F430632

General Info

Members Datasets Scaffolds Average Seq Length
386 236 772 235

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000011|Ga0496104_0000011_93695_94459
Length 254
Sequence VSRVTDATGNRLRRQSAVQASGRIDVTTLFISDLHLDESRPQIVELFDQFLRGQARDAVALYILGDLFESWIGDDDDSRLADTVASALHALNAHGVPVFFMHGNRDFLLGNAYAQRAGMTLLDDPQVIELDGERVLIMHGDTLCTDDVEYQKFRALVRDVRWQAQFLARPLVERRAFAAQARGESRKHTAAAKPEIMDVNPAAVVAAMQAHGVRRLIHGHTHRPATHRLGVDRQAAERIVLGDWYEQSSVLTWN

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
118 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
123 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
133 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
138 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
168 2506520008 Serratia plymuthica AS12 Isolate Unclassified
169 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
170 2547132181 Kosakonia sacchari SP1 Isolate Stem
171 2561511199 Enterobacter sp. R4-368 Isolate Nodule
172 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
173 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
174 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
175 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
176 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
177 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
178 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
179 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
180 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
181 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
182 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
183 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
184 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
185 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
186 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
187 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
188 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
189 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
190 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
191 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
192 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
193 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
194 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
195 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
196 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
197 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
198 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
199 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
200 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
201 2636415599 Klebsiella variicola DX120E Isolate Unclassified
202 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
203 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
204 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
205 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
206 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
207 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
208 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
209 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
210 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
211 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
212 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
213 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
214 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
215 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
216 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
217 2904504865 Serratia marcescens 1822 Isolate Unclassified
218 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
219 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
220 2919150387 Rahnella aceris 1817 Isolate Unclassified
221 2927143783 Rahnella sp. 2050 Isolate Unclassified
222 2932406140 Serratia sp. 2723 Isolate Rhizosphere
223 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
224 2937967321 Serratia sp. YC16 Isolate Unclassified
225 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
226 2939577877 Serratia sp. 509 Isolate Rhizosphere
227 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
228 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
229 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
230 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
231 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
232 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
233 640753048 Serratia proteamaculans 568 Isolate Endosphere
234 8004592986 Serratia sp. S119 Isolate Unclassified
235 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
236 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.09
Metatranscriptomes 0.78
Isolates 18.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 5.18
Nodule 1.81
Rhizoplane 9.84
Rhizosphere 65.54
Stem 0.26
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0000011 3300048907 Bacteria 459358
2 SwRhRL2b_contig_3107099 2162886007 Bacteria 2011
3 JGI25163J39215_1000108 3300002771 Bacteria 34764
4 JGI25164J39214_1000014 3300002772 Bacteria 219691
5 Ga0055538_1000005 3300003751 Bacteria 575218
6 Ga0055539_1000007 3300003752 Bacteria 575218
7 Ga0055533_1000009 3300003756 Bacteria 575218
8 Ga0055525_1000010 3300003759 Bacteria 575218
9 Ga0055541_1000005 3300003841 Bacteria 575218
10 Ga0058692_1000146 3300003856 Bacteria 44864
11 Ga0058692_1002924 3300003856 Bacteria 5510
12 Ga0058692_1012961 3300003856 Bacteria 1956
13 Ga0065703_1019913 3300005272 Bacteria 2274
14 Ga0065704_10104445 3300005289 Bacteria 2130
15 Ga0070676_10062101 3300005328 Bacteria 2222
16 Ga0070670_100011664 3300005331 Bacteria 7516
17 Ga0070666_10000444 3300005335 Bacteria 25283
18 Ga0070666_10011865 3300005335 Bacteria 5479
19 Ga0070666_10039626 3300005335 Bacteria 3141
20 Ga0070661_100010710 3300005344 Bacteria 6380
21 Ga0070667_100008634 3300005367 Bacteria 8445
22 Ga0070711_100075484 3300005439 Bacteria 2387
23 Ga0070663_100034137 3300005455 Bacteria 3521
24 Ga0070663_100216176 3300005455 Bacteria 1503
25 Ga0070662_100005063 3300005457 Bacteria 8388
26 Ga0070681_10057937 3300005458 Bacteria 3854
27 Ga0068853_100008444 3300005539 Bacteria 8277
28 Ga0068853_100105449 3300005539 Bacteria 2497
29 Ga0068853_100242492 3300005539 Bacteria 1652
30 Ga0070696_100001818 3300005546 Bacteria 14014
31 Ga0070696_100079642 3300005546 Bacteria 2318
32 Ga0070665_100000807 3300005548 Bacteria 40948
33 Ga0070665_100204956 3300005548 Bacteria 1973
34 Ga0068855_100139780 3300005563 Bacteria 2762
35 Ga0068855_100193738 3300005563 Bacteria 2291
36 Ga0070664_100090511 3300005564 Bacteria 2648
37 Ga0068857_100143140 3300005577 Bacteria 2162
38 Ga0068856_100021372 3300005614 Bacteria 6291
39 Ga0068856_100059372 3300005614 Bacteria 3778
40 Ga0068852_100021115 3300005616 Bacteria 5190
41 Ga0068852_100290504 3300005616 Bacteria 1579
42 Ga0068859_100678900 3300005617 Bacteria 1121
43 Ga0068851_10000362 3300005834 Bacteria 20468
44 Ga0068851_10053980 3300005834 Bacteria 2046
45 Ga0068863_100102515 3300005841 Bacteria 2721
46 Ga0068858_100001486 3300005842 Bacteria 24143
47 Ga0068858_100097992 3300005842 Bacteria 2733
48 Ga0068860_100044570 3300005843 Bacteria 4228
49 Ga0075364_10095979 3300006051 Bacteria 1971
50 Ga0097621_100007117 3300006237 Bacteria 7975
51 Ga0068871_100012012 3300006358 Bacteria 6372
52 Ga0068865_100003233 3300006881 Bacteria 9761
53 Ga0068865_100064714 3300006881 Bacteria 2574
54 Ga0097620_100678787 3300006931 Bacteria 1121
55 Ga0079104_1000511 3300006946 Bacteria 41655
56 Ga0079104_1001983 3300006946 Bacteria 12008
57 Ga0079104_1002803 3300006946 Bacteria 8777
58 Ga0099795_10000820 3300007788 Bacteria 6147
59 Ga0105251_10000228 3300009011 Bacteria 56620
60 Ga0105251_10001338 3300009011 Bacteria 21285
61 Ga0105251_10002657 3300009011 Bacteria 13778
62 Ga0105251_10015108 3300009011 Bacteria 4232
63 Ga0105251_10039376 3300009011 Bacteria 2310
64 Ga0105244_10000024 3300009036 Bacteria 218628
65 Ga0105244_10000048 3300009036 Bacteria 141340
66 Ga0105244_10001565 3300009036 Bacteria 18167
67 Ga0105244_10012857 3300009036 Bacteria 4929
68 Ga0105244_10016607 3300009036 Bacteria 4188
69 Ga0105244_10036669 3300009036 Bacteria 2567
70 Ga0105244_10123298 3300009036 Bacteria 1254
71 Ga0105244_10138995 3300009036 Bacteria 1169
72 Ga0105250_10000003 3300009092 Bacteria 547770
73 Ga0105250_10000025 3300009092 Bacteria 215424
74 Ga0105250_10000044 3300009092 Bacteria 128269
75 Ga0105250_10002491 3300009092 Bacteria 9233
76 Ga0105250_10016241 3300009092 Bacteria 3037
77 Ga0105250_10123441 3300009092 Bacteria 1066
78 Ga0105240_10000617 3300009093 Bacteria 65935
79 Ga0105240_10058039 3300009093 Bacteria 4832
80 Ga0105240_10122593 3300009093 Bacteria 3128
81 Ga0105240_10238478 3300009093 Bacteria 2110
82 Ga0105245_10193266 3300009098 Bacteria 1951
83 Ga0105247_10000018 3300009101 Bacteria 259335
84 Ga0105243_10173599 3300009148 Bacteria 1869
85 Ga0105241_10000004 3300009174 Bacteria 803007
86 Ga0105241_10030972 3300009174 Bacteria 4001
87 Ga0105241_10556734 3300009174 Bacteria 1030
88 Ga0105242_10001890 3300009176 Bacteria 16469
89 Ga0105242_10199138 3300009176 Bacteria 1778
90 Ga0105248_10197838 3300009177 Bacteria 2265
91 Ga0105238_10009940 3300009551 Bacteria 9540
92 Ga0105249_10004564 3300009553 Bacteria 11967
93 Ga0099796_10006282 3300010159 Bacteria 3030
94 Ga0105239_10062343 3300010375 Bacteria 4092
95 Ga0105239_10492348 3300010375 Bacteria 1393
96 Ga0105246_10021080 3300011119 Bacteria 4188
97 Ga0105246_10385671 3300011119 Bacteria 1159
98 Ga0157373_10000104 3300013100 Bacteria 66432
99 Ga0157373_10010360 3300013100 Bacteria 6862
100 Ga0157371_10000007 3300013102 Bacteria 401847
101 Ga0157371_10057469 3300013102 Bacteria 2759
102 Ga0157371_10079762 3300013102 Bacteria 2318
103 Ga0157371_10138553 3300013102 Bacteria 1733
104 Ga0157370_10001101 3300013104 Bacteria 33897
105 Ga0157370_10128434 3300013104 Bacteria 2365
106 Ga0157369_10000983 3300013105 Bacteria 36119
107 Ga0157369_10001364 3300013105 Bacteria 30124
108 Ga0157369_10017667 3300013105 Bacteria 8014
109 Ga0157369_10522464 3300013105 Bacteria 1228
110 Ga0157374_10302135 3300013296 Bacteria 1583
111 Ga0157378_10000130 3300013297 Bacteria 72949
112 Ga0157378_10365381 3300013297 Bacteria 1413
113 Ga0163162_10121342 3300013306 Bacteria 2718
114 Ga0163162_10339848 3300013306 Bacteria 1634
115 Ga0157372_10022705 3300013307 Bacteria 6791
116 Ga0157372_10191088 3300013307 Bacteria 2372
117 Ga0157372_10313059 3300013307 Bacteria 1827
118 Ga0157372_10390167 3300013307 Bacteria 1622
119 Ga0157372_10536039 3300013307 Bacteria 1364
120 Ga0157375_10000256 3300013308 Bacteria 48304
121 Ga0182008_10003644 3300014497 Bacteria 9190
122 Ga0157376_10056003 3300014969 Bacteria 3292
123 Ga0163161_10000004 3300017792 Bacteria 333149
124 Ga0213876_10000176 3300021384 Bacteria 66221
125 Ga0209760_100057 3300025207 Bacteria 99434
126 Ga0209784_100001 3300025224 Bacteria 3600592
127 Ga0209566_100001 3300025225 Bacteria 3600765
128 Ga0209674_100002 3300025226 Bacteria 3600592
129 Ga0209563_100008 3300025230 Bacteria 1554545
130 Ga0207427_100002 3300025231 Bacteria 1355321
131 Ga0209437_100007 3300025233 Bacteria 938377
132 Ga0207425_1013847 3300025245 Bacteria 1849
133 Ga0209677_100004 3300025253 Bacteria 1554545
134 Ga0209129_1000015 3300025258 Bacteria 487967
135 Ga0209233_1003856 3300025261 Bacteria 5219
136 Ga0207656_10002243 3300025321 Bacteria 6476
137 Ga0207656_10189332 3300025321 Bacteria 990
138 Ga0207696_1000003 3300025711 Bacteria 860639
139 Ga0207696_1000004 3300025711 Bacteria 671626
140 Ga0207696_1000007 3300025711 Bacteria 578417
141 Ga0207696_1000033 3300025711 Bacteria 360689
142 Ga0207696_1000192 3300025711 Bacteria 94285
143 Ga0207696_1000408 3300025711 Bacteria 40084
144 Ga0207655_1000011 3300025728 Bacteria 643321
145 Ga0207655_1000023 3300025728 Bacteria 467070
146 Ga0207655_1000029 3300025728 Bacteria 432187
147 Ga0207655_1000042 3300025728 Bacteria 333039
148 Ga0207655_1000206 3300025728 Bacteria 102975
149 Ga0207655_1000621 3300025728 Bacteria 42638
150 Ga0207655_1038164 3300025728 Bacteria 2104
151 Ga0207713_1000021 3300025735 Bacteria 353108
152 Ga0207713_1000101 3300025735 Bacteria 140693
153 Ga0207713_1000133 3300025735 Bacteria 112797
154 Ga0207713_1001385 3300025735 Bacteria 19655
155 Ga0207713_1077377 3300025735 Bacteria 1208
156 Ga0207710_10000016 3300025900 Bacteria 388568
157 Ga0207680_10000258 3300025903 Bacteria 25434
158 Ga0207647_10000023 3300025904 Bacteria 115648
159 Ga0207647_10176261 3300025904 Bacteria 1244
160 Ga0207645_10077414 3300025907 Bacteria 2131
161 Ga0207654_10000006 3300025911 Bacteria 815027
162 Ga0207654_10026699 3300025911 Bacteria 3130
163 Ga0207695_10000032 3300025913 Bacteria 521283
164 Ga0207695_10023289 3300025913 Bacteria 7003
165 Ga0207695_10066931 3300025913 Bacteria 3687
166 Ga0207695_10105112 3300025913 Bacteria 2811
167 Ga0207695_10180631 3300025913 Bacteria 2031
168 Ga0207671_10102696 3300025914 Bacteria 2167
169 Ga0207663_10169448 3300025916 Bacteria 1550
170 Ga0207657_10020912 3300025919 Bacteria 6175
171 Ga0207649_10073183 3300025920 Bacteria 2194
172 Ga0207649_10100628 3300025920 Bacteria 1912
173 Ga0207694_10003116 3300025924 Bacteria 13255
174 Ga0207694_10004607 3300025924 Bacteria 10733
175 Ga0207650_10005523 3300025925 Bacteria 8625
176 Ga0207687_10268082 3300025927 Bacteria 1364
177 Ga0207644_10270370 3300025931 Bacteria 1362
178 Ga0207706_10017276 3300025933 Bacteria 6501
179 Ga0207686_10006050 3300025934 Bacteria 6497
180 Ga0207704_10010462 3300025938 Bacteria 4528
181 Ga0207704_10045575 3300025938 Bacteria 2606
182 Ga0207665_10086173 3300025939 Bacteria 2169
183 Ga0207679_10559525 3300025945 Bacteria 1027
184 Ga0207667_10042295 3300025949 Bacteria 4844
185 Ga0207667_10081340 3300025949 Bacteria 3355
186 Ga0207667_10172066 3300025949 Bacteria 2226
187 Ga0207712_10000497 3300025961 Bacteria 32461
188 Ga0207640_10167585 3300025981 Bacteria 1633
189 Ga0207658_10051139 3300025986 Bacteria 3044
190 Ga0207658_10518641 3300025986 Bacteria 1063
191 Ga0207677_10207185 3300026023 Bacteria 1563
192 Ga0207703_10002654 3300026035 Bacteria 15384
193 Ga0207639_10000190 3300026041 Bacteria 47698
194 Ga0207639_10001379 3300026041 Bacteria 16398
195 Ga0207639_10022886 3300026041 Bacteria 4507
196 Ga0207639_10231734 3300026041 Bacteria 1601
197 Ga0207678_10006419 3300026067 Bacteria 10433
198 Ga0207678_10118885 3300026067 Bacteria 2255
199 Ga0207702_10032081 3300026078 Bacteria 4382
200 Ga0207702_10872316 3300026078 Bacteria 891
201 Ga0207641_10136637 3300026088 Bacteria 2207
202 Ga0207641_10248471 3300026088 Bacteria 1660
203 Ga0207674_10004880 3300026116 Bacteria 16054
204 Ga0207674_10205749 3300026116 Bacteria 1917
205 Ga0209281_1000008 3300027111 Bacteria 867470
206 Ga0209281_1000041 3300027111 Bacteria 347825
207 Ga0209281_1017976 3300027111 Bacteria 1423
208 Ga0209371_1000010 3300027312 Bacteria 922021
209 Ga0209371_1000026 3300027312 Bacteria 449205
210 Ga0209371_1000146 3300027312 Bacteria 115378
211 Ga0209371_1002140 3300027312 Bacteria 11629
212 Ga0209371_1002953 3300027312 Bacteria 8854
213 Ga0209371_1034672 3300027312 Bacteria 1068
214 Ga0209371_1042454 3300027312 Bacteria 915
215 Ga0265354_1005775 3300028016 Bacteria 1245
216 Ga0265357_1001801 3300028023 Bacteria 1646
217 Ga0268266_10000013 3300028379 Bacteria 649715
218 Ga0268265_10068938 3300028380 Bacteria 2745
219 Ga0268264_10133276 3300028381 Bacteria 2206
220 Ga0268256_1000003 3300030500 Bacteria 1289401
221 Ga0268256_1000117 3300030500 Bacteria 115176
222 Ga0268256_1002655 3300030500 Bacteria 8854
223 Ga0268256_1003828 3300030500 Bacteria 6564
224 Ga0268256_1032960 3300030500 Bacteria 1228
225 Ga0268256_1039360 3300030500 Bacteria 1068
226 Ga0268256_1050254 3300030500 Bacteria 882
227 Ga0268256_1050262 3300030500 Bacteria 882
228 Ga0265770_1002128 3300030878 Bacteria 2693
229 Ga0307516_10004733 3300031730 Bacteria 16636
230 Ga0316593_10011987 3300032168 Bacteria 2535
231 Ga0316593_10069876 3300032168 Bacteria 1213
232 Ga0307510_10132958 3300033180 Bacteria 2154
233 Ga0373923_0254673 3300035111 Unclassified 822
234 Ga0373954_0223807 3300035118 Unclassified 926
235 Ga0373955_0096948 3300035172 Bacteria 1688
236 Ga0316584_0040558 3300036712 Bacteria 3469
237 Ga0436365_0571044 3300039437 Bacteria 107748
238 Ga0439438_000001 3300041405 Bacteria 1263568
239 Ga0439447_005018 3300041407 Bacteria 4459
240 Ga0439432_000740 3300042006 Bacteria 12232
241 Ga0439432_002843 3300042006 Bacteria 6453
242 Ga0439432_009589 3300042006 Bacteria 3374
243 Ga0439452_000027 3300042010 Bacteria 206086
244 Ga0439452_000033 3300042010 Bacteria 178345
245 Ga0495617_006839 3300046452 Bacteria 3983
246 Ga0495627_000145 3300046453 Bacteria 84853
247 Ga0495627_088308 3300046453 Bacteria 893
248 Ga0495591_000301 3300046458 Bacteria 45136
249 Ga0495650_0000016 3300046471 Bacteria 554693
250 Ga0495650_0110494 3300046471 Bacteria 1021
251 Ga0495639_0229785 3300046475 Unclassified 914
252 Ga0495632_0076836 3300046519 Bacteria 1597
253 Ga0495652_0483550 3300046529 Bacteria 861
254 Ga0495654_0002277 3300046530 Bacteria 12421
255 Ga0495658_0190759 3300046683 Bacteria 1274
256 Ga0495589_0000006 3300046794 Bacteria 303635
257 Ga0495660_0000007 3300046810 Bacteria 485295
258 Ga0495681_0007032 3300047470 Bacteria 7269
259 Ga0496101_0000029 3300048904 Bacteria 198515
260 Ga0496103_0058891 3300048906 Bacteria 2386
261 Ga0496104_0008700 3300048907 Bacteria 9027
262 Ga0496104_0030321 3300048907 Bacteria 5025
263 Ga0496105_0000014 3300048908 Bacteria 220911
264 Ga0496107_0362549 3300048910 Bacteria 1078
265 Ga0496114_0040199 3300048917 Bacteria 3870
266 Ga0496115_0005522 3300048918 Bacteria 9203
267 Ga0496116_0000031 3300048919 Bacteria 420043
268 Ga0496116_0000054 3300048919 Bacteria 289010
269 Ga0496116_0000505 3300048919 Bacteria 53281
270 Ga0496116_0009874 3300048919 Bacteria 8076
271 Ga0496116_0033288 3300048919 Bacteria 3659
272 Ga0496116_0111366 3300048919 Bacteria 1608
273 Ga0496117_0003341 3300048920 Bacteria 18739
274 Ga0496117_0012152 3300048920 Bacteria 7626
275 Ga0496117_0052951 3300048920 Bacteria 2855
276 Ga0496118_0001321 3300048921 Bacteria 37625
277 Ga0496118_0042574 3300048921 Bacteria 3581
278 Ga0496118_0055891 3300048921 Bacteria 2972
279 Ga0496118_0150213 3300048921 Bacteria 1459
280 Ga0496118_0151389 3300048921 Bacteria 1451
281 Ga0496119_0000045 3300048922 Bacteria 191361
282 Ga0496119_0014780 3300048922 Bacteria 6076
283 Ga0496119_0018488 3300048922 Bacteria 5183
284 Ga0496119_0061553 3300048922 Bacteria 2240
285 Ga0496119_0075399 3300048922 Bacteria 1960
286 Ga0496119_0092125 3300048922 Bacteria 1720
287 Ga0496120_0000374 3300048923 Bacteria 72781
288 Ga0496120_0000429 3300048923 Bacteria 66724
289 Ga0496120_0000760 3300048923 Bacteria 46714
290 Ga0496120_0002810 3300048923 Bacteria 16823
291 Ga0496120_0007944 3300048923 Bacteria 7809
292 Ga0496120_0016246 3300048923 Bacteria 4870
293 Ga0496122_0000013 3300048925 Bacteria 501039
294 Ga0496122_0018334 3300048925 Bacteria 6476
295 Ga0496122_0024887 3300048925 Bacteria 5224
296 Ga0496122_0058305 3300048925 Bacteria 2859
297 Ga0496122_0186807 3300048925 Bacteria 1228
298 Ga0496123_0000010 3300048926 Bacteria 501039
299 Ga0496123_0000152 3300048926 Bacteria 140376
300 Ga0496123_0003920 3300048926 Bacteria 16160
301 Ga0496123_0037777 3300048926 Bacteria 3404
302 Ga0496124_0000010 3300048927 Bacteria 595157
303 Ga0496124_0000039 3300048927 Bacteria 307831
304 Ga0496124_0000322 3300048927 Bacteria 88424
305 Ga0496124_0001225 3300048927 Bacteria 39571
306 Ga0496124_0002999 3300048927 Bacteria 21117
307 Ga0496124_0145379 3300048927 Bacteria 1866
308 Ga0496124_0372201 3300048927 Bacteria 1002
309 Ga0496125_0000016 3300048928 Bacteria 512512
310 Ga0496125_0000019 3300048928 Bacteria 474989
311 Ga0496125_0019973 3300048928 Bacteria 6299
312 Ga0496126_0000252 3300048929 Bacteria 115370
313 Ga0496126_0035008 3300048929 Bacteria 4709
314 Ga0501033_0323626 3300049570 Unclassified 1083
315 Ga0501034_0704017 3300049571 Unclassified 908
316 Ga0501035_0202567 3300049822 Unclassified 1701
317 2506577139 2506520007 Bacteria 5442880
318 2506582277 2506520008 Bacteria 5443009
319 2508851106 2508501071 Bacteria 5454741
320 2547694274 2547132181 Bacteria 4945084
321 2562466346 2561511199 Bacteria 5155034
322 2585826794 2585427591 Bacteria 5482980
323 2585831280 2585427592 Bacteria 5370892
324 2599411937 2599185169 Bacteria 5441380
325 2601525115 2600255254 Bacteria 5281859
326 2601530302 2600255255 Bacteria 5282785
327 2601617094 2600255280 Bacteria 5292309
328 2601621559 2600255281 Bacteria 5288753
329 2601650717 2600255288 Bacteria 5282738
330 2601654883 2600255289 Bacteria 5281907
331 2601660450 2600255290 Bacteria 5282218
332 2601708298 2600255300 Bacteria 5287774
333 2601713391 2600255301 Bacteria 5280532
334 2601718442 2600255302 Bacteria 5288235
335 2601728325 2600255304 Bacteria 5283973
336 2601733390 2600255305 Bacteria 5282329
337 2601738309 2600255306 Bacteria 5281613
338 2601742433 2600255307 Bacteria 5439064
339 2601753647 2600255309 Bacteria 5431045
340 2602019966 2600255392 Bacteria 5437392
341 2603700116 2602042066 Bacteria 4423871
342 2603840501 2602042103 Bacteria 5284714
343 2603845836 2602042104 Bacteria 5281639
344 2603850909 2602042105 Bacteria 5282303
345 2603855718 2602042106 Bacteria 5282744
346 2603873300 2602042110 Bacteria 5283285
347 2606050738 2603880178 Bacteria 5283018
348 2606148422 2603880202 Bacteria 5284684
349 2606178369 2603880211 Bacteria 5284226
350 2609914331 2609459761 Bacteria 5513740
351 2637226683 2636415599 Bacteria 5718434
352 2656275881 2654587920 Bacteria 5475511
353 2671108373 2667528173 Bacteria 5375747
354 2676407164 2675903046 Bacteria 5451247
355 2689443539 2687453601 Bacteria 5546041
356 2712470569 2711768156 Bacteria 4471618
357 2772437679 2772190666 Bacteria 5117644
358 2792312137 2791355010 Bacteria 4864581
359 2807177255 2806310673 Bacteria 4801221
360 2844426509 2844425489 Bacteria 4854065
361 2846543166 2846540461 Bacteria 5471451
362 2852103578 2852103415 Bacteria 5193810
363 2869552958 2869551831 Bacteria 5474685
364 2888367669 2888366609 Bacteria 5155009
365 2888374630 2888373701 Bacteria 5098052
366 2904474955 2904474040 Bacteria 5504324
367 2904505604 2904504865 Bacteria 5152820
368 2904514949 2904513164 Bacteria 5476410
369 2908671201 2908669403 Bacteria 5740494
370 2919151301 2919150387 Bacteria 5500879
371 2927146175 2927143783 Bacteria 5504251
372 2932407308 2932406140 Bacteria 5134491
373 2935629357 2935625433 Bacteria 5042964
374 2937969459 2937967321 Bacteria 5094075
375 2939574833 2939573065 Bacteria 4926053
376 2939579218 2939577877 Bacteria 5132791
377 2945879270 2945874760 Bacteria 5527237
378 2969083666 2969079654 Bacteria 5439582
379 2974437431 2974435778 Bacteria 4876478
380 2984560767 2984559226 Bacteria 5683096
381 2984598843 2984595703 Bacteria 5682994
382 3000380101 3000376612 Bacteria 4705565
383 640936684 640753048 Bacteria 5495657
384 8004594381 8004592986 Bacteria 5122074
385 8015398967 8015394850 Bacteria 5064660
386 8016736850 8016733728 Bacteria 5274317
387 Ga0496104_0000011
388 SwRhRL2b_contig_3107099
389 JGI25163J39215_1000108
390 JGI25164J39214_1000014
391 Ga0055538_1000005
392 Ga0055539_1000007
393 Ga0055533_1000009
394 Ga0055525_1000010
395 Ga0055541_1000005
396 Ga0058692_1000146
397 Ga0058692_1002924
398 Ga0058692_1012961
399 Ga0065703_1019913
400 Ga0065704_10104445
401 Ga0070676_10062101
402 Ga0070670_100011664
403 Ga0070666_10000444
404 Ga0070666_10011865
405 Ga0070666_10039626
406 Ga0070661_100010710
407 Ga0070667_100008634
408 Ga0070711_100075484
409 Ga0070663_100034137
410 Ga0070663_100216176
411 Ga0070662_100005063
412 Ga0070681_10057937
413 Ga0068853_100008444
414 Ga0068853_100105449
415 Ga0068853_100242492
416 Ga0070696_100001818
417 Ga0070696_100079642
418 Ga0070665_100000807
419 Ga0070665_100204956
420 Ga0068855_100139780
421 Ga0068855_100193738
422 Ga0070664_100090511
423 Ga0068857_100143140
424 Ga0068856_100021372
425 Ga0068856_100059372
426 Ga0068852_100021115
427 Ga0068852_100290504
428 Ga0068859_100678900
429 Ga0068851_10000362
430 Ga0068851_10053980
431 Ga0068863_100102515
432 Ga0068858_100001486
433 Ga0068858_100097992
434 Ga0068860_100044570
435 Ga0075364_10095979
436 Ga0097621_100007117
437 Ga0068871_100012012
438 Ga0068865_100003233
439 Ga0068865_100064714
440 Ga0097620_100678787
441 Ga0079104_1000511
442 Ga0079104_1001983
443 Ga0079104_1002803
444 Ga0099795_10000820
445 Ga0105251_10000228
446 Ga0105251_10001338
447 Ga0105251_10002657
448 Ga0105251_10015108
449 Ga0105251_10039376
450 Ga0105244_10000024
451 Ga0105244_10000048
452 Ga0105244_10001565
453 Ga0105244_10012857
454 Ga0105244_10016607
455 Ga0105244_10036669
456 Ga0105244_10123298
457 Ga0105244_10138995
458 Ga0105250_10000003
459 Ga0105250_10000025
460 Ga0105250_10000044
461 Ga0105250_10002491
462 Ga0105250_10016241
463 Ga0105250_10123441
464 Ga0105240_10000617
465 Ga0105240_10058039
466 Ga0105240_10122593
467 Ga0105240_10238478
468 Ga0105245_10193266
469 Ga0105247_10000018
470 Ga0105243_10173599
471 Ga0105241_10000004
472 Ga0105241_10030972
473 Ga0105241_10556734
474 Ga0105242_10001890
475 Ga0105242_10199138
476 Ga0105248_10197838
477 Ga0105238_10009940
478 Ga0105249_10004564
479 Ga0099796_10006282
480 Ga0105239_10062343
481 Ga0105239_10492348
482 Ga0105246_10021080
483 Ga0105246_10385671
484 Ga0157373_10000104
485 Ga0157373_10010360
486 Ga0157371_10000007
487 Ga0157371_10057469
488 Ga0157371_10079762
489 Ga0157371_10138553
490 Ga0157370_10001101
491 Ga0157370_10128434
492 Ga0157369_10000983
493 Ga0157369_10001364
494 Ga0157369_10017667
495 Ga0157369_10522464
496 Ga0157374_10302135
497 Ga0157378_10000130
498 Ga0157378_10365381
499 Ga0163162_10121342
500 Ga0163162_10339848
501 Ga0157372_10022705
502 Ga0157372_10191088
503 Ga0157372_10313059
504 Ga0157372_10390167
505 Ga0157372_10536039
506 Ga0157375_10000256
507 Ga0182008_10003644
508 Ga0157376_10056003
509 Ga0163161_10000004
510 Ga0213876_10000176
511 Ga0209760_100057
512 Ga0209784_100001
513 Ga0209566_100001
514 Ga0209674_100002
515 Ga0209563_100008
516 Ga0207427_100002
517 Ga0209437_100007
518 Ga0207425_1013847
519 Ga0209677_100004
520 Ga0209129_1000015
521 Ga0209233_1003856
522 Ga0207656_10002243
523 Ga0207656_10189332
524 Ga0207696_1000003
525 Ga0207696_1000004
526 Ga0207696_1000007
527 Ga0207696_1000033
528 Ga0207696_1000192
529 Ga0207696_1000408
530 Ga0207655_1000011
531 Ga0207655_1000023
532 Ga0207655_1000029
533 Ga0207655_1000042
534 Ga0207655_1000206
535 Ga0207655_1000621
536 Ga0207655_1038164
537 Ga0207713_1000021
538 Ga0207713_1000101
539 Ga0207713_1000133
540 Ga0207713_1001385
541 Ga0207713_1077377
542 Ga0207710_10000016
543 Ga0207680_10000258
544 Ga0207647_10000023
545 Ga0207647_10176261
546 Ga0207645_10077414
547 Ga0207654_10000006
548 Ga0207654_10026699
549 Ga0207695_10000032
550 Ga0207695_10023289
551 Ga0207695_10066931
552 Ga0207695_10105112
553 Ga0207695_10180631
554 Ga0207671_10102696
555 Ga0207663_10169448
556 Ga0207657_10020912
557 Ga0207649_10073183
558 Ga0207649_10100628
559 Ga0207694_10003116
560 Ga0207694_10004607
561 Ga0207650_10005523
562 Ga0207687_10268082
563 Ga0207644_10270370
564 Ga0207706_10017276
565 Ga0207686_10006050
566 Ga0207704_10010462
567 Ga0207704_10045575
568 Ga0207665_10086173
569 Ga0207679_10559525
570 Ga0207667_10042295
571 Ga0207667_10081340
572 Ga0207667_10172066
573 Ga0207712_10000497
574 Ga0207640_10167585
575 Ga0207658_10051139
576 Ga0207658_10518641
577 Ga0207677_10207185
578 Ga0207703_10002654
579 Ga0207639_10000190
580 Ga0207639_10001379
581 Ga0207639_10022886
582 Ga0207639_10231734
583 Ga0207678_10006419
584 Ga0207678_10118885
585 Ga0207702_10032081
586 Ga0207702_10872316
587 Ga0207641_10136637
588 Ga0207641_10248471
589 Ga0207674_10004880
590 Ga0207674_10205749
591 Ga0209281_1000008
592 Ga0209281_1000041
593 Ga0209281_1017976
594 Ga0209371_1000010
595 Ga0209371_1000026
596 Ga0209371_1000146
597 Ga0209371_1002140
598 Ga0209371_1002953
599 Ga0209371_1034672
600 Ga0209371_1042454
601 Ga0265354_1005775
602 Ga0265357_1001801
603 Ga0268266_10000013
604 Ga0268265_10068938
605 Ga0268264_10133276
606 Ga0268256_1000003
607 Ga0268256_1000117
608 Ga0268256_1002655
609 Ga0268256_1003828
610 Ga0268256_1032960
611 Ga0268256_1039360
612 Ga0268256_1050254
613 Ga0268256_1050262
614 Ga0265770_1002128
615 Ga0307516_10004733
616 Ga0316593_10011987
617 Ga0316593_10069876
618 Ga0307510_10132958
619 Ga0373923_0254673
620 Ga0373954_0223807
621 Ga0373955_0096948
622 Ga0316584_0040558
623 Ga0436365_0571044
624 Ga0439438_000001
625 Ga0439447_005018
626 Ga0439432_000740
627 Ga0439432_002843
628 Ga0439432_009589
629 Ga0439452_000027
630 Ga0439452_000033
631 Ga0495617_006839
632 Ga0495627_000145
633 Ga0495627_088308
634 Ga0495591_000301
635 Ga0495650_0000016
636 Ga0495650_0110494
637 Ga0495639_0229785
638 Ga0495632_0076836
639 Ga0495652_0483550
640 Ga0495654_0002277
641 Ga0495658_0190759
642 Ga0495589_0000006
643 Ga0495660_0000007
644 Ga0495681_0007032
645 Ga0496101_0000029
646 Ga0496103_0058891
647 Ga0496104_0008700
648 Ga0496104_0030321
649 Ga0496105_0000014
650 Ga0496107_0362549
651 Ga0496114_0040199
652 Ga0496115_0005522
653 Ga0496116_0000031
654 Ga0496116_0000054
655 Ga0496116_0000505
656 Ga0496116_0009874
657 Ga0496116_0033288
658 Ga0496116_0111366
659 Ga0496117_0003341
660 Ga0496117_0012152
661 Ga0496117_0052951
662 Ga0496118_0001321
663 Ga0496118_0042574
664 Ga0496118_0055891
665 Ga0496118_0150213
666 Ga0496118_0151389
667 Ga0496119_0000045
668 Ga0496119_0014780
669 Ga0496119_0018488
670 Ga0496119_0061553
671 Ga0496119_0075399
672 Ga0496119_0092125
673 Ga0496120_0000374
674 Ga0496120_0000429
675 Ga0496120_0000760
676 Ga0496120_0002810
677 Ga0496120_0007944
678 Ga0496120_0016246
679 Ga0496122_0000013
680 Ga0496122_0018334
681 Ga0496122_0024887
682 Ga0496122_0058305
683 Ga0496122_0186807
684 Ga0496123_0000010
685 Ga0496123_0000152
686 Ga0496123_0003920
687 Ga0496123_0037777
688 Ga0496124_0000010
689 Ga0496124_0000039
690 Ga0496124_0000322
691 Ga0496124_0001225
692 Ga0496124_0002999
693 Ga0496124_0145379
694 Ga0496124_0372201
695 Ga0496125_0000016
696 Ga0496125_0000019
697 Ga0496125_0019973
698 Ga0496126_0000252
699 Ga0496126_0035008
700 Ga0501033_0323626
701 Ga0501034_0704017
702 Ga0501035_0202567
703 2506577139
704 2506582277
705 2508851106
706 2547694274
707 2562466346
708 2585826794
709 2585831280
710 2599411937
711 2601525115
712 2601530302
713 2601617094
714 2601621559
715 2601650717
716 2601654883
717 2601660450
718 2601708298
719 2601713391
720 2601718442
721 2601728325
722 2601733390
723 2601738309
724 2601742433
725 2601753647
726 2602019966
727 2603700116
728 2603840501
729 2603845836
730 2603850909
731 2603855718
732 2603873300
733 2606050738
734 2606148422
735 2606178369
736 2609914331
737 2637226683
738 2656275881
739 2671108373
740 2676407164
741 2689443539
742 2712470569
743 2772437679
744 2792312137
745 2807177255
746 2844426509
747 2846543166
748 2852103578
749 2869552958
750 2888367669
751 2888374630
752 2904474955
753 2904505604
754 2904514949
755 2908671201
756 2919151301
757 2927146175
758 2932407308
759 2935629357
760 2937969459
761 2939574833
762 2939579218
763 2945879270
764 2969083666
765 2974437431
766 2984560767
767 2984598843
768 3000380101
769 640936684
770 8004594381
771 8015398967
772 8016736850

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

26

224

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pib-assembly1.cif.gz_A structure of the klebsiella pneumoniae lpxh-az1 complex 0.9815 3 240
6ph9-assembly1.cif.gz_A crystal structure of the klebsiella pneumoniae lpxh-lipid x complex 0.9787 1 240
6pj3-assembly1.cif.gz_A crystal structure of the klebsiella pneumoniae lpxh/jh-lph-33 complex 0.976 4 241
5b49-assembly1.cif.gz_A crystal structure of lpxh with manganese from pseudomonas aeruginosa 0.9752 4 241
7ss7-assembly1.cif.gz_A crystal structure of klebsiella lpxh in complex with jh-lph-50 0.9743 4 240
ID Description Score Start End Superfamily
af_P43341_2_237_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9892 4 237 2.40.10.10
af_P43341_2_237_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9767 4 237 2.40.10.10
af_A0A2R8QAT2_122_259_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.7298 19 95 3.30.870.10
4ry9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6944 24 79 3.40.50.2300
af_K7LEE1_82_225_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6858 6 114 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A4U9D9A1-F1-model_v4 UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) 1.003 4 81 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A6L7A0X8-F1-model_v4 UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54) 0.9994 4 96 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A377M829-F1-model_v4 UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (UDP-2,3-diacylglucosamine diphosphatase) 0.9986 4 188 GO:0005737
GO:0008758
GO:0009245
GO:0019897
GO:0030145
AF-A0A844W8M1-F1-model_v4 deleted 0.9969 4 141
AF-A0A2W6PCZ8-F1-model_v4 UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54) 0.9961 4 120 GO:0005737
GO:0005886
GO:0008758
GO:0009245
GO:0046872

Map