F430649

General Info

Members Datasets Scaffolds Average Seq Length
386 245 367 145

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0706472|Ga0501034_0706472_317_823
Length 168
Sequence MYETNGSCIYYSEDIKVSVERTFVAIKPDGVERGIIGEVIKRFESRGLKLVGMKLMKLSNEKAQEHYGEHKGKPFFDGLVSFITAGPIVAMVWEGKGAIALCRSTIGATNPAQAAPGTIRGDLAVEIGRNVVHGSDGPESAKREIGIFFSESEVCAEWPRAVDKWVSE

Samples

Sample ID Description Type Environment
1 2643221731 Bacillus sp. Root147 Isolate Unclassified
2 2643221732 Bacillus sp. Root239 Isolate Unclassified
3 2738543010 Bacillus sp. YR335 Isolate Unclassified
4 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
5 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
6 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
7 2842882022 Bacillus sp. R-71893 Isolate Unclassified
8 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
9 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
10 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
11 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
12 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
13 2919720352 Priestia megaterium 4340 Isolate Unclassified
14 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
15 2929004312 Priestia megaterium 1104 Isolate Unclassified
16 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
17 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005870 Rhizosphere microbial communities from Harvard Forest, USA - 4Rhizosphere_NRpos metaG Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027200 Rhizosphere microbial communities from Harvard Forest, USA - 4Rhizosphere_NRpos metaG (SPAdes) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
147 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
148 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
149 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
159 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
211 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
222 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
223 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
224 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
225 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
226 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
227 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
228 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
229 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
230 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
238 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
239 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
243 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
244 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
245 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.53
Metatranscriptomes 8.29
Isolates 5.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.07
Nodule 0
Rhizoplane 5.44
Rhizosphere 76.42
Stem 0
Stem Tuber 0
Unclassified 9.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10163444 3300001989 Bacteria 657
2 JGI25159J45721_1003968 3300002987 Bacteria 5046
3 JGI25151J46595_10000029 3300003187 Bacteria 205878
4 JGI25151J46595_10002501 3300003187 Bacteria 10966
5 JGI25151J46595_10006830 3300003187 Bacteria 5674
6 JGI25151J46595_10023947 3300003187 Bacteria 2505
7 rootH1_10007388 3300003316 Bacteria 18072
8 rootH1_10007388 3300003323 Bacteria 2766
9 rootL2_10011855 3300003322 Bacteria 17608
10 rootH1_10379440 3300003323 Bacteria 1410
11 Ga0006562J51391_1000749 3300003578 Bacteria 4871
12 Ga0006562J51391_1002561 3300003578 Bacteria 554
13 Ga0055538_1000127 3300003751 Bacteria 57318
14 Ga0055532_1002522 3300003758 Bacteria 3727
15 Ga0055536_1016506 3300003781 Bacteria 2466
16 Ga0055536_1066245 3300003781 Bacteria 729
17 Ga0055528_1001271 3300003790 Bacteria 15888
18 Ga0070658_10000768 3300005327 Bacteria 27548
19 Ga0070658_10359673 3300005327 Bacteria 1246
20 Ga0070683_100060745 3300005329 Bacteria 3513
21 Ga0070680_100006006 3300005336 Bacteria 9210
22 Ga0070680_100188141 3300005336 Bacteria 1739
23 Ga0070680_100454196 3300005336 Bacteria 1094
24 Ga0070682_100048968 3300005337 Bacteria 2633
25 Ga0070660_100000957 3300005339 Bacteria 19306
26 Ga0070660_100129247 3300005339 Bacteria 2020
27 Ga0070660_100149665 3300005339 Bacteria 1876
28 Ga0070661_100039308 3300005344 Bacteria 3447
29 Ga0070661_100143234 3300005344 Bacteria 1802
30 Ga0070669_100147446 3300005353 Bacteria 1819
31 Ga0070671_100012315 3300005355 Bacteria 6887
32 Ga0070659_100019943 3300005366 Bacteria 5089
33 Ga0070659_100264204 3300005366 Bacteria 1428
34 Ga0070659_100327554 3300005366 Bacteria 1281
35 Ga0070714_100017733 3300005435 Bacteria 5772
36 Ga0070710_10480291 3300005437 Bacteria 847
37 Ga0070663_100967234 3300005455 Bacteria 739
38 Ga0070681_10001709 3300005458 Bacteria 19668
39 Ga0070681_10123623 3300005458 Bacteria 2520
40 Ga0070681_10442569 3300005458 Bacteria 1211
41 Ga0070706_100004009 3300005467 Bacteria 14313
42 Ga0070707_100032041 3300005468 Bacteria 5007
43 Ga0070698_100465820 3300005471 Unclassified 1200
44 Ga0070679_100050108 3300005530 Bacteria 4160
45 Ga0070679_100084727 3300005530 Bacteria 3157
46 Ga0070679_101123892 3300005530 Bacteria 730
47 Ga0070684_100294867 3300005535 Bacteria 1487
48 Ga0070697_100205209 3300005536 Unclassified 1676
49 Ga0068853_100462061 3300005539 Bacteria 1195
50 Ga0068853_100984846 3300005539 Bacteria 811
51 Ga0068853_101184854 3300005539 Unclassified 737
52 Ga0070672_100206193 3300005543 Bacteria 1645
53 Ga0070696_100030167 3300005546 Bacteria 3712
54 Ga0070665_100037861 3300005548 Bacteria 4848
55 Ga0068855_100014486 3300005563 Bacteria 9496
56 Ga0068855_100034072 3300005563 Bacteria 6075
57 Ga0068855_100038766 3300005563 Bacteria 5660
58 Ga0068855_100112316 3300005563 Bacteria 3127
59 Ga0068855_100154780 3300005563 Unclassified 2605
60 Ga0068855_100159271 3300005563 Bacteria 2563
61 Ga0068855_100347354 3300005563 Bacteria 1635
62 Ga0068857_101240139 3300005577 Bacteria 723
63 Ga0068854_100158411 3300005578 Bacteria 1751
64 Ga0068854_101325782 3300005578 Bacteria 649
65 Ga0068856_100090745 3300005614 Bacteria 3039
66 Ga0068856_100398064 3300005614 Bacteria 1397
67 Ga0068852_100638178 3300005616 Bacteria 1072
68 Ga0068864_100580171 3300005618 Bacteria 1086
69 Ga0068858_100210621 3300005842 Unclassified 1839
70 Ga0058723_100006 3300005870 Bacteria 1405
71 Ga0081538_10150078 3300005981 Bacteria 1057
72 Ga0075365_10344640 3300006038 Bacteria 1050
73 Ga0075364_10402672 3300006051 Bacteria 934
74 Ga0070716_100155571 3300006173 Bacteria 1476
75 Ga0070716_100884764 3300006173 Bacteria 698
76 Ga0075434_100751405 3300006871 Bacteria 992
77 Ga0105250_10218291 3300009092 Bacteria 808
78 Ga0105240_10235369 3300009093 Bacteria 2126
79 Ga0105245_10123285 3300009098 Bacteria 2423
80 Ga0105245_10184615 3300009098 Unclassified 1995
81 Ga0105247_10030560 3300009101 Bacteria 3265
82 Ga0114129_10048193 3300009147 Bacteria 5987
83 Ga0105243_10001152 3300009148 Bacteria 23970
84 Ga0105243_10088281 3300009148 Bacteria 2547
85 Ga0105242_10008612 3300009176 Bacteria 7833
86 Ga0105237_11090713 3300009545 Bacteria 805
87 Ga0105238_10013046 3300009551 Bacteria 8386
88 Ga0105238_10562515 3300009551 Bacteria 1145
89 Ga0105238_10681473 3300009551 Bacteria 1039
90 Ga0105239_10338308 3300010375 Unclassified 1698
91 Ga0105239_10390365 3300010375 Bacteria 1574
92 Ga0105239_12581170 3300010375 Bacteria 592
93 Ga0105246_10003765 3300011119 Bacteria 9194
94 Ga0105246_10063807 3300011119 Bacteria 2571
95 Ga0105246_10365559 3300011119 Bacteria 1187
96 Ga0157370_10060718 3300013104 Bacteria 3588
97 Ga0157370_10143597 3300013104 Bacteria 2223
98 Ga0157370_11430489 3300013104 Bacteria 622
99 Ga0157374_10000361 3300013296 Bacteria 42139
100 Ga0157374_10121911 3300013296 Bacteria 2517
101 Ga0157378_10103206 3300013297 Bacteria 2605
102 Ga0157378_12015021 3300013297 Unclassified 627
103 Ga0157372_10084636 3300013307 Bacteria 3595
104 Ga0157372_10405115 3300013307 Bacteria 1589
105 Ga0157372_10529776 3300013307 Bacteria 1373
106 Ga0157377_10012664 3300014745 Bacteria 4246
107 Ga0157376_10064277 3300014969 Bacteria 3094
108 Ga0157376_10107145 3300014969 Bacteria 2453
109 Ga0182006_1196672 3300015261 Bacteria 669
110 Ga0206353_11144751 3300020082 Bacteria 730
111 Ga0206353_11420495 3300020082 Bacteria 786
112 Ga0224712_10143103 3300022467 Bacteria 1054
113 Ga0209784_100031 3300025224 Bacteria 318854
114 Ga0209147_100042 3300025229 Bacteria 301263
115 Ga0209147_100461 3300025229 Bacteria 25155
116 Ga0209130_1026704 3300025284 Bacteria 1235
117 Ga0209675_1018472 3300025291 Bacteria 1950
118 Ga0209676_1067869 3300025292 Bacteria 859
119 Ga0209025_1000001 3300025294 Bacteria 1888151
120 Ga0209025_1002108 3300025294 Bacteria 22452
121 Ga0209025_1002373 3300025294 Bacteria 20153
122 Ga0209025_1004501 3300025294 Bacteria 12052
123 Ga0209025_1008060 3300025294 Bacteria 7670
124 Ga0209025_1010217 3300025294 Bacteria 6397
125 Ga0209025_1014494 3300025294 Bacteria 4841
126 Ga0209025_1021181 3300025294 Bacteria 3514
127 Ga0209025_1023160 3300025294 Bacteria 3258
128 Ga0209025_1071717 3300025294 Bacteria 1226
129 Ga0209256_1053335 3300025299 Bacteria 968
130 Ga0207426_1018427 3300025302 Bacteria 2459
131 Ga0207656_10040908 3300025321 Bacteria 1967
132 Ga0207696_1014913 3300025711 Bacteria 2648
133 Ga0207696_1022613 3300025711 Bacteria 1995
134 Ga0207655_1000925 3300025728 Bacteria 30529
135 Ga0207710_10041371 3300025900 Bacteria 2044
136 Ga0207705_10000226 3300025909 Bacteria 56086
137 Ga0207705_10120254 3300025909 Bacteria 1948
138 Ga0207684_10030148 3300025910 Unclassified 4619
139 Ga0207707_10003296 3300025912 Bacteria 14347
140 Ga0207707_10013337 3300025912 Bacteria 7163
141 Ga0207707_10268865 3300025912 Bacteria 1478
142 Ga0207707_10314724 3300025912 Bacteria 1352
143 Ga0207707_10592085 3300025912 Bacteria 939
144 Ga0207695_10187600 3300025913 Bacteria 1986
145 Ga0207671_10000283 3300025914 Bacteria 75047
146 Ga0207660_10034137 3300025917 Bacteria 3524
147 Ga0207660_10067374 3300025917 Bacteria 2593
148 Ga0207660_10165439 3300025917 Bacteria 1709
149 Ga0207657_10007423 3300025919 Bacteria 11245
150 Ga0207657_10019347 3300025919 Bacteria 6470
151 Ga0207649_10052165 3300025920 Bacteria 2536
152 Ga0207649_10101973 3300025920 Bacteria 1901
153 Ga0207649_10335309 3300025920 Bacteria 1115
154 Ga0207652_10055181 3300025921 Bacteria 3416
155 Ga0207652_10088045 3300025921 Bacteria 2724
156 Ga0207652_10219033 3300025921 Bacteria 1715
157 Ga0207646_10009663 3300025922 Bacteria 9514
158 Ga0207646_10012025 3300025922 Bacteria 8340
159 Ga0207646_11061767 3300025922 Bacteria 714
160 Ga0207694_10058853 3300025924 Bacteria 2988
161 Ga0207694_10360443 3300025924 Bacteria 1205
162 Ga0207694_10959793 3300025924 Bacteria 723
163 Ga0207650_10485897 3300025925 Bacteria 1031
164 Ga0207659_10170839 3300025926 Bacteria 1715
165 Ga0207687_10097418 3300025927 Bacteria 2157
166 Ga0207687_10329927 3300025927 Bacteria 1237
167 Ga0207664_10117228 3300025929 Bacteria 2223
168 Ga0207644_10947367 3300025931 Bacteria 722
169 Ga0207690_10019715 3300025932 Bacteria 4157
170 Ga0207690_10063941 3300025932 Bacteria 2511
171 Ga0207686_10194332 3300025934 Bacteria 1449
172 Ga0207665_10018174 3300025939 Bacteria 4620
173 Ga0207691_10247473 3300025940 Bacteria 1540
174 Ga0207689_10898688 3300025942 Bacteria 747
175 Ga0207661_10367901 3300025944 Bacteria 1299
176 Ga0207661_10497749 3300025944 Bacteria 1113
177 Ga0207661_10795999 3300025944 Bacteria 870
178 Ga0207667_10002942 3300025949 Bacteria 21144
179 Ga0207667_10025902 3300025949 Bacteria 6416
180 Ga0207667_10078761 3300025949 Bacteria 3415
181 Ga0207667_10109009 3300025949 Bacteria 2856
182 Ga0207667_10110195 3300025949 Bacteria 2840
183 Ga0207667_10253329 3300025949 Bacteria 1801
184 Ga0207640_10073660 3300025981 Bacteria 2308
185 Ga0207640_10711910 3300025981 Bacteria 862
186 Ga0207639_10238526 3300026041 Bacteria 1580
187 Ga0207639_10417626 3300026041 Bacteria 1212
188 Ga0207639_10860727 3300026041 Unclassified 846
189 Ga0207639_10915522 3300026041 Bacteria 820
190 Ga0207678_10174509 3300026067 Bacteria 1835
191 Ga0207678_10287413 3300026067 Bacteria 1412
192 Ga0207702_10039635 3300026078 Bacteria 3949
193 Ga0207702_10621696 3300026078 Bacteria 1061
194 Ga0207674_10162128 3300026116 Bacteria 2190
195 Ga0207674_11458507 3300026116 Bacteria 653
196 Ga0207675_101523811 3300026118 Bacteria 689
197 Ga0207698_10089195 3300026142 Bacteria 2518
198 Ga0207698_10473626 3300026142 Bacteria 1213
199 Ga0208976_10010 3300027200 Bacteria 1405
200 Ga0268266_10013509 3300028379 Bacteria 7030
201 Ga0237817_10548 3300030083 Bacteria 4421
202 Ga0265339_10439716 3300031249 Bacteria 606
203 Ga0307408_100003810 3300031548 Bacteria 10270
204 Ga0307408_100724533 3300031548 Bacteria 896
205 Ga0316579_10147578 3300031691 Unclassified 1134
206 Ga0265314_10027244 3300031711 Bacteria 4282
207 Ga0316576_10165543 3300031727 Bacteria 1668
208 Ga0316576_10223119 3300031727 Bacteria 1417
209 Ga0316576_10815435 3300031727 Unclassified 671
210 Ga0316578_10025412 3300031728 Unclassified 3330
211 Ga0316578_10056337 3300031728 Bacteria 2308
212 Ga0316578_10132239 3300031728 Bacteria 1501
213 Ga0316578_10215267 3300031728 Bacteria 1155
214 Ga0307405_10068016 3300031731 Bacteria 2278
215 Ga0316577_10156808 3300031733 Bacteria 1284
216 Ga0316577_10176688 3300031733 Bacteria 1205
217 Ga0307410_10833130 3300031852 Bacteria 786
218 Ga0307406_10133245 3300031901 Bacteria 1748
219 Ga0307412_10466423 3300031911 Bacteria 1044
220 Ga0307409_100096764 3300031995 Bacteria 2436
221 Ga0307416_100039389 3300032002 Bacteria 3658
222 Ga0307416_100055925 3300032002 Bacteria 3180
223 Ga0307416_101244582 3300032002 Bacteria 850
224 Ga0307416_103194691 3300032002 Bacteria 548
225 Ga0307414_10521510 3300032004 Bacteria 1055
226 Ga0307411_10072473 3300032005 Bacteria 2339
227 Ga0307415_101117062 3300032126 Bacteria 739
228 Ga0316583_10008335 3300032133 Bacteria 3738
229 Ga0316585_10000258 3300032137 Bacteria 11420
230 Ga0316585_10031360 3300032137 Unclassified 1671
231 Ga0316585_10092714 3300032137 Bacteria 988
232 Ga0316580_10043107 3300032139 Unclassified 1392
233 Ga0316593_10268807 3300032168 Bacteria 641
234 Ga0316592_1002695 3300033524 Unclassified 3100
235 Ga0316592_1018182 3300033524 Unclassified 1479
236 Ga0316588_1102871 3300033528 Unclassified 716
237 Ga0316587_1029472 3300033529 Unclassified 965
238 Ga0316596_1016211 3300033541 Bacteria 1865
239 Ga0316596_1046354 3300033541 Unclassified 1148
240 Ga0316574_0000628 3300035398 Bacteria 14749
241 Ga0316574_0134026 3300035398 Bacteria 1595
242 Ga0316574_0148178 3300035398 Bacteria 1512
243 Ga0316582_0119718 3300036647 Bacteria 1760
244 Ga0316582_0124528 3300036647 Bacteria 1727
245 Ga0316582_0208812 3300036647 Unclassified 1334
246 Ga0316582_0598617 3300036647 Bacteria 759
247 Ga0316584_0003697 3300036712 Bacteria 10010
248 Ga0316584_0060951 3300036712 Unclassified 2826
249 Ga0316584_0343176 3300036712 Bacteria 1073
250 Ga0316584_0504452 3300036712 Unclassified 850
251 Ga0316584_0705029 3300036712 Unclassified 692
252 Ga0395898_0675683 3300037466 Bacteria 975
253 Ga0316581_0036351 3300037588 Bacteria 1494
254 Ga0237819_01018 3300038705 Bacteria 8416
255 Ga0436365_0308036 3300039437 Bacteria 789
256 Ga0436362_0509156 3300039453 Unclassified 1551
257 Ga0436362_1257599 3300039453 Unclassified 1722
258 Ga0451807_1587770 3300041486 Bacteria 914
259 Ga0439449_0040890 3300042007 Bacteria 1723
260 Ga0439462_0007996 3300042015 Bacteria 2660
261 Ga0450898_022062 3300042134 Bacteria 1125
262 Ga0453683_0124781 3300044673 Bacteria 1621
263 Ga0453683_0617121 3300044673 Bacteria 708
264 Ga0466966_0019372 3300044684 Unclassified 4476
265 Ga0466963_0581864 3300044694 Unclassified 791
266 Ga0466964_0006762 3300044706 Bacteria 4274
267 Ga0453684_0136502 3300044712 Archaea 2936
268 Ga0453684_0174692 3300044712 Archaea 2528
269 Ga0453684_0724927 3300044712 Bacteria 1078
270 Ga0466970_0066516 3300044765 Bacteria 1935
271 Ga0466957_0055599 3300044842 Unclassified 2419
272 Ga0466959_0000394 3300045049 Bacteria 25591
273 Ga0466959_0748907 3300045049 Unclassified 654
274 Ga0466959_0749591 3300045049 Unclassified 654
275 Ga0466958_0002478 3300045836 Bacteria 9290
276 Ga0466958_0233504 3300045836 Bacteria 1175
277 Ga0466967_0001012 3300045976 Bacteria 15385
278 Ga0466967_0071330 3300045976 Bacteria 3110
279 Ga0466967_0113123 3300045976 Bacteria 2496
280 Ga0495603_0390666 3300046455 Bacteria 797
281 Ga0495584_0004195 3300046491 Bacteria 7777
282 Ga0495585_0069114 3300046492 Bacteria 1928
283 Ga0495597_0206615 3300046542 Bacteria 785
284 Ga0495633_0076427 3300046558 Bacteria 1559
285 Ga0495683_0006067 3300047323 Bacteria 6632
286 Ga0496100_0132286 3300048903 Bacteria 1758
287 Ga0496101_0002658 3300048904 Bacteria 10972
288 Ga0496102_0010878 3300048905 Bacteria 7833
289 Ga0496102_0083265 3300048905 Bacteria 2952
290 Ga0496102_1282561 3300048905 Bacteria 652
291 Ga0496103_0010375 3300048906 Bacteria 5512
292 Ga0496103_0054677 3300048906 Bacteria 2475
293 Ga0496103_0584490 3300048906 Bacteria 712
294 Ga0496104_0007537 3300048907 Bacteria 9622
295 Ga0496105_0010584 3300048908 Bacteria 7256
296 Ga0496106_0000397 3300048909 Bacteria 31022
297 Ga0496107_0000728 3300048910 Bacteria 18805
298 Ga0496107_0879457 3300048910 Bacteria 654
299 Ga0496108_0002795 3300048911 Bacteria 13987
300 Ga0496109_0007870 3300048912 Bacteria 9033
301 Ga0496110_0000689 3300048913 Bacteria 23271
302 Ga0496110_0003407 3300048913 Bacteria 12162
303 Ga0496111_0007764 3300048914 Bacteria 7061
304 Ga0496112_0067089 3300048915 Bacteria 3540
305 Ga0496115_0938479 3300048918 Bacteria 665
306 Ga0496116_0009467 3300048919 Bacteria 8298
307 Ga0496116_0449794 3300048919 Bacteria 552
308 Ga0496118_0194143 3300048921 Bacteria 1210
309 Ga0496119_0103380 3300048922 Bacteria 1595
310 Ga0496120_0165989 3300048923 Bacteria 1096
311 Ga0496121_0104160 3300048924 Bacteria 2181
312 Ga0496122_0004478 3300048925 Bacteria 17283
313 Ga0496122_0052253 3300048925 Bacteria 3095
314 Ga0496123_0095135 3300048926 Bacteria 1753
315 Ga0496125_0004427 3300048928 Bacteria 16219
316 Ga0496126_0007422 3300048929 Bacteria 12026
317 Ga0496126_0749810 3300048929 Bacteria 754
318 Ga0496126_1274520 3300048929 Bacteria 537
319 Ga0501306_045198 3300049127 Bacteria 693
320 Ga0501309_065963 3300049129 Bacteria 589
321 Ga0501343_007204 3300049132 Bacteria 876
322 Ga0501305_020107 3300049161 Bacteria 979
323 Ga0501305_024187 3300049161 Bacteria 914
324 Ga0501305_051583 3300049161 Bacteria 691
325 Ga0501307_076250 3300049162 Bacteria 541
326 Ga0501295_064255 3300049518 Bacteria 809
327 Ga0501312_024568 3300049528 Bacteria 914
328 Ga0501312_125346 3300049528 Bacteria 500
329 Ga0501313_000159 3300049529 Bacteria 3679
330 Ga0501313_037455 3300049529 Bacteria 644
331 Ga0501315_006104 3300049531 Bacteria 1330
332 Ga0501315_017223 3300049531 Bacteria 942
333 Ga0501316_001105 3300049532 Bacteria 2185
334 Ga0501316_015596 3300049532 Bacteria 916
335 Ga0501317_000311 3300049533 Bacteria 3208
336 Ga0501323_084459 3300049539 Bacteria 523
337 Ga0501323_094686 3300049539 Bacteria 501
338 Ga0501335_011530 3300049551 Bacteria 865
339 Ga0501034_0126490 3300049571 Unclassified 2540
340 Ga0501034_0706472 3300049571 Bacteria 906
341 Ga0501039_0914049 3300049575 Bacteria 683
342 Ga0501070_0694047 3300049586 Bacteria 805
343 Ga0501199_004430 3300049650 Bacteria 1383
344 Ga0501206_071811 3300049653 Bacteria 587
345 Ga0501217_008256 3300049661 Bacteria 2245
346 Ga0501217_095085 3300049661 Bacteria 841
347 Ga0501233_010432 3300049668 Bacteria 1830
348 Ga0501243_077161 3300049675 Bacteria 642
349 Ga0501255_064041 3300049684 Bacteria 589
350 Ga0501257_062620 3300049686 Bacteria 942
351 Ga0501234_047737 3300049707 Bacteria 709
352 Ga0501245_002201 3300049708 Bacteria 2592
353 Ga0501263_015861 3300049760 Bacteria 976
354 nmdc:mga00v17_633289_c1 3300050491 Bacteria 688
355 nmdc:mga0yw44_1241559_c1 3300050492 Bacteria 502
356 nmdc:mga05p37_198141_c1 3300050507 Unclassified 2434
357 nmdc:mga05p37_368497_c1 3300050507 Bacteria 1686
358 nmdc:mga06r32_1350738_c1 3300050510 Unclassified 655
359 nmdc:mga0n895_1189544_c1 3300050512 Bacteria 737
360 nmdc:mga0a205_1214974_c1 3300050515 Unclassified 601
361 nmdc:mga0a205_793637_c1 3300050515 Bacteria 795
362 Ga0495655_0204392 3300053083 Bacteria 647
363 Ga0500556_0000285 3300053104 Bacteria 39622
364 Ga0500562_020152 3300053108 Bacteria 1731
365 Ga0500616_0010299 3300053153 Bacteria 5603
366 Ga0587084_096475 3300059477 Bacteria 594
367 Ga0530510_0154306 3300061734 Bacteria 1696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033529 Ga0316587_1029472 Ga0316587_10294721 121
2 3300009098 Ga0105245_10184615 Ga0105245_101846153 128
3 3300013297 Ga0157378_12015021 Ga0157378_120150211 128
4 3300025913 Ga0207695_10187600 Ga0207695_101876001 128
5 3300044673 Ga0453683_0124781 Ga0453683_0124781_273_701 128
6 3300044673 Ga0453683_0617121 Ga0453683_0617121_77_475 128
7 3300009147 Ga0114129_10048193 Ga0114129_100481932 129
8 3300009148 Ga0105243_10088281 Ga0105243_100882812 129
9 3300044712 Ga0453684_0724927 Ga0453684_0724927_591_1028 129
10 3300050507 nmdc:mga05p37_198141_c1 nmdc:mga05p37_198141_c1_478_915 129
11 3300050510 nmdc:mga06r32_1350738_c1 nmdc:mga06r32_1350738_c1_50_487 129
12 3300050515 nmdc:mga0a205_1214974_c1 nmdc:mga0a205_1214974_c1_114_551 129
13 iso_pu_bacteria 2738543010 2739230502 130
14 iso_pu_bacteria 2643221731 2644715986 131
15 iso_pu_bacteria 2643221732 2644724144 131
16 iso_pu_bacteria 2818991465 2819709458 131
17 iso_pu_bacteria 2842882022 2842884291 131
18 iso_pu_bacteria 2904524088 2904524680 131
19 iso_pu_bacteria 2919143609 2919146724 131
20 iso_pu_bacteria 2919517244 2919518647 131
21 iso_pu_bacteria 2919720352 2919723015 131
22 iso_pu_bacteria 2928093941 2928096458 131
23 iso_pu_bacteria 2929004312 2929006167 131
24 iso_pu_bacteria 2960319331 2960320638 131
25 iso_pu_bacteria 2960375949 2960380710 131
26 iso_pu_bacteria 8022893055 8022897963 131
27 iso_pu_bacteria 8022914991 8022917146 131
28 3300026142 Ga0207698_10473626 Ga0207698_104736261 132
29 3300031548 Ga0307408_100724533 Ga0307408_1007245331 132
30 3300031731 Ga0307405_10068016 Ga0307405_100680164 132
31 3300031852 Ga0307410_10833130 Ga0307410_108331302 132
32 3300031911 Ga0307412_10466423 Ga0307412_104664231 132
33 3300031995 Ga0307409_100096764 Ga0307409_1000967642 132
34 3300032002 Ga0307416_100055925 Ga0307416_1000559255 132
35 3300032004 Ga0307414_10521510 Ga0307414_105215102 132
36 3300032005 Ga0307411_10072473 Ga0307411_100724735 132
37 3300037466 Ga0395898_0675683 Ga0395898_0675683_165_569 132
38 3300039437 Ga0436365_0308036 Ga0436365_0308036_166_573 132
39 3300050491 nmdc:mga00v17_633289_c1 nmdc:mga00v17_633289_c1_119_523 132
40 3300050507 nmdc:mga05p37_368497_c1 nmdc:mga05p37_368497_c1_957_1361 132
41 3300053083 Ga0495655_0204392 Ga0495655_0204392_83_484 132
42 iso_pu_bacteria 2788500588 2791212710 132
43 iso_pu_bacteria 2818991451 2819626855 132
44 iso_pu_bacteria 2904606771 2904606972 132
45 iso_pu_bacteria 2919543075 2919544220 132
46 iso_pu_bacteria 8055531788 8055533447 132
47 3300032002 Ga0307416_101244582 Ga0307416_1012445822 133
48 3300001989 JGI24739J22299_10163444 JGI24739J22299_101634441 134
49 3300002987 JGI25159J45721_1003968 JGI25159J45721_10039685 134
50 3300003187 JGI25151J46595_10000029 JGI25151J46595_10000029200 134
51 3300003187 JGI25151J46595_10002501 JGI25151J46595_100025012 134
52 3300003187 JGI25151J46595_10006830 JGI25151J46595_100068308 134
53 3300003187 JGI25151J46595_10023947 JGI25151J46595_100239475 134
54 3300003316 rootH1_10007388 rootH1_100073884 134
55 3300003322 rootL2_10011855 rootL2_1001185523 134
56 3300003323 rootH1_10379440 rootH1_103794402 134
57 3300003578 Ga0006562J51391_1000749 Ga0006562J51391_10007497 134
58 3300003578 Ga0006562J51391_1002561 Ga0006562J51391_10025611 134
59 3300003751 Ga0055538_1000127 Ga0055538_100012757 134
60 3300003758 Ga0055532_1002522 Ga0055532_10025222 134
61 3300003781 Ga0055536_1016506 Ga0055536_10165062 134
62 3300003781 Ga0055536_1066245 Ga0055536_10662451 134
63 3300003790 Ga0055528_1001271 Ga0055528_100127119 134
64 3300005327 Ga0070658_10000768 Ga0070658_100007687 134
65 3300005327 Ga0070658_10359673 Ga0070658_103596733 134
66 3300005329 Ga0070683_100060745 Ga0070683_1000607451 134
67 3300005336 Ga0070680_100006006 Ga0070680_1000060069 134
68 3300005336 Ga0070680_100188141 Ga0070680_1001881412 134
69 3300005336 Ga0070680_100454196 Ga0070680_1004541961 134
70 3300005337 Ga0070682_100048968 Ga0070682_1000489683 134
71 3300005339 Ga0070660_100000957 Ga0070660_1000009576 134
72 3300005339 Ga0070660_100129247 Ga0070660_1001292471 134
73 3300005339 Ga0070660_100149665 Ga0070660_1001496653 134
74 3300005344 Ga0070661_100039308 Ga0070661_1000393083 134
75 3300005344 Ga0070661_100143234 Ga0070661_1001432343 134
76 3300005353 Ga0070669_100147446 Ga0070669_1001474463 134
77 3300005355 Ga0070671_100012315 Ga0070671_1000123153 134
78 3300005366 Ga0070659_100019943 Ga0070659_1000199436 134
79 3300005366 Ga0070659_100264204 Ga0070659_1002642041 134
80 3300005366 Ga0070659_100327554 Ga0070659_1003275541 134
81 3300005435 Ga0070714_100017733 Ga0070714_1000177333 134
82 3300005437 Ga0070710_10480291 Ga0070710_104802912 134
83 3300005455 Ga0070663_100967234 Ga0070663_1009672341 134
84 3300005458 Ga0070681_10001709 Ga0070681_100017094 134
85 3300005458 Ga0070681_10123623 Ga0070681_101236232 134
86 3300005458 Ga0070681_10442569 Ga0070681_104425693 134
87 3300005467 Ga0070706_100004009 Ga0070706_10000400915 134
88 3300005468 Ga0070707_100032041 Ga0070707_1000320415 134
89 3300005471 Ga0070698_100465820 Ga0070698_1004658202 134
90 3300005530 Ga0070679_100050108 Ga0070679_1000501084 134
91 3300005530 Ga0070679_100084727 Ga0070679_1000847273 134
92 3300005530 Ga0070679_101123892 Ga0070679_1011238922 134
93 3300005535 Ga0070684_100294867 Ga0070684_1002948673 134
94 3300005536 Ga0070697_100205209 Ga0070697_1002052093 134
95 3300005539 Ga0068853_100462061 Ga0068853_1004620612 134
96 3300005539 Ga0068853_100984846 Ga0068853_1009848461 134
97 3300005539 Ga0068853_101184854 Ga0068853_1011848541 134
98 3300005543 Ga0070672_100206193 Ga0070672_1002061932 134
99 3300005546 Ga0070696_100030167 Ga0070696_1000301672 134
100 3300005548 Ga0070665_100037861 Ga0070665_1000378615 134
101 3300005563 Ga0068855_100014486 Ga0068855_10001448610 134
102 3300005563 Ga0068855_100034072 Ga0068855_1000340722 134
103 3300005563 Ga0068855_100038766 Ga0068855_1000387665 134
104 3300005563 Ga0068855_100112316 Ga0068855_1001123163 134
105 3300005563 Ga0068855_100154780 Ga0068855_1001547801 134
106 3300005563 Ga0068855_100159271 Ga0068855_1001592712 134
107 3300005563 Ga0068855_100347354 Ga0068855_1003473542 134
108 3300005577 Ga0068857_101240139 Ga0068857_1012401392 134
109 3300005578 Ga0068854_100158411 Ga0068854_1001584112 134
110 3300005578 Ga0068854_101325782 Ga0068854_1013257821 134
111 3300005614 Ga0068856_100090745 Ga0068856_1000907454 134
112 3300005614 Ga0068856_100398064 Ga0068856_1003980642 134
113 3300005616 Ga0068852_100638178 Ga0068852_1006381782 134
114 3300005618 Ga0068864_100580171 Ga0068864_1005801712 134
115 3300005842 Ga0068858_100210621 Ga0068858_1002106213 134
116 3300005870 Ga0058723_100006 Ga0058723_1000062 134
117 3300005981 Ga0081538_10150078 Ga0081538_101500782 134
118 3300006038 Ga0075365_10344640 Ga0075365_103446401 134
119 3300006051 Ga0075364_10402672 Ga0075364_104026722 134
120 3300006173 Ga0070716_100155571 Ga0070716_1001555712 134
121 3300006173 Ga0070716_100884764 Ga0070716_1008847641 134
122 3300006871 Ga0075434_100751405 Ga0075434_1007514052 134
123 3300009092 Ga0105250_10218291 Ga0105250_102182911 134
124 3300009093 Ga0105240_10235369 Ga0105240_102353692 134
125 3300009098 Ga0105245_10123285 Ga0105245_101232852 134
126 3300009101 Ga0105247_10030560 Ga0105247_100305603 134
127 3300009148 Ga0105243_10001152 Ga0105243_1000115213 134
128 3300009176 Ga0105242_10008612 Ga0105242_100086127 134
129 3300009545 Ga0105237_11090713 Ga0105237_110907131 134
130 3300009551 Ga0105238_10013046 Ga0105238_100130466 134
131 3300009551 Ga0105238_10562515 Ga0105238_105625152 134
132 3300009551 Ga0105238_10681473 Ga0105238_106814731 134
133 3300010375 Ga0105239_10338308 Ga0105239_103383082 134
134 3300010375 Ga0105239_10390365 Ga0105239_103903652 134
135 3300010375 Ga0105239_12581170 Ga0105239_125811702 134
136 3300011119 Ga0105246_10003765 Ga0105246_100037656 134
137 3300011119 Ga0105246_10063807 Ga0105246_100638072 134
138 3300011119 Ga0105246_10365559 Ga0105246_103655592 134
139 3300013104 Ga0157370_10060718 Ga0157370_100607183 134
140 3300013104 Ga0157370_10143597 Ga0157370_101435974 134
141 3300013104 Ga0157370_11430489 Ga0157370_114304892 134
142 3300013296 Ga0157374_10000361 Ga0157374_1000036137 134
143 3300013296 Ga0157374_10121911 Ga0157374_101219111 134
144 3300013297 Ga0157378_10103206 Ga0157378_101032063 134
145 3300013307 Ga0157372_10084636 Ga0157372_100846366 134
146 3300013307 Ga0157372_10405115 Ga0157372_104051152 134
147 3300013307 Ga0157372_10529776 Ga0157372_105297762 134
148 3300014745 Ga0157377_10012664 Ga0157377_100126647 134
149 3300014969 Ga0157376_10064277 Ga0157376_100642772 134
150 3300014969 Ga0157376_10107145 Ga0157376_101071452 134
151 3300015261 Ga0182006_1196672 Ga0182006_11966722 134
152 3300020082 Ga0206353_11144751 Ga0206353_111447512 134
153 3300020082 Ga0206353_11420495 Ga0206353_114204952 134
154 3300022467 Ga0224712_10143103 Ga0224712_101431033 134
155 3300025224 Ga0209784_100031 Ga0209784_100031152 134
156 3300025229 Ga0209147_100042 Ga0209147_100042205 134
157 3300025229 Ga0209147_100461 Ga0209147_1004613 134
158 3300025284 Ga0209130_1026704 Ga0209130_10267041 134
159 3300025291 Ga0209675_1018472 Ga0209675_10184722 134
160 3300025292 Ga0209676_1067869 Ga0209676_10678692 134
161 3300025294 Ga0209025_1000001 Ga0209025_1000001831 134
162 3300025294 Ga0209025_1002108 Ga0209025_100210823 134
163 3300025294 Ga0209025_1002373 Ga0209025_10023738 134
164 3300025294 Ga0209025_1004501 Ga0209025_10045016 134
165 3300025294 Ga0209025_1008060 Ga0209025_10080608 134
166 3300025294 Ga0209025_1010217 Ga0209025_10102173 134
167 3300025294 Ga0209025_1014494 Ga0209025_10144945 134
168 3300025294 Ga0209025_1021181 Ga0209025_10211813 134
169 3300025294 Ga0209025_1023160 Ga0209025_10231601 134
170 3300025294 Ga0209025_1071717 Ga0209025_10717172 134
171 3300025299 Ga0209256_1053335 Ga0209256_10533352 134
172 3300025302 Ga0207426_1018427 Ga0207426_10184272 134
173 3300025321 Ga0207656_10040908 Ga0207656_100409084 134
174 3300025711 Ga0207696_1014913 Ga0207696_10149132 134
175 3300025711 Ga0207696_1022613 Ga0207696_10226132 134
176 3300025728 Ga0207655_1000925 Ga0207655_100092525 134
177 3300025900 Ga0207710_10041371 Ga0207710_100413712 134
178 3300025909 Ga0207705_10000226 Ga0207705_1000022642 134
179 3300025909 Ga0207705_10120254 Ga0207705_101202542 134
180 3300025910 Ga0207684_10030148 Ga0207684_100301482 134
181 3300025912 Ga0207707_10003296 Ga0207707_100032964 134
182 3300025912 Ga0207707_10013337 Ga0207707_100133372 134
183 3300025912 Ga0207707_10268865 Ga0207707_102688652 134
184 3300025912 Ga0207707_10314724 Ga0207707_103147244 134
185 3300025912 Ga0207707_10592085 Ga0207707_105920852 134
186 3300025914 Ga0207671_10000283 Ga0207671_1000028362 134
187 3300025917 Ga0207660_10034137 Ga0207660_100341373 134
188 3300025917 Ga0207660_10067374 Ga0207660_100673742 134
189 3300025917 Ga0207660_10165439 Ga0207660_101654392 134
190 3300025919 Ga0207657_10007423 Ga0207657_100074236 134
191 3300025919 Ga0207657_10019347 Ga0207657_100193475 134
192 3300025920 Ga0207649_10052165 Ga0207649_100521654 134
193 3300025920 Ga0207649_10101973 Ga0207649_101019732 134
194 3300025920 Ga0207649_10335309 Ga0207649_103353093 134
195 3300025921 Ga0207652_10055181 Ga0207652_100551814 134
196 3300025921 Ga0207652_10088045 Ga0207652_100880454 134
197 3300025921 Ga0207652_10219033 Ga0207652_102190332 134
198 3300025922 Ga0207646_10009663 Ga0207646_100096634 134
199 3300025922 Ga0207646_10012025 Ga0207646_100120255 134
200 3300025922 Ga0207646_11061767 Ga0207646_110617671 134
201 3300025924 Ga0207694_10058853 Ga0207694_100588534 134
202 3300025924 Ga0207694_10360443 Ga0207694_103604434 134
203 3300025924 Ga0207694_10959793 Ga0207694_109597932 134
204 3300025925 Ga0207650_10485897 Ga0207650_104858971 134
205 3300025926 Ga0207659_10170839 Ga0207659_101708391 134
206 3300025927 Ga0207687_10097418 Ga0207687_100974182 134
207 3300025927 Ga0207687_10329927 Ga0207687_103299272 134
208 3300025929 Ga0207664_10117228 Ga0207664_101172282 134
209 3300025931 Ga0207644_10947367 Ga0207644_109473671 134
210 3300025932 Ga0207690_10019715 Ga0207690_100197155 134
211 3300025932 Ga0207690_10063941 Ga0207690_100639412 134
212 3300025934 Ga0207686_10194332 Ga0207686_101943322 134
213 3300025939 Ga0207665_10018174 Ga0207665_100181742 134
214 3300025940 Ga0207691_10247473 Ga0207691_102474731 134
215 3300025942 Ga0207689_10898688 Ga0207689_108986882 134
216 3300025944 Ga0207661_10367901 Ga0207661_103679012 134
217 3300025944 Ga0207661_10497749 Ga0207661_104977491 134
218 3300025944 Ga0207661_10795999 Ga0207661_107959992 134
219 3300025949 Ga0207667_10002942 Ga0207667_1000294217 134
220 3300025949 Ga0207667_10025902 Ga0207667_100259026 134
221 3300025949 Ga0207667_10078761 Ga0207667_100787614 134
222 3300025949 Ga0207667_10109009 Ga0207667_101090093 134
223 3300025949 Ga0207667_10110195 Ga0207667_101101952 134
224 3300025949 Ga0207667_10253329 Ga0207667_102533292 134
225 3300025981 Ga0207640_10073660 Ga0207640_100736602 134
226 3300025981 Ga0207640_10711910 Ga0207640_107119102 134
227 3300026041 Ga0207639_10238526 Ga0207639_102385262 134
228 3300026041 Ga0207639_10417626 Ga0207639_104176262 134
229 3300026041 Ga0207639_10860727 Ga0207639_108607271 134
230 3300026041 Ga0207639_10915522 Ga0207639_109155221 134
231 3300026067 Ga0207678_10174509 Ga0207678_101745094 134
232 3300026067 Ga0207678_10287413 Ga0207678_102874132 134
233 3300026078 Ga0207702_10039635 Ga0207702_100396355 134
234 3300026078 Ga0207702_10621696 Ga0207702_106216961 134
235 3300026116 Ga0207674_10162128 Ga0207674_101621284 134
236 3300026116 Ga0207674_11458507 Ga0207674_114585071 134
237 3300026118 Ga0207675_101523811 Ga0207675_1015238111 134
238 3300026142 Ga0207698_10089195 Ga0207698_100891952 134
239 3300027200 Ga0208976_10010 Ga0208976_100102 134
240 3300028379 Ga0268266_10013509 Ga0268266_100135095 134
241 3300030083 Ga0237817_10548 Ga0237817_105487 134
242 3300031249 Ga0265339_10439716 Ga0265339_104397161 134
243 3300031548 Ga0307408_100003810 Ga0307408_10000381013 134
244 3300031691 Ga0316579_10147578 Ga0316579_101475782 134
245 3300031711 Ga0265314_10027244 Ga0265314_100272442 134
246 3300031727 Ga0316576_10165543 Ga0316576_101655433 134
247 3300031727 Ga0316576_10223119 Ga0316576_102231192 134
248 3300031727 Ga0316576_10815435 Ga0316576_108154351 134
249 3300031728 Ga0316578_10025412 Ga0316578_100254122 134
250 3300031728 Ga0316578_10056337 Ga0316578_100563372 134
251 3300031728 Ga0316578_10132239 Ga0316578_101322392 134
252 3300031728 Ga0316578_10215267 Ga0316578_102152672 134
253 3300031733 Ga0316577_10156808 Ga0316577_101568081 134
254 3300031733 Ga0316577_10176688 Ga0316577_101766882 134
255 3300031901 Ga0307406_10133245 Ga0307406_101332452 134
256 3300032002 Ga0307416_100039389 Ga0307416_1000393895 134
257 3300032002 Ga0307416_103194691 Ga0307416_1031946911 134
258 3300032126 Ga0307415_101117062 Ga0307415_1011170621 134
259 3300032133 Ga0316583_10008335 Ga0316583_100083352 134
260 3300032137 Ga0316585_10000258 Ga0316585_100002582 134
261 3300032137 Ga0316585_10031360 Ga0316585_100313602 134
262 3300032137 Ga0316585_10092714 Ga0316585_100927142 134
263 3300032139 Ga0316580_10043107 Ga0316580_100431072 134
264 3300032168 Ga0316593_10268807 Ga0316593_102688071 134
265 3300033524 Ga0316592_1002695 Ga0316592_10026954 134
266 3300033524 Ga0316592_1018182 Ga0316592_10181823 134
267 3300033528 Ga0316588_1102871 Ga0316588_11028711 134
268 3300033541 Ga0316596_1016211 Ga0316596_10162112 134
269 3300033541 Ga0316596_1046354 Ga0316596_10463541 134
270 3300035398 Ga0316574_0000628 Ga0316574_0000628_686_1135 134
271 3300035398 Ga0316574_0134026 Ga0316574_0134026_341_790 134
272 3300035398 Ga0316574_0148178 Ga0316574_0148178_1003_1452 134
273 3300036647 Ga0316582_0119718 Ga0316582_0119718_467_916 134
274 3300036647 Ga0316582_0124528 Ga0316582_0124528_112_561 134
275 3300036647 Ga0316582_0208812 Ga0316582_0208812_476_931 134
276 3300036647 Ga0316582_0598617 Ga0316582_0598617_126_575 134
277 3300036712 Ga0316584_0003697 Ga0316584_0003697_630_1079 134
278 3300036712 Ga0316584_0060951 Ga0316584_0060951_665_1114 134
279 3300036712 Ga0316584_0343176 Ga0316584_0343176_76_525 134
280 3300036712 Ga0316584_0504452 Ga0316584_0504452_136_585 134
281 3300036712 Ga0316584_0705029 Ga0316584_0705029_217_666 134
282 3300037588 Ga0316581_0036351 Ga0316581_0036351_397_846 134
283 3300038705 Ga0237819_01018 Ga0237819_01018_59_505 134
284 3300039453 Ga0436362_0509156 Ga0436362_0509156_934_1383 134
285 3300039453 Ga0436362_1257599 Ga0436362_1257599_142_603 134
286 3300041486 Ga0451807_1587770 Ga0451807_1587770_86_547 134
287 3300042007 Ga0439449_0040890 Ga0439449_0040890_331_774 134
288 3300042015 Ga0439462_0007996 Ga0439462_0007996_950_1393 134
289 3300042134 Ga0450898_022062 Ga0450898_022062_672_1115 134
290 3300044684 Ga0466966_0019372 Ga0466966_0019372_3798_4331 134
291 3300044694 Ga0466963_0581864 Ga0466963_0581864_74_532 134
292 3300044706 Ga0466964_0006762 Ga0466964_0006762_3227_3643 134
293 3300044712 Ga0453684_0136502 Ga0453684_0136502_2369_2818 134
294 3300044712 Ga0453684_0174692 Ga0453684_0174692_1544_1993 134
295 3300044765 Ga0466970_0066516 Ga0466970_0066516_910_1359 134
296 3300044842 Ga0466957_0055599 Ga0466957_0055599_553_1029 134
297 3300045049 Ga0466959_0000394 Ga0466959_0000394_9271_9804 134
298 3300045049 Ga0466959_0748907 Ga0466959_0748907_98_553 134
299 3300045049 Ga0466959_0749591 Ga0466959_0749591_158_616 134
300 3300045836 Ga0466958_0002478 Ga0466958_0002478_4614_5090 134
301 3300045836 Ga0466958_0233504 Ga0466958_0233504_484_942 134
302 3300045976 Ga0466967_0001012 Ga0466967_0001012_5918_6364 134
303 3300045976 Ga0466967_0071330 Ga0466967_0071330_2583_2999 134
304 3300045976 Ga0466967_0113123 Ga0466967_0113123_1139_1555 134
305 3300046455 Ga0495603_0390666 Ga0495603_0390666_310_759 134
306 3300046491 Ga0495584_0004195 Ga0495584_0004195_3285_3734 134
307 3300046492 Ga0495585_0069114 Ga0495585_0069114_399_848 134
308 3300046542 Ga0495597_0206615 Ga0495597_0206615_86_529 134
309 3300046558 Ga0495633_0076427 Ga0495633_0076427_276_725 134
310 3300047323 Ga0495683_0006067 Ga0495683_0006067_5103_5552 134
311 3300048903 Ga0496100_0132286 Ga0496100_0132286_600_1049 134
312 3300048904 Ga0496101_0002658 Ga0496101_0002658_9385_9834 134
313 3300048905 Ga0496102_0010878 Ga0496102_0010878_986_1435 134
314 3300048905 Ga0496102_0083265 Ga0496102_0083265_312_758 134
315 3300048905 Ga0496102_1282561 Ga0496102_1282561_65_511 134
316 3300048906 Ga0496103_0010375 Ga0496103_0010375_1917_2366 134
317 3300048906 Ga0496103_0054677 Ga0496103_0054677_1017_1463 134
318 3300048906 Ga0496103_0584490 Ga0496103_0584490_164_580 134
319 3300048907 Ga0496104_0007537 Ga0496104_0007537_5318_5767 134
320 3300048908 Ga0496105_0010584 Ga0496105_0010584_4891_5340 134
321 3300048909 Ga0496106_0000397 Ga0496106_0000397_23281_23730 134
322 3300048910 Ga0496107_0000728 Ga0496107_0000728_6553_7002 134
323 3300048910 Ga0496107_0879457 Ga0496107_0879457_82_528 134
324 3300048911 Ga0496108_0002795 Ga0496108_0002795_10151_10600 134
325 3300048912 Ga0496109_0007870 Ga0496109_0007870_5829_6278 134
326 3300048913 Ga0496110_0000689 Ga0496110_0000689_20724_21170 134
327 3300048913 Ga0496110_0003407 Ga0496110_0003407_9385_9834 134
328 3300048914 Ga0496111_0007764 Ga0496111_0007764_3155_3604 134
329 3300048915 Ga0496112_0067089 Ga0496112_0067089_2045_2494 134
330 3300048918 Ga0496115_0938479 Ga0496115_0938479_97_552 134
331 3300048919 Ga0496116_0009467 Ga0496116_0009467_7117_7566 134
332 3300048919 Ga0496116_0449794 Ga0496116_0449794_56_499 134
333 3300048921 Ga0496118_0194143 Ga0496118_0194143_217_666 134
334 3300048922 Ga0496119_0103380 Ga0496119_0103380_562_1011 134
335 3300048923 Ga0496120_0165989 Ga0496120_0165989_261_710 134
336 3300048924 Ga0496121_0104160 Ga0496121_0104160_1410_1859 134
337 3300048925 Ga0496122_0004478 Ga0496122_0004478_8768_9226 134
338 3300048925 Ga0496122_0052253 Ga0496122_0052253_1917_2366 134
339 3300048926 Ga0496123_0095135 Ga0496123_0095135_229_678 134
340 3300048928 Ga0496125_0004427 Ga0496125_0004427_320_769 134
341 3300048929 Ga0496126_0007422 Ga0496126_0007422_10122_10571 134
342 3300048929 Ga0496126_0749810 Ga0496126_0749810_265_723 134
343 3300048929 Ga0496126_1274520 Ga0496126_1274520_64_510 134
344 3300049127 Ga0501306_045198 Ga0501306_045198_189_632 134
345 3300049129 Ga0501309_065963 Ga0501309_065963_128_577 134
346 3300049132 Ga0501343_007204 Ga0501343_007204_69_572 134
347 3300049161 Ga0501305_020107 Ga0501305_020107_150_653 134
348 3300049161 Ga0501305_024187 Ga0501305_024187_453_902 134
349 3300049161 Ga0501305_051583 Ga0501305_051583_64_507 134
350 3300049162 Ga0501307_076250 Ga0501307_076250_69_518 134
351 3300049518 Ga0501295_064255 Ga0501295_064255_331_777 134
352 3300049528 Ga0501312_024568 Ga0501312_024568_453_902 134
353 3300049528 Ga0501312_125346 Ga0501312_125346_41_487 134
354 3300049529 Ga0501313_000159 Ga0501313_000159_3218_3667 134
355 3300049529 Ga0501313_037455 Ga0501313_037455_100_603 134
356 3300049531 Ga0501315_006104 Ga0501315_006104_364_777 134
357 3300049531 Ga0501315_017223 Ga0501315_017223_17_466 134
358 3300049532 Ga0501316_001105 Ga0501316_001105_69_572 134
359 3300049532 Ga0501316_015596 Ga0501316_015596_12_461 134
360 3300049533 Ga0501317_000311 Ga0501317_000311_2747_3196 134
361 3300049539 Ga0501323_084459 Ga0501323_084459_40_489 134
362 3300049539 Ga0501323_094686 Ga0501323_094686_40_489 134
363 3300049551 Ga0501335_011530 Ga0501335_011530_309_812 134
364 3300049571 Ga0501034_0126490 Ga0501034_0126490_1865_2320 134
365 3300049571 Ga0501034_0706472 Ga0501034_0706472_317_823 134
366 3300049575 Ga0501039_0914049 Ga0501039_0914049_95_550 134
367 3300049586 Ga0501070_0694047 Ga0501070_0694047_286_741 134
368 3300049650 Ga0501199_004430 Ga0501199_004430_877_1326 134
369 3300049653 Ga0501206_071811 Ga0501206_071811_24_470 134
370 3300049661 Ga0501217_008256 Ga0501217_008256_521_964 134
371 3300049661 Ga0501217_095085 Ga0501217_095085_143_592 134
372 3300049668 Ga0501233_010432 Ga0501233_010432_826_1272 134
373 3300049675 Ga0501243_077161 Ga0501243_077161_36_482 134
374 3300049684 Ga0501255_064041 Ga0501255_064041_31_477 134
375 3300049686 Ga0501257_062620 Ga0501257_062620_344_793 134
376 3300049707 Ga0501234_047737 Ga0501234_047737_174_620 134
377 3300049708 Ga0501245_002201 Ga0501245_002201_1130_1576 134
378 3300049760 Ga0501263_015861 Ga0501263_015861_121_570 134
379 3300050492 nmdc:mga0yw44_1241559_c1 nmdc:mga0yw44_1241559_c1_41_463 134
380 3300050512 nmdc:mga0n895_1189544_c1 nmdc:mga0n895_1189544_c1_254_721 134
381 3300050515 nmdc:mga0a205_793637_c1 nmdc:mga0a205_793637_c1_180_647 134
382 3300053104 Ga0500556_0000285 Ga0500556_0000285_10372_10794 134
383 3300053108 Ga0500562_020152 Ga0500562_020152_1002_1424 134
384 3300053153 Ga0500616_0010299 Ga0500616_0010299_599_1021 134
385 3300059477 Ga0587084_096475 Ga0587084_096475_12_461 134
386 3300061734 Ga0530510_0154306 Ga0530510_0154306_842_1255 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

20

154

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vya-assembly1.cif.gz_F identification and characterization of the first plant g-quadruplex binding protein encoded by the zea mays l. nucleoside diphosphate1 gene, zmndpk1 0.9944 1 133
1pku-assembly2.cif.gz_G crystal structure of nucleoside diphosphate kinase from rice 0.9938 2 133
5c7p-assembly1.cif.gz_A-2 structure of leishmania nucleoside diphostate kinase mutant p95s 0.9928 2 131
5u2i-assembly1.cif.gz_B crystal structure of a nucleoside diphosphate kinase from naegleria fowleri 0.9917 2 131
3ngt-assembly7.cif.gz_L structure of leishmania ndkb complexed with amp. 0.9911 2 131
ID Description Score Start End Superfamily
af_A0A1D6EH51_54_191_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9943 18 131 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9877 1 133 3.30.70.141
1k44A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9845 1 134 3.30.70.141
af_A0A0G2L2L7_25_106_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9812 2 77 3.30.70.141
5go1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.981 1 131 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A7S4E3E9-F1-model_v4 nucleoside-diphosphate kinase (EC 2.7.4.6) 1 2 131 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241
AF-A0A250X6T6-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9987 2 131 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241
GO:0016020
AF-A0A1Q2HR77-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9983 2 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A2U3DCS3-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9979 1 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A1R3HH14-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9979 1 133 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241
GO:0008380
GO:0035145

Feature Viewer

pLDDT pTM Quality
96.34 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map