1256
366 Ga0500658_0015323 3300053134 Bacteria 2844
367 Ga0500604_0002992 3300053151 Bacteria 4544
368 Ga0500616_0005705 3300053153 Bacteria 8386
369 Ga0500616_0019958 3300053153 Bacteria 3770
370 2599477149 2599185184 Bacteria 6430550
371 2738755277 2738541283 Bacteria 7222293
372 2738764335 2738541284 Bacteria 5199923
373 2738855148 2738541302 Bacteria 5944758
374 2740031699 2739367866 Bacteria 4215900
375 2776613806 2775506987 Bacteria 5373360
376 2819547830 2818991437 Bacteria 5805520
377 2886630207 2886627955 Bacteria 7618130
378 2896090023 2896085136 Bacteria 6129793
379 2896110557 2896109856 Bacteria 7140722
380 2910249510 2910245624 Bacteria 6935613
381 2919442073 2919437846 Bacteria 6199444
382 2928079062 2928078545 Bacteria 6534839
383 2928148567 2928147474 Bacteria 6512076
384 2929239490 2929239360 Bacteria 7745570
385 2932085861 2932082852 Bacteria 6563563
386 2945999744 2945997725 Bacteria 6404843
387 Ga0495616_0002729
388 SwRhRL2b_contig_1109292
389 SwRhRL2b_contig_1157535
390 JGI24740J21852_10016913
391 JGI24739J22299_10003069
392 JGI24739J22299_10010232
393 JGI24737J22298_10000041
394 JGI24737J22298_10009062
395 JGI24735J21928_10000001
396 JGI25162J39368_1000121
397 JGI25162J39368_1002782
398 JGI25164J39214_1001349
399 JGI25406J46586_10015506
400 rootH1_10026547
401 rootH1_10046686
402 rootH2_10000343
403 rootH2_10080304
404 rootH2_10181492
405 rootH2_10312186
406 rootL2_10075502
407 rootL2_10094435
408 rootL2_10105471
409 rootL2_10146438
410 rootL2_10181125
411 rootL2_10281801
412 rootH1_10001370
413 rootH1_10073149
414 rootH1_10147516
415 rootH1_10168855
416 rootH1_10190916
417 rootH1_10244862
418 JGI25160J50197_1001244
419 JGI25160J50197_1001283
420 Ga0055535_1002870
421 Ga0055526_1007283
422 Ga0055536_1000009
423 Ga0055528_1000572
424 Ga0055530_10000789
425 Ga0055530_10000943
426 Ga0065165_1000017
427 Ga0065714_10002263
428 Ga0065714_10002864
429 Ga0065714_10064508
430 Ga0065714_10071301
431 Ga0065714_10075273
432 Ga0065714_10075458
433 Ga0065704_10000229
434 Ga0065712_10095194
435 Ga0070658_10000080
436 Ga0070676_10000140
437 Ga0068869_100055855
438 Ga0070666_10000042
439 Ga0068868_100019165
440 Ga0068868_100037836
441 Ga0068868_100171772
442 Ga0070660_100004493
443 Ga0070661_100011648
444 Ga0070669_100018855
445 Ga0070671_100021632
446 Ga0070671_100059329
447 Ga0070674_100105546
448 Ga0070673_100002084
449 Ga0070673_100285756
450 Ga0070659_100075178
451 Ga0070667_100119427
452 Ga0070667_100361212
453 Ga0070663_100016864
454 Ga0070678_100008809
455 Ga0070662_100000081
456 Ga0070681_10061275
457 Ga0070681_10294885
458 Ga0070685_10181663
459 Ga0070679_100007702
460 Ga0068853_100073679
461 Ga0068853_100142376
462 Ga0070665_100000001
463 Ga0070665_100000072
464 Ga0068855_100000090
465 Ga0068855_100006355
466 Ga0068855_100007153
467 Ga0068855_100013657
468 Ga0068855_100021064
469 Ga0068855_100076317
470 Ga0068855_100247135
471 Ga0068855_100281368
472 Ga0068857_100371564
473 Ga0068856_100000129
474 Ga0068856_100103344
475 Ga0068856_100405483
476 Ga0068852_100000281
477 Ga0068852_100027435
478 Ga0068859_100000130
479 Ga0068859_100010029
480 Ga0068864_100003460
481 Ga0068863_100008085
482 Ga0068863_100023991
483 Ga0068858_100003098
484 Ga0068860_100001453
485 Ga0068860_100002504
486 Ga0068860_100016152
487 Ga0068860_100042111
488 Ga0068860_100147165
489 Ga0081539_10000337
490 Ga0075366_10002447
491 Ga0097621_100000039
492 Ga0097621_100009477
493 Ga0097621_100191100
494 Ga0068871_100002549
495 Ga0097620_100000130
496 Ga0097620_100010029
497 Ga0105240_10000283
498 Ga0105240_10007948
499 Ga0105240_10008939
500 Ga0105240_10027114
501 Ga0105243_10042767
502 Ga0105241_10000514
503 Ga0105241_10001533
504 Ga0105241_10003973
505 Ga0105237_10000411
506 Ga0105237_10000963
507 Ga0105237_10001958
508 Ga0105237_10001962
509 Ga0105237_10009372
510 Ga0105237_10013274
511 Ga0105237_10023345
512 Ga0105237_10049826
513 Ga0105237_10060269
514 Ga0105237_10065168
515 Ga0105237_10133616
516 Ga0105238_10002377
517 Ga0105238_10133370
518 Ga0105238_10198637
519 Ga0105249_10004268
520 Ga0105249_10012134
521 Ga0105239_10000013
522 Ga0105239_10000106
523 Ga0105239_10000132
524 Ga0105239_10000528
525 Ga0105239_10001538
526 Ga0105239_10016107
527 Ga0105239_10039158
528 Ga0105239_10050174
529 Ga0105239_10108588
530 Ga0105239_10484124
531 Ga0105246_10021910
532 Ga0105246_10028879
533 Ga0157373_10000261
534 Ga0157373_10001202
535 Ga0157373_10025924
536 Ga0157373_10217506
537 Ga0157371_10000050
538 Ga0157371_10001830
539 Ga0157371_10001867
540 Ga0157371_10005170
541 Ga0157371_10023159
542 Ga0157371_10024168
543 Ga0157371_10060079
544 Ga0157371_10128389
545 Ga0157371_10137091
546 Ga0157370_10000285
547 Ga0157370_10005140
548 Ga0157370_10015299
549 Ga0157370_10054481
550 Ga0157370_10057751
551 Ga0157370_10161399
552 Ga0157370_10179892
553 Ga0157369_10001695
554 Ga0157369_10025169
555 Ga0157374_10000007
556 Ga0157374_10000135
557 Ga0157374_10003320
558 Ga0157374_10037679
559 Ga0157374_10096927
560 Ga0157374_10208456
561 Ga0157378_10026588
562 Ga0157378_10026647
563 Ga0157378_10035052
564 Ga0157378_10061117
565 Ga0163162_10000097
566 Ga0163162_10039181
567 Ga0163162_10041334
568 Ga0157372_10000011
569 Ga0157372_10001527
570 Ga0157372_10015408
571 Ga0157372_10030811
572 Ga0157372_10042097
573 Ga0157372_10106719
574 Ga0157372_10297920
575 Ga0157375_10084294
576 Ga0157375_10246899
577 Ga0182008_10000012
578 Ga0182008_10000078
579 Ga0182008_10026529
580 Ga0157377_10008154
581 Ga0157377_10022861
582 Ga0157379_10229498
583 Ga0157376_10000374
584 Ga0157376_10003324
585 Ga0182006_1000166
586 Ga0182006_1000297
587 Ga0182006_1003364
588 Ga0163161_10000215
589 Ga0163161_10000616
590 Ga0163161_10022563
591 Ga0163161_10022691
592 Ga0163161_10050594
593 Ga0213872_10023175
594 Ga0213876_10027715
595 Ga0207427_100125
596 Ga0209437_100008
597 Ga0209437_100017
598 Ga0209258_100029
599 Ga0209646_1002343
600 Ga0209646_1007623
601 Ga0209148_1000163
602 Ga0209233_1000024
603 Ga0209673_1000354
604 Ga0209676_1000001
605 Ga0209564_1003201
606 Ga0209564_1004937
607 Ga0209564_1017285
608 Ga0209758_1003655
609 Ga0209758_1008482
610 Ga0209050_1000018
611 Ga0209050_1000163
612 Ga0207426_1000093
613 Ga0207426_1002304
614 Ga0209257_1005362
615 Ga0207680_10000734
616 Ga0207647_10000058
617 Ga0207645_10001698
618 Ga0207645_10222204
619 Ga0207705_10000035
620 Ga0207654_10001696
621 Ga0207654_10036076
622 Ga0207654_10119225
623 Ga0207695_10000684
624 Ga0207695_10005568
625 Ga0207695_10028675
626 Ga0207695_10062715
627 Ga0207671_10001126
628 Ga0207671_10002903
629 Ga0207671_10003445
630 Ga0207671_10006546
631 Ga0207671_10014701
632 Ga0207671_10041991
633 Ga0207671_10044923
634 Ga0207657_10111240
635 Ga0207694_10006679
636 Ga0207694_10276328
637 Ga0207644_10042891
638 Ga0207644_10113259
639 Ga0207706_10000147
640 Ga0207706_10003522
641 Ga0207704_10000076
642 Ga0207689_10020649
643 Ga0207689_10104496
644 Ga0207667_10000009
645 Ga0207667_10007095
646 Ga0207667_10007728
647 Ga0207667_10050942
648 Ga0207667_10075549
649 Ga0207651_10005400
650 Ga0207712_10024313
651 Ga0207712_10175519
652 Ga0207658_10111999
653 Ga0207658_10124730
654 Ga0207677_10010111
655 Ga0207703_10013669
656 Ga0207639_10003432
657 Ga0207702_10000300
658 Ga0207702_10087217
659 Ga0207641_10000158
660 Ga0207641_10007408
661 Ga0207648_10014282
662 Ga0207648_10133769
663 Ga0207648_10204810
664 Ga0207674_10039422
665 Ga0207674_10257904
666 Ga0207683_10187109
667 Ga0207698_10015501
668 Ga0207698_10017124
669 Ga0268266_10000089
670 Ga0268266_10000232
671 Ga0268266_10176864
672 Ga0268264_10001350
673 Ga0268264_10001875
674 Ga0268264_10002631
675 Ga0268264_10044611
676 Ga0268264_10059198
677 Ga0307517_10161873
678 Ga0307515_10000246
679 Ga0307515_10000707
680 Ga0307515_10000993
681 Ga0265338_10021839
682 Ga0265327_10000284
683 Ga0265327_10080737
684 Ga0307516_10000189
685 Ga0307407_10000017
686 Ga0307412_10000045
687 Ga0307412_10061831
688 Ga0307416_100000011
689 Ga0307414_10000533
690 Ga0307414_10018623
691 Ga0307414_10023338
692 Ga0307414_10187685
693 Ga0307507_10001380
694 Ga0307510_10001267
695 Ga0307510_10004144
696 Ga0395899_0000188
697 Ga0395899_0000888
698 Ga0395900_0000226
699 Ga0395905_0000068
700 Ga0395905_0261948
701 Ga0395901_0000136
702 Ga0436365_1732514
703 Ga0436361_0220461
704 Ga0466971_0041325
705 Ga0466957_0006005
706 Ga0466958_0165856
707 Ga0495651_0066188
708 Ga0495650_0000273
709 Ga0495585_0000132
710 Ga0495606_0000130
711 Ga0495606_0037906
712 Ga0495606_0104098
713 Ga0495610_0000151
714 Ga0495610_0002033
715 Ga0495616_0011882
716 Ga0495631_0040214
717 Ga0495644_0004180
718 Ga0495648_0018174
719 Ga0495648_0057090
720 Ga0495652_0064503
721 Ga0495609_0010661
722 Ga0495633_0000035
723 Ga0495668_0000032
724 Ga0495668_0000513
725 Ga0495625_0000036
726 Ga0495625_0000227
727 Ga0495625_0000358
728 Ga0495625_0047392
729 Ga0495661_0010531
730 Ga0495649_0000017
731 Ga0495660_0014818
732 Ga0495687_000001
733 Ga0495687_002988
734 Ga0495687_004359
735 Ga0495677_0035251
736 Ga0495686_0000083
737 Ga0496122_0006506
738 Ga0496123_0012248
739 Ga0496125_0042544
740 Ga0495682_0041521
741 Ga0501034_0016036
742 nmdc:mga0k408_1683_c1
743 Ga0500644_0000528
744 Ga0500646_0017834
745 Ga0500583_0000197
746 Ga0500583_0056032
747 Ga0500651_0000646
748 Ga0500608_000502
749 Ga0500608_062231
750 Ga0500618_000004
751 Ga0500618_030954
752 Ga0500658_0015323
753 Ga0500604_0002992
754 Ga0500616_0005705
755 Ga0500616_0019958
756 2599477149
757 2738755277
758 2738764335
759 2738855148
760 2740031699
761 2776613806
762 2819547830
763 2886630207
764 2896090023
765 2896110557
766 2910249510
767 2919442073
768 2928079062
769 2928148567
770 2929239490
771 2932085861
772 2945999744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

293

405

0.94

PF12704

MacB_PCD

MacB-like periplasmic core domain

40

256

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.8412 229 345
3ftj-assembly1.cif.gz_A crystal structure of the periplasmic region of macb from actinobacillus actinomycetemcomitans 0.701 8 216
5f9q-assembly1.cif.gz_A crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria 0.6736 11 208
7bfe-assembly1.cif.gz_E circular permutant of ribosomal protein s6, p54-55 truncated, l21a mutant. 0.6679 172 208
5f9q-assembly1.cif.gz_A crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria 0.6641 11 208
ID Description Score Start End Superfamily
af_Q8I0V0_125_217_3.30.70.2380 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6509 174 208 3.30.70.2380
af_A0A1D8PEL1_240_382_3.30.70.890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.6503 174 208 3.30.70.890
af_P07277_235_392_3.30.70.890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.6359 174 208 3.30.70.890
af_Q09780_225_365_3.30.70.890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.6284 174 208 3.30.70.890
3bguB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6143 11 52 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A520CHM2-F1-model_v4 FtsX-like permease family protein 0.9151 7 348 GO:0005886
GO:0022857
AF-A0A520CHM2-F1-model_v4 FtsX-like permease family protein 0.9125 7 348 GO:0005886
GO:0022857
AF-A0A0D3LLY7-F1-model_v4 Antimicrobial peptide ABC transporter permease 0.8882 2 348 GO:0005886
GO:0022857
AF-A0A0D3LLY7-F1-model_v4 Antimicrobial peptide ABC transporter permease 0.8786 2 348 GO:0005886
GO:0022857
AF-A0A2V8ZIK4-F1-model_v4 MacB-like periplasmic core domain-containing protein 0.8605 4 202

Map