F430632
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 386 | 236 | 772 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0000011|Ga0496104_0000011_93695_94459 |
| Length | 254 |
| Sequence | VSRVTDATGNRLRRQSAVQASGRIDVTTLFISDLHLDESRPQIVELFDQFLRGQARDAVALYILGDLFESWIGDDDDSRLADTVASALHALNAHGVPVFFMHGNRDFLLGNAYAQRAGMTLLDDPQVIELDGERVLIMHGDTLCTDDVEYQKFRALVRDVRWQAQFLARPLVERRAFAAQARGESRKHTAAAKPEIMDVNPAAVVAAMQAHGVRRLIHGHTHRPATHRLGVDRQAAERIVLGDWYEQSSVLTWN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 11 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 42 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 118 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 123 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 125 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 127 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 129 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 133 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 134 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 135 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 136 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 150 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 151 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 155 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 156 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 157 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 158 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 159 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 160 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 161 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 162 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 168 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 169 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 170 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 171 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 172 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 173 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 174 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 175 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 176 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 177 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 178 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 179 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 180 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 181 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 182 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 183 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 184 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 185 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 186 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 187 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 188 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 189 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 190 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 191 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 192 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 193 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 194 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 195 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 196 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 197 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 198 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 199 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 200 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 201 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 202 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 203 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 204 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 205 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 206 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 207 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 208 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 209 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 210 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 211 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 212 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 213 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 214 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 215 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 216 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 217 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 218 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 219 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 220 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 221 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 222 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 223 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 224 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 225 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 226 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 227 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 228 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 229 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 230 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 231 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 232 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 233 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 234 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 235 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 236 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.09 |
| Metatranscriptomes | 0.78 |
| Isolates | 18.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.52 |
| Bulb | 0 |
| Endosphere | 5.18 |
| Nodule | 1.81 |
| Rhizoplane | 9.84 |
| Rhizosphere | 65.54 |
| Stem | 0.26 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 2 | SwRhRL2b_contig_3107099 | 2162886007 | Bacteria | 2011 |
| 3 | JGI25163J39215_1000108 | 3300002771 | Bacteria | 34764 |
| 4 | JGI25164J39214_1000014 | 3300002772 | Bacteria | 219691 |
| 5 | Ga0055538_1000005 | 3300003751 | Bacteria | 575218 |
| 6 | Ga0055539_1000007 | 3300003752 | Bacteria | 575218 |
| 7 | Ga0055533_1000009 | 3300003756 | Bacteria | 575218 |
| 8 | Ga0055525_1000010 | 3300003759 | Bacteria | 575218 |
| 9 | Ga0055541_1000005 | 3300003841 | Bacteria | 575218 |
| 10 | Ga0058692_1000146 | 3300003856 | Bacteria | 44864 |
| 11 | Ga0058692_1002924 | 3300003856 | Bacteria | 5510 |
| 12 | Ga0058692_1012961 | 3300003856 | Bacteria | 1956 |
| 13 | Ga0065703_1019913 | 3300005272 | Bacteria | 2274 |
| 14 | Ga0065704_10104445 | 3300005289 | Bacteria | 2130 |
| 15 | Ga0070676_10062101 | 3300005328 | Bacteria | 2222 |
| 16 | Ga0070670_100011664 | 3300005331 | Bacteria | 7516 |
| 17 | Ga0070666_10000444 | 3300005335 | Bacteria | 25283 |
| 18 | Ga0070666_10011865 | 3300005335 | Bacteria | 5479 |
| 19 | Ga0070666_10039626 | 3300005335 | Bacteria | 3141 |
| 20 | Ga0070661_100010710 | 3300005344 | Bacteria | 6380 |
| 21 | Ga0070667_100008634 | 3300005367 | Bacteria | 8445 |
| 22 | Ga0070711_100075484 | 3300005439 | Bacteria | 2387 |
| 23 | Ga0070663_100034137 | 3300005455 | Bacteria | 3521 |
| 24 | Ga0070663_100216176 | 3300005455 | Bacteria | 1503 |
| 25 | Ga0070662_100005063 | 3300005457 | Bacteria | 8388 |
| 26 | Ga0070681_10057937 | 3300005458 | Bacteria | 3854 |
| 27 | Ga0068853_100008444 | 3300005539 | Bacteria | 8277 |
| 28 | Ga0068853_100105449 | 3300005539 | Bacteria | 2497 |
| 29 | Ga0068853_100242492 | 3300005539 | Bacteria | 1652 |
| 30 | Ga0070696_100001818 | 3300005546 | Bacteria | 14014 |
| 31 | Ga0070696_100079642 | 3300005546 | Bacteria | 2318 |
| 32 | Ga0070665_100000807 | 3300005548 | Bacteria | 40948 |
| 33 | Ga0070665_100204956 | 3300005548 | Bacteria | 1973 |
| 34 | Ga0068855_100139780 | 3300005563 | Bacteria | 2762 |
| 35 | Ga0068855_100193738 | 3300005563 | Bacteria | 2291 |
| 36 | Ga0070664_100090511 | 3300005564 | Bacteria | 2648 |
| 37 | Ga0068857_100143140 | 3300005577 | Bacteria | 2162 |
| 38 | Ga0068856_100021372 | 3300005614 | Bacteria | 6291 |
| 39 | Ga0068856_100059372 | 3300005614 | Bacteria | 3778 |
| 40 | Ga0068852_100021115 | 3300005616 | Bacteria | 5190 |
| 41 | Ga0068852_100290504 | 3300005616 | Bacteria | 1579 |
| 42 | Ga0068859_100678900 | 3300005617 | Bacteria | 1121 |
| 43 | Ga0068851_10000362 | 3300005834 | Bacteria | 20468 |
| 44 | Ga0068851_10053980 | 3300005834 | Bacteria | 2046 |
| 45 | Ga0068863_100102515 | 3300005841 | Bacteria | 2721 |
| 46 | Ga0068858_100001486 | 3300005842 | Bacteria | 24143 |
| 47 | Ga0068858_100097992 | 3300005842 | Bacteria | 2733 |
| 48 | Ga0068860_100044570 | 3300005843 | Bacteria | 4228 |
| 49 | Ga0075364_10095979 | 3300006051 | Bacteria | 1971 |
| 50 | Ga0097621_100007117 | 3300006237 | Bacteria | 7975 |
| 51 | Ga0068871_100012012 | 3300006358 | Bacteria | 6372 |
| 52 | Ga0068865_100003233 | 3300006881 | Bacteria | 9761 |
| 53 | Ga0068865_100064714 | 3300006881 | Bacteria | 2574 |
| 54 | Ga0097620_100678787 | 3300006931 | Bacteria | 1121 |
| 55 | Ga0079104_1000511 | 3300006946 | Bacteria | 41655 |
| 56 | Ga0079104_1001983 | 3300006946 | Bacteria | 12008 |
| 57 | Ga0079104_1002803 | 3300006946 | Bacteria | 8777 |
| 58 | Ga0099795_10000820 | 3300007788 | Bacteria | 6147 |
| 59 | Ga0105251_10000228 | 3300009011 | Bacteria | 56620 |
| 60 | Ga0105251_10001338 | 3300009011 | Bacteria | 21285 |
| 61 | Ga0105251_10002657 | 3300009011 | Bacteria | 13778 |
| 62 | Ga0105251_10015108 | 3300009011 | Bacteria | 4232 |
| 63 | Ga0105251_10039376 | 3300009011 | Bacteria | 2310 |
| 64 | Ga0105244_10000024 | 3300009036 | Bacteria | 218628 |
| 65 | Ga0105244_10000048 | 3300009036 | Bacteria | 141340 |
| 66 | Ga0105244_10001565 | 3300009036 | Bacteria | 18167 |
| 67 | Ga0105244_10012857 | 3300009036 | Bacteria | 4929 |
| 68 | Ga0105244_10016607 | 3300009036 | Bacteria | 4188 |
| 69 | Ga0105244_10036669 | 3300009036 | Bacteria | 2567 |
| 70 | Ga0105244_10123298 | 3300009036 | Bacteria | 1254 |
| 71 | Ga0105244_10138995 | 3300009036 | Bacteria | 1169 |
| 72 | Ga0105250_10000003 | 3300009092 | Bacteria | 547770 |
| 73 | Ga0105250_10000025 | 3300009092 | Bacteria | 215424 |
| 74 | Ga0105250_10000044 | 3300009092 | Bacteria | 128269 |
| 75 | Ga0105250_10002491 | 3300009092 | Bacteria | 9233 |
| 76 | Ga0105250_10016241 | 3300009092 | Bacteria | 3037 |
| 77 | Ga0105250_10123441 | 3300009092 | Bacteria | 1066 |
| 78 | Ga0105240_10000617 | 3300009093 | Bacteria | 65935 |
| 79 | Ga0105240_10058039 | 3300009093 | Bacteria | 4832 |
| 80 | Ga0105240_10122593 | 3300009093 | Bacteria | 3128 |
| 81 | Ga0105240_10238478 | 3300009093 | Bacteria | 2110 |
| 82 | Ga0105245_10193266 | 3300009098 | Bacteria | 1951 |
| 83 | Ga0105247_10000018 | 3300009101 | Bacteria | 259335 |
| 84 | Ga0105243_10173599 | 3300009148 | Bacteria | 1869 |
| 85 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 86 | Ga0105241_10030972 | 3300009174 | Bacteria | 4001 |
| 87 | Ga0105241_10556734 | 3300009174 | Bacteria | 1030 |
| 88 | Ga0105242_10001890 | 3300009176 | Bacteria | 16469 |
| 89 | Ga0105242_10199138 | 3300009176 | Bacteria | 1778 |
| 90 | Ga0105248_10197838 | 3300009177 | Bacteria | 2265 |
| 91 | Ga0105238_10009940 | 3300009551 | Bacteria | 9540 |
| 92 | Ga0105249_10004564 | 3300009553 | Bacteria | 11967 |
| 93 | Ga0099796_10006282 | 3300010159 | Bacteria | 3030 |
| 94 | Ga0105239_10062343 | 3300010375 | Bacteria | 4092 |
| 95 | Ga0105239_10492348 | 3300010375 | Bacteria | 1393 |
| 96 | Ga0105246_10021080 | 3300011119 | Bacteria | 4188 |
| 97 | Ga0105246_10385671 | 3300011119 | Bacteria | 1159 |
| 98 | Ga0157373_10000104 | 3300013100 | Bacteria | 66432 |
| 99 | Ga0157373_10010360 | 3300013100 | Bacteria | 6862 |
| 100 | Ga0157371_10000007 | 3300013102 | Bacteria | 401847 |
| 101 | Ga0157371_10057469 | 3300013102 | Bacteria | 2759 |
| 102 | Ga0157371_10079762 | 3300013102 | Bacteria | 2318 |
| 103 | Ga0157371_10138553 | 3300013102 | Bacteria | 1733 |
| 104 | Ga0157370_10001101 | 3300013104 | Bacteria | 33897 |
| 105 | Ga0157370_10128434 | 3300013104 | Bacteria | 2365 |
| 106 | Ga0157369_10000983 | 3300013105 | Bacteria | 36119 |
| 107 | Ga0157369_10001364 | 3300013105 | Bacteria | 30124 |
| 108 | Ga0157369_10017667 | 3300013105 | Bacteria | 8014 |
| 109 | Ga0157369_10522464 | 3300013105 | Bacteria | 1228 |
| 110 | Ga0157374_10302135 | 3300013296 | Bacteria | 1583 |
| 111 | Ga0157378_10000130 | 3300013297 | Bacteria | 72949 |
| 112 | Ga0157378_10365381 | 3300013297 | Bacteria | 1413 |
| 113 | Ga0163162_10121342 | 3300013306 | Bacteria | 2718 |
| 114 | Ga0163162_10339848 | 3300013306 | Bacteria | 1634 |
| 115 | Ga0157372_10022705 | 3300013307 | Bacteria | 6791 |
| 116 | Ga0157372_10191088 | 3300013307 | Bacteria | 2372 |
| 117 | Ga0157372_10313059 | 3300013307 | Bacteria | 1827 |
| 118 | Ga0157372_10390167 | 3300013307 | Bacteria | 1622 |
| 119 | Ga0157372_10536039 | 3300013307 | Bacteria | 1364 |
| 120 | Ga0157375_10000256 | 3300013308 | Bacteria | 48304 |
| 121 | Ga0182008_10003644 | 3300014497 | Bacteria | 9190 |
| 122 | Ga0157376_10056003 | 3300014969 | Bacteria | 3292 |
| 123 | Ga0163161_10000004 | 3300017792 | Bacteria | 333149 |
| 124 | Ga0213876_10000176 | 3300021384 | Bacteria | 66221 |
| 125 | Ga0209760_100057 | 3300025207 | Bacteria | 99434 |
| 126 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 127 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 128 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 129 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 130 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 131 | Ga0209437_100007 | 3300025233 | Bacteria | 938377 |
| 132 | Ga0207425_1013847 | 3300025245 | Bacteria | 1849 |
| 133 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 134 | Ga0209129_1000015 | 3300025258 | Bacteria | 487967 |
| 135 | Ga0209233_1003856 | 3300025261 | Bacteria | 5219 |
| 136 | Ga0207656_10002243 | 3300025321 | Bacteria | 6476 |
| 137 | Ga0207656_10189332 | 3300025321 | Bacteria | 990 |
| 138 | Ga0207696_1000003 | 3300025711 | Bacteria | 860639 |
| 139 | Ga0207696_1000004 | 3300025711 | Bacteria | 671626 |
| 140 | Ga0207696_1000007 | 3300025711 | Bacteria | 578417 |
| 141 | Ga0207696_1000033 | 3300025711 | Bacteria | 360689 |
| 142 | Ga0207696_1000192 | 3300025711 | Bacteria | 94285 |
| 143 | Ga0207696_1000408 | 3300025711 | Bacteria | 40084 |
| 144 | Ga0207655_1000011 | 3300025728 | Bacteria | 643321 |
| 145 | Ga0207655_1000023 | 3300025728 | Bacteria | 467070 |
| 146 | Ga0207655_1000029 | 3300025728 | Bacteria | 432187 |
| 147 | Ga0207655_1000042 | 3300025728 | Bacteria | 333039 |
| 148 | Ga0207655_1000206 | 3300025728 | Bacteria | 102975 |
| 149 | Ga0207655_1000621 | 3300025728 | Bacteria | 42638 |
| 150 | Ga0207655_1038164 | 3300025728 | Bacteria | 2104 |
| 151 | Ga0207713_1000021 | 3300025735 | Bacteria | 353108 |
| 152 | Ga0207713_1000101 | 3300025735 | Bacteria | 140693 |
| 153 | Ga0207713_1000133 | 3300025735 | Bacteria | 112797 |
| 154 | Ga0207713_1001385 | 3300025735 | Bacteria | 19655 |
| 155 | Ga0207713_1077377 | 3300025735 | Bacteria | 1208 |
| 156 | Ga0207710_10000016 | 3300025900 | Bacteria | 388568 |
| 157 | Ga0207680_10000258 | 3300025903 | Bacteria | 25434 |
| 158 | Ga0207647_10000023 | 3300025904 | Bacteria | 115648 |
| 159 | Ga0207647_10176261 | 3300025904 | Bacteria | 1244 |
| 160 | Ga0207645_10077414 | 3300025907 | Bacteria | 2131 |
| 161 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 162 | Ga0207654_10026699 | 3300025911 | Bacteria | 3130 |
| 163 | Ga0207695_10000032 | 3300025913 | Bacteria | 521283 |
| 164 | Ga0207695_10023289 | 3300025913 | Bacteria | 7003 |
| 165 | Ga0207695_10066931 | 3300025913 | Bacteria | 3687 |
| 166 | Ga0207695_10105112 | 3300025913 | Bacteria | 2811 |
| 167 | Ga0207695_10180631 | 3300025913 | Bacteria | 2031 |
| 168 | Ga0207671_10102696 | 3300025914 | Bacteria | 2167 |
| 169 | Ga0207663_10169448 | 3300025916 | Bacteria | 1550 |
| 170 | Ga0207657_10020912 | 3300025919 | Bacteria | 6175 |
| 171 | Ga0207649_10073183 | 3300025920 | Bacteria | 2194 |
| 172 | Ga0207649_10100628 | 3300025920 | Bacteria | 1912 |
| 173 | Ga0207694_10003116 | 3300025924 | Bacteria | 13255 |
| 174 | Ga0207694_10004607 | 3300025924 | Bacteria | 10733 |
| 175 | Ga0207650_10005523 | 3300025925 | Bacteria | 8625 |
| 176 | Ga0207687_10268082 | 3300025927 | Bacteria | 1364 |
| 177 | Ga0207644_10270370 | 3300025931 | Bacteria | 1362 |
| 178 | Ga0207706_10017276 | 3300025933 | Bacteria | 6501 |
| 179 | Ga0207686_10006050 | 3300025934 | Bacteria | 6497 |
| 180 | Ga0207704_10010462 | 3300025938 | Bacteria | 4528 |
| 181 | Ga0207704_10045575 | 3300025938 | Bacteria | 2606 |
| 182 | Ga0207665_10086173 | 3300025939 | Bacteria | 2169 |
| 183 | Ga0207679_10559525 | 3300025945 | Bacteria | 1027 |
| 184 | Ga0207667_10042295 | 3300025949 | Bacteria | 4844 |
| 185 | Ga0207667_10081340 | 3300025949 | Bacteria | 3355 |
| 186 | Ga0207667_10172066 | 3300025949 | Bacteria | 2226 |
| 187 | Ga0207712_10000497 | 3300025961 | Bacteria | 32461 |
| 188 | Ga0207640_10167585 | 3300025981 | Bacteria | 1633 |
| 189 | Ga0207658_10051139 | 3300025986 | Bacteria | 3044 |
| 190 | Ga0207658_10518641 | 3300025986 | Bacteria | 1063 |
| 191 | Ga0207677_10207185 | 3300026023 | Bacteria | 1563 |
| 192 | Ga0207703_10002654 | 3300026035 | Bacteria | 15384 |
| 193 | Ga0207639_10000190 | 3300026041 | Bacteria | 47698 |
| 194 | Ga0207639_10001379 | 3300026041 | Bacteria | 16398 |
| 195 | Ga0207639_10022886 | 3300026041 | Bacteria | 4507 |
| 196 | Ga0207639_10231734 | 3300026041 | Bacteria | 1601 |
| 197 | Ga0207678_10006419 | 3300026067 | Bacteria | 10433 |
| 198 | Ga0207678_10118885 | 3300026067 | Bacteria | 2255 |
| 199 | Ga0207702_10032081 | 3300026078 | Bacteria | 4382 |
| 200 | Ga0207702_10872316 | 3300026078 | Bacteria | 891 |
| 201 | Ga0207641_10136637 | 3300026088 | Bacteria | 2207 |
| 202 | Ga0207641_10248471 | 3300026088 | Bacteria | 1660 |
| 203 | Ga0207674_10004880 | 3300026116 | Bacteria | 16054 |
| 204 | Ga0207674_10205749 | 3300026116 | Bacteria | 1917 |
| 205 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 206 | Ga0209281_1000041 | 3300027111 | Bacteria | 347825 |
| 207 | Ga0209281_1017976 | 3300027111 | Bacteria | 1423 |
| 208 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 209 | Ga0209371_1000026 | 3300027312 | Bacteria | 449205 |
| 210 | Ga0209371_1000146 | 3300027312 | Bacteria | 115378 |
| 211 | Ga0209371_1002140 | 3300027312 | Bacteria | 11629 |
| 212 | Ga0209371_1002953 | 3300027312 | Bacteria | 8854 |
| 213 | Ga0209371_1034672 | 3300027312 | Bacteria | 1068 |
| 214 | Ga0209371_1042454 | 3300027312 | Bacteria | 915 |
| 215 | Ga0265354_1005775 | 3300028016 | Bacteria | 1245 |
| 216 | Ga0265357_1001801 | 3300028023 | Bacteria | 1646 |
| 217 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 218 | Ga0268265_10068938 | 3300028380 | Bacteria | 2745 |
| 219 | Ga0268264_10133276 | 3300028381 | Bacteria | 2206 |
| 220 | Ga0268256_1000003 | 3300030500 | Bacteria | 1289401 |
| 221 | Ga0268256_1000117 | 3300030500 | Bacteria | 115176 |
| 222 | Ga0268256_1002655 | 3300030500 | Bacteria | 8854 |
| 223 | Ga0268256_1003828 | 3300030500 | Bacteria | 6564 |
| 224 | Ga0268256_1032960 | 3300030500 | Bacteria | 1228 |
| 225 | Ga0268256_1039360 | 3300030500 | Bacteria | 1068 |
| 226 | Ga0268256_1050254 | 3300030500 | Bacteria | 882 |
| 227 | Ga0268256_1050262 | 3300030500 | Bacteria | 882 |
| 228 | Ga0265770_1002128 | 3300030878 | Bacteria | 2693 |
| 229 | Ga0307516_10004733 | 3300031730 | Bacteria | 16636 |
| 230 | Ga0316593_10011987 | 3300032168 | Bacteria | 2535 |
| 231 | Ga0316593_10069876 | 3300032168 | Bacteria | 1213 |
| 232 | Ga0307510_10132958 | 3300033180 | Bacteria | 2154 |
| 233 | Ga0373923_0254673 | 3300035111 | Unclassified | 822 |
| 234 | Ga0373954_0223807 | 3300035118 | Unclassified | 926 |
| 235 | Ga0373955_0096948 | 3300035172 | Bacteria | 1688 |
| 236 | Ga0316584_0040558 | 3300036712 | Bacteria | 3469 |
| 237 | Ga0436365_0571044 | 3300039437 | Bacteria | 107748 |
| 238 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 239 | Ga0439447_005018 | 3300041407 | Bacteria | 4459 |
| 240 | Ga0439432_000740 | 3300042006 | Bacteria | 12232 |
| 241 | Ga0439432_002843 | 3300042006 | Bacteria | 6453 |
| 242 | Ga0439432_009589 | 3300042006 | Bacteria | 3374 |
| 243 | Ga0439452_000027 | 3300042010 | Bacteria | 206086 |
| 244 | Ga0439452_000033 | 3300042010 | Bacteria | 178345 |
| 245 | Ga0495617_006839 | 3300046452 | Bacteria | 3983 |
| 246 | Ga0495627_000145 | 3300046453 | Bacteria | 84853 |
| 247 | Ga0495627_088308 | 3300046453 | Bacteria | 893 |
| 248 | Ga0495591_000301 | 3300046458 | Bacteria | 45136 |
| 249 | Ga0495650_0000016 | 3300046471 | Bacteria | 554693 |
| 250 | Ga0495650_0110494 | 3300046471 | Bacteria | 1021 |
| 251 | Ga0495639_0229785 | 3300046475 | Unclassified | 914 |
| 252 | Ga0495632_0076836 | 3300046519 | Bacteria | 1597 |
| 253 | Ga0495652_0483550 | 3300046529 | Bacteria | 861 |
| 254 | Ga0495654_0002277 | 3300046530 | Bacteria | 12421 |
| 255 | Ga0495658_0190759 | 3300046683 | Bacteria | 1274 |
| 256 | Ga0495589_0000006 | 3300046794 | Bacteria | 303635 |
| 257 | Ga0495660_0000007 | 3300046810 | Bacteria | 485295 |
| 258 | Ga0495681_0007032 | 3300047470 | Bacteria | 7269 |
| 259 | Ga0496101_0000029 | 3300048904 | Bacteria | 198515 |
| 260 | Ga0496103_0058891 | 3300048906 | Bacteria | 2386 |
| 261 | Ga0496104_0008700 | 3300048907 | Bacteria | 9027 |
| 262 | Ga0496104_0030321 | 3300048907 | Bacteria | 5025 |
| 263 | Ga0496105_0000014 | 3300048908 | Bacteria | 220911 |
| 264 | Ga0496107_0362549 | 3300048910 | Bacteria | 1078 |
| 265 | Ga0496114_0040199 | 3300048917 | Bacteria | 3870 |
| 266 | Ga0496115_0005522 | 3300048918 | Bacteria | 9203 |
| 267 | Ga0496116_0000031 | 3300048919 | Bacteria | 420043 |
| 268 | Ga0496116_0000054 | 3300048919 | Bacteria | 289010 |
| 269 | Ga0496116_0000505 | 3300048919 | Bacteria | 53281 |
| 270 | Ga0496116_0009874 | 3300048919 | Bacteria | 8076 |
| 271 | Ga0496116_0033288 | 3300048919 | Bacteria | 3659 |
| 272 | Ga0496116_0111366 | 3300048919 | Bacteria | 1608 |
| 273 | Ga0496117_0003341 | 3300048920 | Bacteria | 18739 |
| 274 | Ga0496117_0012152 | 3300048920 | Bacteria | 7626 |
| 275 | Ga0496117_0052951 | 3300048920 | Bacteria | 2855 |
| 276 | Ga0496118_0001321 | 3300048921 | Bacteria | 37625 |
| 277 | Ga0496118_0042574 | 3300048921 | Bacteria | 3581 |
| 278 | Ga0496118_0055891 | 3300048921 | Bacteria | 2972 |
| 279 | Ga0496118_0150213 | 3300048921 | Bacteria | 1459 |
| 280 | Ga0496118_0151389 | 3300048921 | Bacteria | 1451 |
| 281 | Ga0496119_0000045 | 3300048922 | Bacteria | 191361 |
| 282 | Ga0496119_0014780 | 3300048922 | Bacteria | 6076 |
| 283 | Ga0496119_0018488 | 3300048922 | Bacteria | 5183 |
| 284 | Ga0496119_0061553 | 3300048922 | Bacteria | 2240 |
| 285 | Ga0496119_0075399 | 3300048922 | Bacteria | 1960 |
| 286 | Ga0496119_0092125 | 3300048922 | Bacteria | 1720 |
| 287 | Ga0496120_0000374 | 3300048923 | Bacteria | 72781 |
| 288 | Ga0496120_0000429 | 3300048923 | Bacteria | 66724 |
| 289 | Ga0496120_0000760 | 3300048923 | Bacteria | 46714 |
| 290 | Ga0496120_0002810 | 3300048923 | Bacteria | 16823 |
| 291 | Ga0496120_0007944 | 3300048923 | Bacteria | 7809 |
| 292 | Ga0496120_0016246 | 3300048923 | Bacteria | 4870 |
| 293 | Ga0496122_0000013 | 3300048925 | Bacteria | 501039 |
| 294 | Ga0496122_0018334 | 3300048925 | Bacteria | 6476 |
| 295 | Ga0496122_0024887 | 3300048925 | Bacteria | 5224 |
| 296 | Ga0496122_0058305 | 3300048925 | Bacteria | 2859 |
| 297 | Ga0496122_0186807 | 3300048925 | Bacteria | 1228 |
| 298 | Ga0496123_0000010 | 3300048926 | Bacteria | 501039 |
| 299 | Ga0496123_0000152 | 3300048926 | Bacteria | 140376 |
| 300 | Ga0496123_0003920 | 3300048926 | Bacteria | 16160 |
| 301 | Ga0496123_0037777 | 3300048926 | Bacteria | 3404 |
| 302 | Ga0496124_0000010 | 3300048927 | Bacteria | 595157 |
| 303 | Ga0496124_0000039 | 3300048927 | Bacteria | 307831 |
| 304 | Ga0496124_0000322 | 3300048927 | Bacteria | 88424 |
| 305 | Ga0496124_0001225 | 3300048927 | Bacteria | 39571 |
| 306 | Ga0496124_0002999 | 3300048927 | Bacteria | 21117 |
| 307 | Ga0496124_0145379 | 3300048927 | Bacteria | 1866 |
| 308 | Ga0496124_0372201 | 3300048927 | Bacteria | 1002 |
| 309 | Ga0496125_0000016 | 3300048928 | Bacteria | 512512 |
| 310 | Ga0496125_0000019 | 3300048928 | Bacteria | 474989 |
| 311 | Ga0496125_0019973 | 3300048928 | Bacteria | 6299 |
| 312 | Ga0496126_0000252 | 3300048929 | Bacteria | 115370 |
| 313 | Ga0496126_0035008 | 3300048929 | Bacteria | 4709 |
| 314 | Ga0501033_0323626 | 3300049570 | Unclassified | 1083 |
| 315 | Ga0501034_0704017 | 3300049571 | Unclassified | 908 |
| 316 | Ga0501035_0202567 | 3300049822 | Unclassified | 1701 |
| 317 | 2506577139 | 2506520007 | Bacteria | 5442880 |
| 318 | 2506582277 | 2506520008 | Bacteria | 5443009 |
| 319 | 2508851106 | 2508501071 | Bacteria | 5454741 |
| 320 | 2547694274 | 2547132181 | Bacteria | 4945084 |
| 321 | 2562466346 | 2561511199 | Bacteria | 5155034 |
| 322 | 2585826794 | 2585427591 | Bacteria | 5482980 |
| 323 | 2585831280 | 2585427592 | Bacteria | 5370892 |
| 324 | 2599411937 | 2599185169 | Bacteria | 5441380 |
| 325 | 2601525115 | 2600255254 | Bacteria | 5281859 |
| 326 | 2601530302 | 2600255255 | Bacteria | 5282785 |
| 327 | 2601617094 | 2600255280 | Bacteria | 5292309 |
| 328 | 2601621559 | 2600255281 | Bacteria | 5288753 |
| 329 | 2601650717 | 2600255288 | Bacteria | 5282738 |
| 330 | 2601654883 | 2600255289 | Bacteria | 5281907 |
| 331 | 2601660450 | 2600255290 | Bacteria | 5282218 |
| 332 | 2601708298 | 2600255300 | Bacteria | 5287774 |
| 333 | 2601713391 | 2600255301 | Bacteria | 5280532 |
| 334 | 2601718442 | 2600255302 | Bacteria | 5288235 |
| 335 | 2601728325 | 2600255304 | Bacteria | 5283973 |
| 336 | 2601733390 | 2600255305 | Bacteria | 5282329 |
| 337 | 2601738309 | 2600255306 | Bacteria | 5281613 |
| 338 | 2601742433 | 2600255307 | Bacteria | 5439064 |
| 339 | 2601753647 | 2600255309 | Bacteria | 5431045 |
| 340 | 2602019966 | 2600255392 | Bacteria | 5437392 |
| 341 | 2603700116 | 2602042066 | Bacteria | 4423871 |
| 342 | 2603840501 | 2602042103 | Bacteria | 5284714 |
| 343 | 2603845836 | 2602042104 | Bacteria | 5281639 |
| 344 | 2603850909 | 2602042105 | Bacteria | 5282303 |
| 345 | 2603855718 | 2602042106 | Bacteria | 5282744 |
| 346 | 2603873300 | 2602042110 | Bacteria | 5283285 |
| 347 | 2606050738 | 2603880178 | Bacteria | 5283018 |
| 348 | 2606148422 | 2603880202 | Bacteria | 5284684 |
| 349 | 2606178369 | 2603880211 | Bacteria | 5284226 |
| 350 | 2609914331 | 2609459761 | Bacteria | 5513740 |
| 351 | 2637226683 | 2636415599 | Bacteria | 5718434 |
| 352 | 2656275881 | 2654587920 | Bacteria | 5475511 |
| 353 | 2671108373 | 2667528173 | Bacteria | 5375747 |
| 354 | 2676407164 | 2675903046 | Bacteria | 5451247 |
| 355 | 2689443539 | 2687453601 | Bacteria | 5546041 |
| 356 | 2712470569 | 2711768156 | Bacteria | 4471618 |
| 357 | 2772437679 | 2772190666 | Bacteria | 5117644 |
| 358 | 2792312137 | 2791355010 | Bacteria | 4864581 |
| 359 | 2807177255 | 2806310673 | Bacteria | 4801221 |
| 360 | 2844426509 | 2844425489 | Bacteria | 4854065 |
| 361 | 2846543166 | 2846540461 | Bacteria | 5471451 |
| 362 | 2852103578 | 2852103415 | Bacteria | 5193810 |
| 363 | 2869552958 | 2869551831 | Bacteria | 5474685 |
| 364 | 2888367669 | 2888366609 | Bacteria | 5155009 |
| 365 | 2888374630 | 2888373701 | Bacteria | 5098052 |
| 366 | 2904474955 | 2904474040 | Bacteria | 5504324 |
| 367 | 2904505604 | 2904504865 | Bacteria | 5152820 |
| 368 | 2904514949 | 2904513164 | Bacteria | 5476410 |
| 369 | 2908671201 | 2908669403 | Bacteria | 5740494 |
| 370 | 2919151301 | 2919150387 | Bacteria | 5500879 |
| 371 | 2927146175 | 2927143783 | Bacteria | 5504251 |
| 372 | 2932407308 | 2932406140 | Bacteria | 5134491 |
| 373 | 2935629357 | 2935625433 | Bacteria | 5042964 |
| 374 | 2937969459 | 2937967321 | Bacteria | 5094075 |
| 375 | 2939574833 | 2939573065 | Bacteria | 4926053 |
| 376 | 2939579218 | 2939577877 | Bacteria | 5132791 |
| 377 | 2945879270 | 2945874760 | Bacteria | 5527237 |
| 378 | 2969083666 | 2969079654 | Bacteria | 5439582 |
| 379 | 2974437431 | 2974435778 | Bacteria | 4876478 |
| 380 | 2984560767 | 2984559226 | Bacteria | 5683096 |
| 381 | 2984598843 | 2984595703 | Bacteria | 5682994 |
| 382 | 3000380101 | 3000376612 | Bacteria | 4705565 |
| 383 | 640936684 | 640753048 | Bacteria | 5495657 |
| 384 | 8004594381 | 8004592986 | Bacteria | 5122074 |
| 385 | 8015398967 | 8015394850 | Bacteria | 5064660 |
| 386 | 8016736850 | 8016733728 | Bacteria | 5274317 |
| 387 | Ga0496104_0000011 | |||
| 388 | SwRhRL2b_contig_3107099 | |||
| 389 | JGI25163J39215_1000108 | |||
| 390 | JGI25164J39214_1000014 | |||
| 391 | Ga0055538_1000005 | |||
| 392 | Ga0055539_1000007 | |||
| 393 | Ga0055533_1000009 | |||
| 394 | Ga0055525_1000010 | |||
| 395 | Ga0055541_1000005 | |||
| 396 | Ga0058692_1000146 | |||
| 397 | Ga0058692_1002924 | |||
| 398 | Ga0058692_1012961 | |||
| 399 | Ga0065703_1019913 | |||
| 400 | Ga0065704_10104445 | |||
| 401 | Ga0070676_10062101 | |||
| 402 | Ga0070670_100011664 | |||
| 403 | Ga0070666_10000444 | |||
| 404 | Ga0070666_10011865 | |||
| 405 | Ga0070666_10039626 | |||
| 406 | Ga0070661_100010710 | |||
| 407 | Ga0070667_100008634 | |||
| 408 | Ga0070711_100075484 | |||
| 409 | Ga0070663_100034137 | |||
| 410 | Ga0070663_100216176 | |||
| 411 | Ga0070662_100005063 | |||
| 412 | Ga0070681_10057937 | |||
| 413 | Ga0068853_100008444 | |||
| 414 | Ga0068853_100105449 | |||
| 415 | Ga0068853_100242492 | |||
| 416 | Ga0070696_100001818 | |||
| 417 | Ga0070696_100079642 | |||
| 418 | Ga0070665_100000807 | |||
| 419 | Ga0070665_100204956 | |||
| 420 | Ga0068855_100139780 | |||
| 421 | Ga0068855_100193738 | |||
| 422 | Ga0070664_100090511 | |||
| 423 | Ga0068857_100143140 | |||
| 424 | Ga0068856_100021372 | |||
| 425 | Ga0068856_100059372 | |||
| 426 | Ga0068852_100021115 | |||
| 427 | Ga0068852_100290504 | |||
| 428 | Ga0068859_100678900 | |||
| 429 | Ga0068851_10000362 | |||
| 430 | Ga0068851_10053980 | |||
| 431 | Ga0068863_100102515 | |||
| 432 | Ga0068858_100001486 | |||
| 433 | Ga0068858_100097992 | |||
| 434 | Ga0068860_100044570 | |||
| 435 | Ga0075364_10095979 | |||
| 436 | Ga0097621_100007117 | |||
| 437 | Ga0068871_100012012 | |||
| 438 | Ga0068865_100003233 | |||
| 439 | Ga0068865_100064714 | |||
| 440 | Ga0097620_100678787 | |||
| 441 | Ga0079104_1000511 | |||
| 442 | Ga0079104_1001983 | |||
| 443 | Ga0079104_1002803 | |||
| 444 | Ga0099795_10000820 | |||
| 445 | Ga0105251_10000228 | |||
| 446 | Ga0105251_10001338 | |||
| 447 | Ga0105251_10002657 | |||
| 448 | Ga0105251_10015108 | |||
| 449 | Ga0105251_10039376 | |||
| 450 | Ga0105244_10000024 | |||
| 451 | Ga0105244_10000048 | |||
| 452 | Ga0105244_10001565 | |||
| 453 | Ga0105244_10012857 | |||
| 454 | Ga0105244_10016607 | |||
| 455 | Ga0105244_10036669 | |||
| 456 | Ga0105244_10123298 | |||
| 457 | Ga0105244_10138995 | |||
| 458 | Ga0105250_10000003 | |||
| 459 | Ga0105250_10000025 | |||
| 460 | Ga0105250_10000044 | |||
| 461 | Ga0105250_10002491 | |||
| 462 | Ga0105250_10016241 | |||
| 463 | Ga0105250_10123441 | |||
| 464 | Ga0105240_10000617 | |||
| 465 | Ga0105240_10058039 | |||
| 466 | Ga0105240_10122593 | |||
| 467 | Ga0105240_10238478 | |||
| 468 | Ga0105245_10193266 | |||
| 469 | Ga0105247_10000018 | |||
| 470 | Ga0105243_10173599 | |||
| 471 | Ga0105241_10000004 | |||
| 472 | Ga0105241_10030972 | |||
| 473 | Ga0105241_10556734 | |||
| 474 | Ga0105242_10001890 | |||
| 475 | Ga0105242_10199138 | |||
| 476 | Ga0105248_10197838 | |||
| 477 | Ga0105238_10009940 | |||
| 478 | Ga0105249_10004564 | |||
| 479 | Ga0099796_10006282 | |||
| 480 | Ga0105239_10062343 | |||
| 481 | Ga0105239_10492348 | |||
| 482 | Ga0105246_10021080 | |||
| 483 | Ga0105246_10385671 | |||
| 484 | Ga0157373_10000104 | |||
| 485 | Ga0157373_10010360 | |||
| 486 | Ga0157371_10000007 | |||
| 487 | Ga0157371_10057469 | |||
| 488 | Ga0157371_10079762 | |||
| 489 | Ga0157371_10138553 | |||
| 490 | Ga0157370_10001101 | |||
| 491 | Ga0157370_10128434 | |||
| 492 | Ga0157369_10000983 | |||
| 493 | Ga0157369_10001364 | |||
| 494 | Ga0157369_10017667 | |||
| 495 | Ga0157369_10522464 | |||
| 496 | Ga0157374_10302135 | |||
| 497 | Ga0157378_10000130 | |||
| 498 | Ga0157378_10365381 | |||
| 499 | Ga0163162_10121342 | |||
| 500 | Ga0163162_10339848 | |||
| 501 | Ga0157372_10022705 | |||
| 502 | Ga0157372_10191088 | |||
| 503 | Ga0157372_10313059 | |||
| 504 | Ga0157372_10390167 | |||
| 505 | Ga0157372_10536039 | |||
| 506 | Ga0157375_10000256 | |||
| 507 | Ga0182008_10003644 | |||
| 508 | Ga0157376_10056003 | |||
| 509 | Ga0163161_10000004 | |||
| 510 | Ga0213876_10000176 | |||
| 511 | Ga0209760_100057 | |||
| 512 | Ga0209784_100001 | |||
| 513 | Ga0209566_100001 | |||
| 514 | Ga0209674_100002 | |||
| 515 | Ga0209563_100008 | |||
| 516 | Ga0207427_100002 | |||
| 517 | Ga0209437_100007 | |||
| 518 | Ga0207425_1013847 | |||
| 519 | Ga0209677_100004 | |||
| 520 | Ga0209129_1000015 | |||
| 521 | Ga0209233_1003856 | |||
| 522 | Ga0207656_10002243 | |||
| 523 | Ga0207656_10189332 | |||
| 524 | Ga0207696_1000003 | |||
| 525 | Ga0207696_1000004 | |||
| 526 | Ga0207696_1000007 | |||
| 527 | Ga0207696_1000033 | |||
| 528 | Ga0207696_1000192 | |||
| 529 | Ga0207696_1000408 | |||
| 530 | Ga0207655_1000011 | |||
| 531 | Ga0207655_1000023 | |||
| 532 | Ga0207655_1000029 | |||
| 533 | Ga0207655_1000042 | |||
| 534 | Ga0207655_1000206 | |||
| 535 | Ga0207655_1000621 | |||
| 536 | Ga0207655_1038164 | |||
| 537 | Ga0207713_1000021 | |||
| 538 | Ga0207713_1000101 | |||
| 539 | Ga0207713_1000133 | |||
| 540 | Ga0207713_1001385 | |||
| 541 | Ga0207713_1077377 | |||
| 542 | Ga0207710_10000016 | |||
| 543 | Ga0207680_10000258 | |||
| 544 | Ga0207647_10000023 | |||
| 545 | Ga0207647_10176261 | |||
| 546 | Ga0207645_10077414 | |||
| 547 | Ga0207654_10000006 | |||
| 548 | Ga0207654_10026699 | |||
| 549 | Ga0207695_10000032 | |||
| 550 | Ga0207695_10023289 | |||
| 551 | Ga0207695_10066931 | |||
| 552 | Ga0207695_10105112 | |||
| 553 | Ga0207695_10180631 | |||
| 554 | Ga0207671_10102696 | |||
| 555 | Ga0207663_10169448 | |||
| 556 | Ga0207657_10020912 | |||
| 557 | Ga0207649_10073183 | |||
| 558 | Ga0207649_10100628 | |||
| 559 | Ga0207694_10003116 | |||
| 560 | Ga0207694_10004607 | |||
| 561 | Ga0207650_10005523 | |||
| 562 | Ga0207687_10268082 | |||
| 563 | Ga0207644_10270370 | |||
| 564 | Ga0207706_10017276 | |||
| 565 | Ga0207686_10006050 | |||
| 566 | Ga0207704_10010462 | |||
| 567 | Ga0207704_10045575 | |||
| 568 | Ga0207665_10086173 | |||
| 569 | Ga0207679_10559525 | |||
| 570 | Ga0207667_10042295 | |||
| 571 | Ga0207667_10081340 | |||
| 572 | Ga0207667_10172066 | |||
| 573 | Ga0207712_10000497 | |||
| 574 | Ga0207640_10167585 | |||
| 575 | Ga0207658_10051139 | |||
| 576 | Ga0207658_10518641 | |||
| 577 | Ga0207677_10207185 | |||
| 578 | Ga0207703_10002654 | |||
| 579 | Ga0207639_10000190 | |||
| 580 | Ga0207639_10001379 | |||
| 581 | Ga0207639_10022886 | |||
| 582 | Ga0207639_10231734 | |||
| 583 | Ga0207678_10006419 | |||
| 584 | Ga0207678_10118885 | |||
| 585 | Ga0207702_10032081 | |||
| 586 | Ga0207702_10872316 | |||
| 587 | Ga0207641_10136637 | |||
| 588 | Ga0207641_10248471 | |||
| 589 | Ga0207674_10004880 | |||
| 590 | Ga0207674_10205749 | |||
| 591 | Ga0209281_1000008 | |||
| 592 | Ga0209281_1000041 | |||
| 593 | Ga0209281_1017976 | |||
| 594 | Ga0209371_1000010 | |||
| 595 | Ga0209371_1000026 | |||
| 596 | Ga0209371_1000146 | |||
| 597 | Ga0209371_1002140 | |||
| 598 | Ga0209371_1002953 | |||
| 599 | Ga0209371_1034672 | |||
| 600 | Ga0209371_1042454 | |||
| 601 | Ga0265354_1005775 | |||
| 602 | Ga0265357_1001801 | |||
| 603 | Ga0268266_10000013 | |||
| 604 | Ga0268265_10068938 | |||
| 605 | Ga0268264_10133276 | |||
| 606 | Ga0268256_1000003 | |||
| 607 | Ga0268256_1000117 | |||
| 608 | Ga0268256_1002655 | |||
| 609 | Ga0268256_1003828 | |||
| 610 | Ga0268256_1032960 | |||
| 611 | Ga0268256_1039360 | |||
| 612 | Ga0268256_1050254 | |||
| 613 | Ga0268256_1050262 | |||
| 614 | Ga0265770_1002128 | |||
| 615 | Ga0307516_10004733 | |||
| 616 | Ga0316593_10011987 | |||
| 617 | Ga0316593_10069876 | |||
| 618 | Ga0307510_10132958 | |||
| 619 | Ga0373923_0254673 | |||
| 620 | Ga0373954_0223807 | |||
| 621 | Ga0373955_0096948 | |||
| 622 | Ga0316584_0040558 | |||
| 623 | Ga0436365_0571044 | |||
| 624 | Ga0439438_000001 | |||
| 625 | Ga0439447_005018 | |||
| 626 | Ga0439432_000740 | |||
| 627 | Ga0439432_002843 | |||
| 628 | Ga0439432_009589 | |||
| 629 | Ga0439452_000027 | |||
| 630 | Ga0439452_000033 | |||
| 631 | Ga0495617_006839 | |||
| 632 | Ga0495627_000145 | |||
| 633 | Ga0495627_088308 | |||
| 634 | Ga0495591_000301 | |||
| 635 | Ga0495650_0000016 | |||
| 636 | Ga0495650_0110494 | |||
| 637 | Ga0495639_0229785 | |||
| 638 | Ga0495632_0076836 | |||
| 639 | Ga0495652_0483550 | |||
| 640 | Ga0495654_0002277 | |||
| 641 | Ga0495658_0190759 | |||
| 642 | Ga0495589_0000006 | |||
| 643 | Ga0495660_0000007 | |||
| 644 | Ga0495681_0007032 | |||
| 645 | Ga0496101_0000029 | |||
| 646 | Ga0496103_0058891 | |||
| 647 | Ga0496104_0008700 | |||
| 648 | Ga0496104_0030321 | |||
| 649 | Ga0496105_0000014 | |||
| 650 | Ga0496107_0362549 | |||
| 651 | Ga0496114_0040199 | |||
| 652 | Ga0496115_0005522 | |||
| 653 | Ga0496116_0000031 | |||
| 654 | Ga0496116_0000054 | |||
| 655 | Ga0496116_0000505 | |||
| 656 | Ga0496116_0009874 | |||
| 657 | Ga0496116_0033288 | |||
| 658 | Ga0496116_0111366 | |||
| 659 | Ga0496117_0003341 | |||
| 660 | Ga0496117_0012152 | |||
| 661 | Ga0496117_0052951 | |||
| 662 | Ga0496118_0001321 | |||
| 663 | Ga0496118_0042574 | |||
| 664 | Ga0496118_0055891 | |||
| 665 | Ga0496118_0150213 | |||
| 666 | Ga0496118_0151389 | |||
| 667 | Ga0496119_0000045 | |||
| 668 | Ga0496119_0014780 | |||
| 669 | Ga0496119_0018488 | |||
| 670 | Ga0496119_0061553 | |||
| 671 | Ga0496119_0075399 | |||
| 672 | Ga0496119_0092125 | |||
| 673 | Ga0496120_0000374 | |||
| 674 | Ga0496120_0000429 | |||
| 675 | Ga0496120_0000760 | |||
| 676 | Ga0496120_0002810 | |||
| 677 | Ga0496120_0007944 | |||
| 678 | Ga0496120_0016246 | |||
| 679 | Ga0496122_0000013 | |||
| 680 | Ga0496122_0018334 | |||
| 681 | Ga0496122_0024887 | |||
| 682 | Ga0496122_0058305 | |||
| 683 | Ga0496122_0186807 | |||
| 684 | Ga0496123_0000010 | |||
| 685 | Ga0496123_0000152 | |||
| 686 | Ga0496123_0003920 | |||
| 687 | Ga0496123_0037777 | |||
| 688 | Ga0496124_0000010 | |||
| 689 | Ga0496124_0000039 | |||
| 690 | Ga0496124_0000322 | |||
| 691 | Ga0496124_0001225 | |||
| 692 | Ga0496124_0002999 | |||
| 693 | Ga0496124_0145379 | |||
| 694 | Ga0496124_0372201 | |||
| 695 | Ga0496125_0000016 | |||
| 696 | Ga0496125_0000019 | |||
| 697 | Ga0496125_0019973 | |||
| 698 | Ga0496126_0000252 | |||
| 699 | Ga0496126_0035008 | |||
| 700 | Ga0501033_0323626 | |||
| 701 | Ga0501034_0704017 | |||
| 702 | Ga0501035_0202567 | |||
| 703 | 2506577139 | |||
| 704 | 2506582277 | |||
| 705 | 2508851106 | |||
| 706 | 2547694274 | |||
| 707 | 2562466346 | |||
| 708 | 2585826794 | |||
| 709 | 2585831280 | |||
| 710 | 2599411937 | |||
| 711 | 2601525115 | |||
| 712 | 2601530302 | |||
| 713 | 2601617094 | |||
| 714 | 2601621559 | |||
| 715 | 2601650717 | |||
| 716 | 2601654883 | |||
| 717 | 2601660450 | |||
| 718 | 2601708298 | |||
| 719 | 2601713391 | |||
| 720 | 2601718442 | |||
| 721 | 2601728325 | |||
| 722 | 2601733390 | |||
| 723 | 2601738309 | |||
| 724 | 2601742433 | |||
| 725 | 2601753647 | |||
| 726 | 2602019966 | |||
| 727 | 2603700116 | |||
| 728 | 2603840501 | |||
| 729 | 2603845836 | |||
| 730 | 2603850909 | |||
| 731 | 2603855718 | |||
| 732 | 2603873300 | |||
| 733 | 2606050738 | |||
| 734 | 2606148422 | |||
| 735 | 2606178369 | |||
| 736 | 2609914331 | |||
| 737 | 2637226683 | |||
| 738 | 2656275881 | |||
| 739 | 2671108373 | |||
| 740 | 2676407164 | |||
| 741 | 2689443539 | |||
| 742 | 2712470569 | |||
| 743 | 2772437679 | |||
| 744 | 2792312137 | |||
| 745 | 2807177255 | |||
| 746 | 2844426509 | |||
| 747 | 2846543166 | |||
| 748 | 2852103578 | |||
| 749 | 2869552958 | |||
| 750 | 2888367669 | |||
| 751 | 2888374630 | |||
| 752 | 2904474955 | |||
| 753 | 2904505604 | |||
| 754 | 2904514949 | |||
| 755 | 2908671201 | |||
| 756 | 2919151301 | |||
| 757 | 2927146175 | |||
| 758 | 2932407308 | |||
| 759 | 2935629357 | |||
| 760 | 2937969459 | |||
| 761 | 2939574833 | |||
| 762 | 2939579218 | |||
| 763 | 2945879270 | |||
| 764 | 2969083666 | |||
| 765 | 2974437431 | |||
| 766 | 2984560767 | |||
| 767 | 2984598843 | |||
| 768 | 3000380101 | |||
| 769 | 640936684 | |||
| 770 | 8004594381 | |||
| 771 | 8015398967 | |||
| 772 | 8016736850 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pib-assembly1.cif.gz_A | structure of the klebsiella pneumoniae lpxh-az1 complex | 0.9815 | 3 | 240 |
| 6ph9-assembly1.cif.gz_A | crystal structure of the klebsiella pneumoniae lpxh-lipid x complex | 0.9787 | 1 | 240 |
| 6pj3-assembly1.cif.gz_A | crystal structure of the klebsiella pneumoniae lpxh/jh-lph-33 complex | 0.976 | 4 | 241 |
| 5b49-assembly1.cif.gz_A | crystal structure of lpxh with manganese from pseudomonas aeruginosa | 0.9752 | 4 | 241 |
| 7ss7-assembly1.cif.gz_A | crystal structure of klebsiella lpxh in complex with jh-lph-50 | 0.9743 | 4 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P43341_2_237_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.9892 | 4 | 237 | 2.40.10.10 |
| af_P43341_2_237_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.9767 | 4 | 237 | 2.40.10.10 |
| af_A0A2R8QAT2_122_259_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.7298 | 19 | 95 | 3.30.870.10 |
| 4ry9B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6944 | 24 | 79 | 3.40.50.2300 |
| af_K7LEE1_82_225_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6858 | 6 | 114 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U9D9A1-F1-model_v4 | UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) | 1.003 | 4 | 81 |
GO:0005886
GO:0008758 GO:0009245 GO:0046872 |
| AF-A0A6L7A0X8-F1-model_v4 | UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54) | 0.9994 | 4 | 96 |
GO:0005886
GO:0008758 GO:0009245 GO:0046872 |
| AF-A0A377M829-F1-model_v4 | UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) | 0.9986 | 4 | 188 |
GO:0005737
GO:0008758 GO:0009245 GO:0019897 GO:0030145 |
| AF-A0A844W8M1-F1-model_v4 | deleted | 0.9969 | 4 | 141 |
|
| AF-A0A2W6PCZ8-F1-model_v4 | UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54) | 0.9961 | 4 | 120 |
GO:0005737
GO:0005886 GO:0008758 GO:0009245 GO:0046872 |