F430665

General Info

Members Datasets Scaffolds Average Seq Length
386 240 772 421

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_77914_c1|nmdc:mga0yw44_77914_c1_527_2047
Length 506
Sequence VRTRACEAAKRKARHHAVTCQRQLFPARQPDAIWHKGCYYEYKRILNDEVRVNKGVHPHESRARCCAFFVSIQPWNISAMKPSKPVAPATTVVANEGRRSLLKHAGVLGGAGLMSMLTPGLRGAVHAAGSDAPEKKEVKVGFIPLTDCASVVMASVMEFDKKYGIKIVPTKEASWASVRDKLVNGELDAAHVLYGLIYGVHNGVGGPKKDMAVLMNLNHNGQAITLSKKLNEKGVKDGASLKALMDKEKREYIFAQTFPTGTHAMWIYYWLAAQGIDPLKDAKAITVPPPQMVANMRVGNMDGYCVGEPWGNRAIADGIGFTVETTQAIWKDHPEKVLGTSADWVAKNPNTARAMTAAILDAGRWIDASLSNRQKTAQTVADRSYVNTDADIIVARMLGRYDNGIGKKWDDPDYMKFYNDGAVNFPYLSDGMWFMTQHRRWGLMKTDLDYLAVAKQVNRIDIYKDAATAAKTSVAKSDMRTHKLIDGTVWDGKDPKKYASGFKIHA

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
152 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
216 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
217 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
235 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
236 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
237 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
238 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
239 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
240 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.06
Nodule 0.52
Rhizoplane 2.33
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_77914_c1 3300050492 Bacteria 2072
2 JGI25151J46595_10001315 3300003187 Bacteria 17394
3 JGI25151J46595_10038402 3300003187 Bacteria 1782
4 JGI25161J50226_1000835 3300003374 Bacteria 11514
5 Ga0055526_1006460 3300003771 Bacteria 6356
6 Ga0055537_1002374 3300003773 Bacteria 6371
7 Ga0055524_1002073 3300003775 Bacteria 10626
8 Ga0055524_1002533 3300003775 Bacteria 9356
9 Ga0055524_1005230 3300003775 Bacteria 5834
10 Ga0055536_1000134 3300003781 Bacteria 63257
11 Ga0055534_1001576 3300003784 Bacteria 8862
12 Ga0055534_1002439 3300003784 Bacteria 6434
13 Ga0055530_10001933 3300003791 Bacteria 14134
14 Ga0055543_1001437 3300004625 Bacteria 9469
15 Ga0065165_1004653 3300005262 Bacteria 8311
16 Ga0065165_1013869 3300005262 Bacteria 3169
17 Ga0070658_10179121 3300005327 Bacteria 1783
18 Ga0070676_10047775 3300005328 Bacteria 2500
19 Ga0070683_100017689 3300005329 Bacteria 6299
20 Ga0070690_100014451 3300005330 Bacteria 4683
21 Ga0070670_100005362 3300005331 Bacteria 10823
22 Ga0070670_100028987 3300005331 Bacteria 4764
23 Ga0070670_100037626 3300005331 Bacteria 4162
24 Ga0068869_100000106 3300005334 Bacteria 39499
25 Ga0068869_100016487 3300005334 Bacteria 4980
26 Ga0068869_100068815 3300005334 Bacteria 2616
27 Ga0070680_100070604 3300005336 Bacteria 2868
28 Ga0070680_100126122 3300005336 Bacteria 2139
29 Ga0068868_100008784 3300005338 Bacteria 7240
30 Ga0068868_100024020 3300005338 Bacteria 4620
31 Ga0070660_100005509 3300005339 Bacteria 8766
32 Ga0070660_100027633 3300005339 Bacteria 4236
33 Ga0070660_100132541 3300005339 Bacteria 1995
34 Ga0070689_100025034 3300005340 Bacteria 4482
35 Ga0070661_100020266 3300005344 Bacteria 4740
36 Ga0070661_100052636 3300005344 Bacteria 2980
37 Ga0070661_100105734 3300005344 Bacteria 2098
38 Ga0070692_10063593 3300005345 Bacteria 1949
39 Ga0070668_100011697 3300005347 Bacteria 6534
40 Ga0070668_100014416 3300005347 Bacteria 5908
41 Ga0070668_100065440 3300005347 Bacteria 2820
42 Ga0070669_100000995 3300005353 Bacteria 20639
43 Ga0070669_100064627 3300005353 Bacteria 2695
44 Ga0070675_100047235 3300005354 Bacteria 3527
45 Ga0070675_100060882 3300005354 Bacteria 3116
46 Ga0070675_100148081 3300005354 Bacteria 2011
47 Ga0070675_100340440 3300005354 Bacteria 1328
48 Ga0070671_100064651 3300005355 Bacteria 3046
49 Ga0070671_100184858 3300005355 Bacteria 1765
50 Ga0070673_100015414 3300005364 Bacteria 5368
51 Ga0070673_100031370 3300005364 Bacteria 3987
52 Ga0070667_100000861 3300005367 Bacteria 28255
53 Ga0070667_100159908 3300005367 Bacteria 1983
54 Ga0070667_100160301 3300005367 Bacteria 1981
55 Ga0070701_10012992 3300005438 Bacteria 3776
56 Ga0070700_100009006 3300005441 Bacteria 5466
57 Ga0070700_100090817 3300005441 Bacteria 1992
58 Ga0070662_100075759 3300005457 Bacteria 2492
59 Ga0068867_100000742 3300005459 Bacteria 21874
60 Ga0068867_100010377 3300005459 Bacteria 6572
61 Ga0068867_100164266 3300005459 Bacteria 1753
62 Ga0068867_100228382 3300005459 Bacteria 1503
63 Ga0070698_100009492 3300005471 Bacteria 10421
64 Ga0068853_100166382 3300005539 Bacteria 1993
65 Ga0070672_100024857 3300005543 Bacteria 4434
66 Ga0070672_100051058 3300005543 Bacteria 3223
67 Ga0070672_100123335 3300005543 Bacteria 2123
68 Ga0070665_100029022 3300005548 Bacteria 5569
69 Ga0070665_100145120 3300005548 Bacteria 2377
70 Ga0070704_100222609 3300005549 Bacteria 1535
71 Ga0068855_100085413 3300005563 Bacteria 3651
72 Ga0068855_100378172 3300005563 Bacteria 1555
73 Ga0070664_100012340 3300005564 Bacteria 6943
74 Ga0070664_100265034 3300005564 Bacteria 1546
75 Ga0068854_100014861 3300005578 Bacteria 5141
76 Ga0070702_100013820 3300005615 Bacteria 4085
77 Ga0070702_100037916 3300005615 Bacteria 2680
78 Ga0068852_100002785 3300005616 Bacteria 12109
79 Ga0068859_100000273 3300005617 Bacteria 51339
80 Ga0068859_100034835 3300005617 Bacteria 5051
81 Ga0068859_100140283 3300005617 Bacteria 2490
82 Ga0068864_100000963 3300005618 Bacteria 24153
83 Ga0068864_100092240 3300005618 Bacteria 2673
84 Ga0068866_10044936 3300005718 Bacteria 2213
85 Ga0068861_100002534 3300005719 Bacteria 11939
86 Ga0068861_100004902 3300005719 Bacteria 9011
87 Ga0068870_10005790 3300005840 Bacteria 5421
88 Ga0068870_10112724 3300005840 Bacteria 1555
89 Ga0068863_100010467 3300005841 Bacteria 9016
90 Ga0068863_100052150 3300005841 Bacteria 3877
91 Ga0068858_100013306 3300005842 Bacteria 7759
92 Ga0068858_100027046 3300005842 Bacteria 5328
93 Ga0068860_100017893 3300005843 Bacteria 6901
94 Ga0068862_100003118 3300005844 Bacteria 14450
95 Ga0068862_100008725 3300005844 Bacteria 8391
96 Ga0068862_100043133 3300005844 Bacteria 3845
97 Ga0075363_100020767 3300006048 Bacteria 3298
98 Ga0075364_10009289 3300006051 Bacteria 5893
99 Ga0075364_10022937 3300006051 Bacteria 3947
100 Ga0075362_10043758 3300006177 Bacteria 1983
101 Ga0075367_10005208 3300006178 Bacteria 6429
102 Ga0075369_10002991 3300006186 Bacteria 6108
103 Ga0075369_10005360 3300006186 Bacteria 4785
104 Ga0075369_10006359 3300006186 Bacteria 4463
105 Ga0075366_10011139 3300006195 Bacteria 5069
106 Ga0075366_10013373 3300006195 Bacteria 4670
107 Ga0075366_10023572 3300006195 Bacteria 3586
108 Ga0075366_10031818 3300006195 Bacteria 3105
109 Ga0097621_100047184 3300006237 Bacteria 3489
110 Ga0075370_10016055 3300006353 Bacteria 4023
111 Ga0068871_100011520 3300006358 Bacteria 6486
112 Ga0068871_100111107 3300006358 Bacteria 2305
113 Ga0075428_100268160 3300006844 Bacteria 1837
114 Ga0075430_100012580 3300006846 Bacteria 7205
115 Ga0075430_100050787 3300006846 Bacteria 3495
116 Ga0075431_100019741 3300006847 Bacteria 6878
117 Ga0075431_100093331 3300006847 Bacteria 3106
118 Ga0075431_100100742 3300006847 Bacteria 2981
119 Ga0075431_100323921 3300006847 Bacteria 1553
120 Ga0075429_100000015 3300006880 Bacteria 78823
121 Ga0075429_100001431 3300006880 Bacteria 19585
122 Ga0075429_100137692 3300006880 Bacteria 2137
123 Ga0075429_100160873 3300006880 Bacteria 1966
124 Ga0097620_100000273 3300006931 Bacteria 51339
125 Ga0097620_100034835 3300006931 Bacteria 5051
126 Ga0097620_100140282 3300006931 Bacteria 2490
127 Ga0099826_10000007 3300006948 Bacteria 393518
128 Ga0099794_10012839 3300007265 Bacteria 3629
129 Ga0111539_10158327 3300009094 Bacteria 2649
130 Ga0114129_10002286 3300009147 Bacteria 26528
131 Ga0114129_10050630 3300009147 Bacteria 5834
132 Ga0114129_10056195 3300009147 Bacteria 5514
133 Ga0114129_10300099 3300009147 Bacteria 2141
134 Ga0105243_10017446 3300009148 Bacteria 5427
135 Ga0105243_10029716 3300009148 Bacteria 4205
136 Ga0105243_10211775 3300009148 Bacteria 1707
137 Ga0105241_10017747 3300009174 Bacteria 5234
138 Ga0105242_10027042 3300009176 Bacteria 4550
139 Ga0105242_10086265 3300009176 Bacteria 2634
140 Ga0105248_10005623 3300009177 Bacteria 13763
141 Ga0105237_10068023 3300009545 Bacteria 3556
142 Ga0105238_10324503 3300009551 Bacteria 1526
143 Ga0105249_10001620 3300009553 Bacteria 19709
144 Ga0105246_10057403 3300011119 Bacteria 2693
145 Ga0157373_10130153 3300013100 Bacteria 1770
146 Ga0157378_10009669 3300013297 Bacteria 8398
147 Ga0157378_10059018 3300013297 Bacteria 3423
148 Ga0163162_10005803 3300013306 Bacteria 11947
149 Ga0163162_10063815 3300013306 Bacteria 3728
150 Ga0157375_10039512 3300013308 Bacteria 4542
151 Ga0157375_10324099 3300013308 Bacteria 1705
152 Ga0163163_10073189 3300014325 Bacteria 3417
153 Ga0157380_10011934 3300014326 Bacteria 6286
154 Ga0157380_10028648 3300014326 Bacteria 4248
155 Ga0157380_10213030 3300014326 Bacteria 1723
156 Ga0157380_10261486 3300014326 Bacteria 1572
157 Ga0157377_10010373 3300014745 Bacteria 4607
158 Ga0157377_10012505 3300014745 Bacteria 4270
159 Ga0157377_10034527 3300014745 Bacteria 2767
160 Ga0157377_10047751 3300014745 Bacteria 2399
161 Ga0157379_10000629 3300014968 Bacteria 28451
162 Ga0157376_10007184 3300014969 Bacteria 7918
163 Ga0157376_10066377 3300014969 Bacteria 3050
164 Ga0157376_10093549 3300014969 Bacteria 2610
165 Ga0209436_100521 3300025208 Bacteria 16709
166 Ga0209563_100015 3300025230 Bacteria 879901
167 Ga0209565_1000104 3300025263 Bacteria 124432
168 Ga0209565_1001401 3300025263 Bacteria 10731
169 Ga0209565_1010479 3300025263 Bacteria 2297
170 Ga0209130_1001287 3300025284 Bacteria 17337
171 Ga0209675_1000191 3300025291 Bacteria 67500
172 Ga0209675_1002151 3300025291 Bacteria 10391
173 Ga0209676_1000036 3300025292 Bacteria 457623
174 Ga0209025_1000905 3300025294 Bacteria 45998
175 Ga0209025_1001806 3300025294 Bacteria 25356
176 Ga0209025_1002048 3300025294 Bacteria 22965
177 Ga0209564_1000639 3300025295 Bacteria 53129
178 Ga0209564_1000688 3300025295 Bacteria 49680
179 Ga0209564_1002275 3300025295 Bacteria 15701
180 Ga0209564_1004020 3300025295 Bacteria 9304
181 Ga0209050_1000469 3300025298 Bacteria 71511
182 Ga0209256_1001092 3300025299 Bacteria 31208
183 Ga0209256_1001334 3300025299 Bacteria 26338
184 Ga0209256_1001909 3300025299 Bacteria 19072
185 Ga0207426_1010077 3300025302 Bacteria 3694
186 Ga0209051_1026910 3300025303 Bacteria 2304
187 Ga0207655_1045729 3300025728 Bacteria 1824
188 Ga0207682_10013444 3300025893 Bacteria 3189
189 Ga0207642_10071679 3300025899 Bacteria 1651
190 Ga0207688_10016217 3300025901 Bacteria 4040
191 Ga0207680_10042399 3300025903 Bacteria 2662
192 Ga0207645_10011275 3300025907 Bacteria 6109
193 Ga0207645_10018600 3300025907 Bacteria 4565
194 Ga0207643_10004615 3300025908 Bacteria 7398
195 Ga0207705_10101798 3300025909 Bacteria 2113
196 Ga0207684_10051223 3300025910 Bacteria 3503
197 Ga0207654_10016090 3300025911 Bacteria 3890
198 Ga0207671_10030997 3300025914 Bacteria 3987
199 Ga0207660_10027301 3300025917 Bacteria 3894
200 Ga0207660_10056327 3300025917 Bacteria 2812
201 Ga0207662_10013720 3300025918 Bacteria 4535
202 Ga0207662_10061849 3300025918 Bacteria 2249
203 Ga0207657_10002609 3300025919 Bacteria 19479
204 Ga0207649_10009052 3300025920 Bacteria 5440
205 Ga0207649_10013731 3300025920 Bacteria 4527
206 Ga0207681_10080811 3300025923 Bacteria 2294
207 Ga0207650_10004337 3300025925 Bacteria 9688
208 Ga0207650_10007639 3300025925 Bacteria 7365
209 Ga0207650_10046549 3300025925 Bacteria 3194
210 Ga0207650_10208530 3300025925 Bacteria 1568
211 Ga0207659_10009785 3300025926 Bacteria 5997
212 Ga0207659_10044984 3300025926 Bacteria 3109
213 Ga0207659_10103492 3300025926 Bacteria 2151
214 Ga0207687_10039974 3300025927 Bacteria 3213
215 Ga0207687_10088779 3300025927 Bacteria 2250
216 Ga0207644_10019514 3300025931 Bacteria 4599
217 Ga0207644_10021558 3300025931 Bacteria 4391
218 Ga0207690_10002750 3300025932 Bacteria 10627
219 Ga0207690_10003354 3300025932 Bacteria 9572
220 Ga0207706_10082841 3300025933 Bacteria 2820
221 Ga0207709_10019286 3300025935 Bacteria 3832
222 Ga0207709_10154304 3300025935 Bacteria 1594
223 Ga0207670_10010367 3300025936 Bacteria 5364
224 Ga0207704_10012882 3300025938 Bacteria 4165
225 Ga0207704_10076425 3300025938 Bacteria 2146
226 Ga0207691_10002613 3300025940 Bacteria 17590
227 Ga0207691_10006268 3300025940 Bacteria 11483
228 Ga0207689_10000118 3300025942 Bacteria 65374
229 Ga0207689_10003339 3300025942 Bacteria 14703
230 Ga0207689_10141217 3300025942 Bacteria 1984
231 Ga0207679_10000906 3300025945 Bacteria 18937
232 Ga0207667_10006079 3300025949 Bacteria 14670
233 Ga0207651_10014268 3300025960 Bacteria 4580
234 Ga0207651_10019279 3300025960 Bacteria 4083
235 Ga0207712_10070883 3300025961 Bacteria 2505
236 Ga0207712_10153066 3300025961 Bacteria 1783
237 Ga0207668_10022551 3300025972 Bacteria 4033
238 Ga0207668_10043293 3300025972 Bacteria 3054
239 Ga0207658_10153632 3300025986 Bacteria 1878
240 Ga0207677_10022469 3300026023 Bacteria 3877
241 Ga0207703_10001578 3300026035 Bacteria 20652
242 Ga0207703_10038294 3300026035 Bacteria 3825
243 Ga0207703_10188046 3300026035 Bacteria 1827
244 Ga0207639_10029242 3300026041 Bacteria 4032
245 Ga0207708_10007316 3300026075 Bacteria 8159
246 Ga0207648_10000238 3300026089 Bacteria 59053
247 Ga0207648_10001056 3300026089 Bacteria 30829
248 Ga0207648_10007566 3300026089 Bacteria 10660
249 Ga0207648_10029709 3300026089 Bacteria 4847
250 Ga0207676_10016917 3300026095 Bacteria 5280
251 Ga0207676_10077609 3300026095 Bacteria 2687
252 Ga0207674_10026030 3300026116 Bacteria 6225
253 Ga0207675_100000979 3300026118 Bacteria 28349
254 Ga0207675_100012412 3300026118 Bacteria 7958
255 Ga0207675_100099797 3300026118 Bacteria 2735
256 Ga0207683_10033260 3300026121 Bacteria 4478
257 Ga0207698_10008426 3300026142 Bacteria 6521
258 Ga0207698_10075271 3300026142 Bacteria 2697
259 Ga0209282_1000021 3300027666 Bacteria 177705
260 Ga0209588_1010205 3300027671 Bacteria 2819
261 Ga0268266_10255791 3300028379 Bacteria 1621
262 Ga0268265_10000459 3300028380 Bacteria 43185
263 Ga0268264_10001039 3300028381 Bacteria 27889
264 Ga0268264_10244393 3300028381 Bacteria 1664
265 Ga0265318_10012590 3300028577 Bacteria 3594
266 Ga0307515_10000020 3300028794 Bacteria 411735
267 Ga0307511_10017009 3300030521 Bacteria 6990
268 Ga0316177_1151259 3300030731 Bacteria 3985
269 Ga0316180_1100674 3300030736 Bacteria 4776
270 Ga0265332_10002147 3300031238 Bacteria 10174
271 Ga0265331_10001179 3300031250 Bacteria 19910
272 Ga0265327_10000235 3300031251 Bacteria 111362
273 Ga0265327_10011126 3300031251 Bacteria 6241
274 Ga0265327_10044005 3300031251 Bacteria 2384
275 Ga0307508_10032307 3300031616 Bacteria 4728
276 Ga0265314_10000887 3300031711 Bacteria 35662
277 Ga0307416_100009076 3300032002 Bacteria 6475
278 Ga0373923_0035349 3300035111 Bacteria 2034
279 Ga0373960_0014627 3300035121 Bacteria 1991
280 Ga0373924_0027520 3300035410 Bacteria 2261
281 Ga0373933_0009629 3300035724 Bacteria 5278
282 Ga0373937_0049635 3300036401 Bacteria 3842
283 Ga0395899_0013433 3300037312 Bacteria 6264
284 Ga0395899_0017193 3300037312 Bacteria 5509
285 Ga0395899_0045648 3300037312 Bacteria 3264
286 Ga0395900_0001738 3300037418 Bacteria 25108
287 Ga0395900_0004356 3300037418 Bacteria 15021
288 Ga0395898_0016407 3300037466 Bacteria 7580
289 Ga0395898_0049958 3300037466 Bacteria 4095
290 Ga0395898_0232929 3300037466 Bacteria 1756
291 Ga0395905_0054285 3300037471 Bacteria 3750
292 Ga0395905_0149866 3300037471 Bacteria 2194
293 Ga0395901_0001782 3300038443 Bacteria 22209
294 Ga0439441_000604 3300042001 Bacteria 4037
295 Ga0439448_0001936 3300042005 Bacteria 5517
296 Ga0439450_002808 3300042008 Bacteria 2795
297 Ga0439455_0003148 3300042012 Bacteria 3111
298 Ga0439435_0003266 3300042436 Bacteria 3350
299 Ga0439460_0021753 3300042461 Bacteria 1756
300 Ga0466972_0020642 3300044658 Bacteria 3291
301 Ga0466965_0010530 3300044683 Bacteria 4319
302 Ga0466965_0024429 3300044683 Bacteria 2923
303 Ga0466966_0013081 3300044684 Bacteria 5494
304 Ga0466966_0056758 3300044684 Bacteria 2476
305 Ga0466961_0000232 3300044693 Bacteria 37669
306 Ga0466964_0055629 3300044706 Bacteria 1634
307 Ga0453684_0023507 3300044712 Bacteria 9070
308 Ga0466971_0104350 3300044719 Bacteria 1304
309 Ga0466957_0027728 3300044842 Bacteria 3367
310 Ga0466959_0012677 3300045049 Bacteria 6097
311 Ga0466959_0036373 3300045049 Bacteria 3638
312 Ga0466959_0061224 3300045049 Bacteria 2737
313 Ga0451576_0236095 3300045051 Bacteria 1910
314 Ga0466967_0008988 3300045976 Bacteria 7381
315 Ga0495605_0000085 3300046474 Bacteria 121011
316 Ga0495607_0034853 3300046501 Bacteria 3050
317 Ga0495583_0000205 3300046506 Bacteria 99711
318 Ga0495616_0000145 3300046513 Bacteria 62415
319 Ga0495643_0004391 3300046522 Bacteria 9879
320 Ga0495643_0015686 3300046522 Bacteria 4469
321 Ga0495648_0011756 3300046524 Bacteria 6569
322 Ga0495642_0000973 3300046528 Bacteria 13340
323 Ga0495598_0001997 3300046537 Bacteria 4145
324 Ga0495609_0000002 3300046538 Bacteria 739816
325 Ga0495661_0000271 3300046665 Bacteria 59543
326 Ga0495661_0000669 3300046665 Bacteria 34300
327 Ga0495661_0002269 3300046665 Bacteria 14874
328 Ga0495588_0000135 3300046674 Bacteria 117387
329 Ga0495669_0069456 3300046684 Bacteria 1604
330 Ga0495589_0000030 3300046794 Bacteria 170254
331 Ga0495589_0001070 3300046794 Bacteria 16432
332 Ga0495660_0000423 3300046810 Bacteria 35820
333 Ga0495636_0015916 3300047318 Bacteria 3000
334 Ga0495672_0000833 3300047320 Bacteria 32978
335 Ga0495687_000047 3300047443 Bacteria 206452
336 Ga0495687_000112 3300047443 Bacteria 124725
337 Ga0495687_001101 3300047443 Bacteria 26384
338 Ga0495687_002457 3300047443 Bacteria 14827
339 Ga0495677_0000044 3300047445 Bacteria 74340
340 Ga0495677_0007472 3300047445 Bacteria 4082
341 Ga0495615_0002476 3300048090 Bacteria 2966
342 Ga0495626_0000006 3300048091 Bacteria 284977
343 Ga0495626_0000266 3300048091 Bacteria 59029
344 Ga0496101_0017179 3300048904 Bacteria 4904
345 Ga0496102_0028837 3300048905 Bacteria 4962
346 Ga0496102_0034795 3300048905 Bacteria 4533
347 Ga0496102_0079152 3300048905 Bacteria 3026
348 Ga0496108_0226075 3300048911 Bacteria 1627
349 Ga0496109_0055775 3300048912 Bacteria 3605
350 Ga0496110_0164352 3300048913 Bacteria 2012
351 Ga0496111_0138359 3300048914 Bacteria 1804
352 Ga0496113_0052467 3300048916 Bacteria 3046
353 Ga0496122_0019569 3300048925 Bacteria 6174
354 Ga0496123_0005792 3300048926 Bacteria 12268
355 Ga0501198_000006 3300049649 Bacteria 129954
356 Ga0501209_002850 3300049656 Bacteria 2750
357 Ga0501222_000007 3300049662 Bacteria 126703
358 nmdc:mga03683_5252_c1 3300050489 Bacteria 4363
359 nmdc:mga03n38_2426_c1 3300050490 Bacteria 5756
360 nmdc:mga00v17_36998_c1 3300050491 Bacteria 2912
361 nmdc:mga0k408_14707_c1 3300050493 Bacteria 4318
362 nmdc:mga0k408_203_c2 3300050493 Bacteria 31214
363 nmdc:mga0k408_3682_c1 3300050493 Bacteria 8115
364 nmdc:mga06z11_6653_c1 3300050494 Bacteria 4723
365 nmdc:mga05p37_109994_c1 3300050507 Bacteria 3390
366 nmdc:mga05p37_211_c1 3300050507 Bacteria 58827
367 nmdc:mga09592_221138_c1 3300050508 Bacteria 1641
368 nmdc:mga09592_311_c1 3300050508 Bacteria 35521
369 nmdc:mga0qj67_33680_c1 3300050509 Bacteria 3998
370 nmdc:mga0qj67_8468_c1 3300050509 Bacteria 7631
371 nmdc:mga06r32_220197_c1 3300050510 Bacteria 1886
372 nmdc:mga06r32_244778_c1 3300050510 Bacteria 1781
373 nmdc:mga08y16_103324_c1 3300050511 Bacteria 2967
374 nmdc:mga0rr50_54374_c1 3300050513 Bacteria 2982
375 nmdc:mga0sz30_26204_c1 3300050516 Bacteria 1503
376 Ga0500655_001489 3300053133 Bacteria 4433
377 Ga0500636_0000086 3300053177 Bacteria 46124
378 Ga0500625_014769 3300053729 Bacteria 3612
379 Ga0466962_0017199 3300061719 Bacteria 3483
380 2808984966 2808606386 Bacteria 4471946
381 2809131853 2808606415 Bacteria 4576710
382 2809151335 2808606419 Bacteria 4576925
383 2852620815 2852618963 Bacteria 4577824
384 2919709066 2919704043 Bacteria 5560311
385 2998346625 2998344455 Bacteria 4222996
386 8047677869 8047673197 Bacteria 7395230
387 nmdc:mga0yw44_77914_c1
388 JGI25151J46595_10001315
389 JGI25151J46595_10038402
390 JGI25161J50226_1000835
391 Ga0055526_1006460
392 Ga0055537_1002374
393 Ga0055524_1002073
394 Ga0055524_1002533
395 Ga0055524_1005230
396 Ga0055536_1000134
397 Ga0055534_1001576
398 Ga0055534_1002439
399 Ga0055530_10001933
400 Ga0055543_1001437
401 Ga0065165_1004653
402 Ga0065165_1013869
403 Ga0070658_10179121
404 Ga0070676_10047775
405 Ga0070683_100017689
406 Ga0070690_100014451
407 Ga0070670_100005362
408 Ga0070670_100028987
409 Ga0070670_100037626
410 Ga0068869_100000106
411 Ga0068869_100016487
412 Ga0068869_100068815
413 Ga0070680_100070604
414 Ga0070680_100126122
415 Ga0068868_100008784
416 Ga0068868_100024020
417 Ga0070660_100005509
418 Ga0070660_100027633
419 Ga0070660_100132541
420 Ga0070689_100025034
421 Ga0070661_100020266
422 Ga0070661_100052636
423 Ga0070661_100105734
424 Ga0070692_10063593
425 Ga0070668_100011697
426 Ga0070668_100014416
427 Ga0070668_100065440
428 Ga0070669_100000995
429 Ga0070669_100064627
430 Ga0070675_100047235
431 Ga0070675_100060882
432 Ga0070675_100148081
433 Ga0070675_100340440
434 Ga0070671_100064651
435 Ga0070671_100184858
436 Ga0070673_100015414
437 Ga0070673_100031370
438 Ga0070667_100000861
439 Ga0070667_100159908
440 Ga0070667_100160301
441 Ga0070701_10012992
442 Ga0070700_100009006
443 Ga0070700_100090817
444 Ga0070662_100075759
445 Ga0068867_100000742
446 Ga0068867_100010377
447 Ga0068867_100164266
448 Ga0068867_100228382
449 Ga0070698_100009492
450 Ga0068853_100166382
451 Ga0070672_100024857
452 Ga0070672_100051058
453 Ga0070672_100123335
454 Ga0070665_100029022
455 Ga0070665_100145120
456 Ga0070704_100222609
457 Ga0068855_100085413
458 Ga0068855_100378172
459 Ga0070664_100012340
460 Ga0070664_100265034
461 Ga0068854_100014861
462 Ga0070702_100013820
463 Ga0070702_100037916
464 Ga0068852_100002785
465 Ga0068859_100000273
466 Ga0068859_100034835
467 Ga0068859_100140283
468 Ga0068864_100000963
469 Ga0068864_100092240
470 Ga0068866_10044936
471 Ga0068861_100002534
472 Ga0068861_100004902
473 Ga0068870_10005790
474 Ga0068870_10112724
475 Ga0068863_100010467
476 Ga0068863_100052150
477 Ga0068858_100013306
478 Ga0068858_100027046
479 Ga0068860_100017893
480 Ga0068862_100003118
481 Ga0068862_100008725
482 Ga0068862_100043133
483 Ga0075363_100020767
484 Ga0075364_10009289
485 Ga0075364_10022937
486 Ga0075362_10043758
487 Ga0075367_10005208
488 Ga0075369_10002991
489 Ga0075369_10005360
490 Ga0075369_10006359
491 Ga0075366_10011139
492 Ga0075366_10013373
493 Ga0075366_10023572
494 Ga0075366_10031818
495 Ga0097621_100047184
496 Ga0075370_10016055
497 Ga0068871_100011520
498 Ga0068871_100111107
499 Ga0075428_100268160
500 Ga0075430_100012580
501 Ga0075430_100050787
502 Ga0075431_100019741
503 Ga0075431_100093331
504 Ga0075431_100100742
505 Ga0075431_100323921
506 Ga0075429_100000015
507 Ga0075429_100001431
508 Ga0075429_100137692
509 Ga0075429_100160873
510 Ga0097620_100000273
511 Ga0097620_100034835
512 Ga0097620_100140282
513 Ga0099826_10000007
514 Ga0099794_10012839
515 Ga0111539_10158327
516 Ga0114129_10002286
517 Ga0114129_10050630
518 Ga0114129_10056195
519 Ga0114129_10300099
520 Ga0105243_10017446
521 Ga0105243_10029716
522 Ga0105243_10211775
523 Ga0105241_10017747
524 Ga0105242_10027042
525 Ga0105242_10086265
526 Ga0105248_10005623
527 Ga0105237_10068023
528 Ga0105238_10324503
529 Ga0105249_10001620
530 Ga0105246_10057403
531 Ga0157373_10130153
532 Ga0157378_10009669
533 Ga0157378_10059018
534 Ga0163162_10005803
535 Ga0163162_10063815
536 Ga0157375_10039512
537 Ga0157375_10324099
538 Ga0163163_10073189
539 Ga0157380_10011934
540 Ga0157380_10028648
541 Ga0157380_10213030
542 Ga0157380_10261486
543 Ga0157377_10010373
544 Ga0157377_10012505
545 Ga0157377_10034527
546 Ga0157377_10047751
547 Ga0157379_10000629
548 Ga0157376_10007184
549 Ga0157376_10066377
550 Ga0157376_10093549
551 Ga0209436_100521
552 Ga0209563_100015
553 Ga0209565_1000104
554 Ga0209565_1001401
555 Ga0209565_1010479
556 Ga0209130_1001287
557 Ga0209675_1000191
558 Ga0209675_1002151
559 Ga0209676_1000036
560 Ga0209025_1000905
561 Ga0209025_1001806
562 Ga0209025_1002048
563 Ga0209564_1000639
564 Ga0209564_1000688
565 Ga0209564_1002275
566 Ga0209564_1004020
567 Ga0209050_1000469
568 Ga0209256_1001092
569 Ga0209256_1001334
570 Ga0209256_1001909
571 Ga0207426_1010077
572 Ga0209051_1026910
573 Ga0207655_1045729
574 Ga0207682_10013444
575 Ga0207642_10071679
576 Ga0207688_10016217
577 Ga0207680_10042399
578 Ga0207645_10011275
579 Ga0207645_10018600
580 Ga0207643_10004615
581 Ga0207705_10101798
582 Ga0207684_10051223
583 Ga0207654_10016090
584 Ga0207671_10030997
585 Ga0207660_10027301
586 Ga0207660_10056327
587 Ga0207662_10013720
588 Ga0207662_10061849
589 Ga0207657_10002609
590 Ga0207649_10009052
591 Ga0207649_10013731
592 Ga0207681_10080811
593 Ga0207650_10004337
594 Ga0207650_10007639
595 Ga0207650_10046549
596 Ga0207650_10208530
597 Ga0207659_10009785
598 Ga0207659_10044984
599 Ga0207659_10103492
600 Ga0207687_10039974
601 Ga0207687_10088779
602 Ga0207644_10019514
603 Ga0207644_10021558
604 Ga0207690_10002750
605 Ga0207690_10003354
606 Ga0207706_10082841
607 Ga0207709_10019286
608 Ga0207709_10154304
609 Ga0207670_10010367
610 Ga0207704_10012882
611 Ga0207704_10076425
612 Ga0207691_10002613
613 Ga0207691_10006268
614 Ga0207689_10000118
615 Ga0207689_10003339
616 Ga0207689_10141217
617 Ga0207679_10000906
618 Ga0207667_10006079
619 Ga0207651_10014268
620 Ga0207651_10019279
621 Ga0207712_10070883
622 Ga0207712_10153066
623 Ga0207668_10022551
624 Ga0207668_10043293
625 Ga0207658_10153632
626 Ga0207677_10022469
627 Ga0207703_10001578
628 Ga0207703_10038294
629 Ga0207703_10188046
630 Ga0207639_10029242
631 Ga0207708_10007316
632 Ga0207648_10000238
633 Ga0207648_10001056
634 Ga0207648_10007566
635 Ga0207648_10029709
636 Ga0207676_10016917
637 Ga0207676_10077609
638 Ga0207674_10026030
639 Ga0207675_100000979
640 Ga0207675_100012412
641 Ga0207675_100099797
642 Ga0207683_10033260
643 Ga0207698_10008426
644 Ga0207698_10075271
645 Ga0209282_1000021
646 Ga0209588_1010205
647 Ga0268266_10255791
648 Ga0268265_10000459
649 Ga0268264_10001039
650 Ga0268264_10244393
651 Ga0265318_10012590
652 Ga0307515_10000020
653 Ga0307511_10017009
654 Ga0316177_1151259
655 Ga0316180_1100674
656 Ga0265332_10002147
657 Ga0265331_10001179
658 Ga0265327_10000235
659 Ga0265327_10011126
660 Ga0265327_10044005
661 Ga0307508_10032307
662 Ga0265314_10000887
663 Ga0307416_100009076
664 Ga0373923_0035349
665 Ga0373960_0014627
666 Ga0373924_0027520
667 Ga0373933_0009629
668 Ga0373937_0049635
669 Ga0395899_0013433
670 Ga0395899_0017193
671 Ga0395899_0045648
672 Ga0395900_0001738
673 Ga0395900_0004356
674 Ga0395898_0016407
675 Ga0395898_0049958
676 Ga0395898_0232929
677 Ga0395905_0054285
678 Ga0395905_0149866
679 Ga0395901_0001782
680 Ga0439441_000604
681 Ga0439448_0001936
682 Ga0439450_002808
683 Ga0439455_0003148
684 Ga0439435_0003266
685 Ga0439460_0021753
686 Ga0466972_0020642
687 Ga0466965_0010530
688 Ga0466965_0024429
689 Ga0466966_0013081
690 Ga0466966_0056758
691 Ga0466961_0000232
692 Ga0466964_0055629
693 Ga0453684_0023507
694 Ga0466971_0104350
695 Ga0466957_0027728
696 Ga0466959_0012677
697 Ga0466959_0036373
698 Ga0466959_0061224
699 Ga0451576_0236095
700 Ga0466967_0008988
701 Ga0495605_0000085
702 Ga0495607_0034853
703 Ga0495583_0000205
704 Ga0495616_0000145
705 Ga0495643_0004391
706 Ga0495643_0015686
707 Ga0495648_0011756
708 Ga0495642_0000973
709 Ga0495598_0001997
710 Ga0495609_0000002
711 Ga0495661_0000271
712 Ga0495661_0000669
713 Ga0495661_0002269
714 Ga0495588_0000135
715 Ga0495669_0069456
716 Ga0495589_0000030
717 Ga0495589_0001070
718 Ga0495660_0000423
719 Ga0495636_0015916
720 Ga0495672_0000833
721 Ga0495687_000047
722 Ga0495687_000112
723 Ga0495687_001101
724 Ga0495687_002457
725 Ga0495677_0000044
726 Ga0495677_0007472
727 Ga0495615_0002476
728 Ga0495626_0000006
729 Ga0495626_0000266
730 Ga0496101_0017179
731 Ga0496102_0028837
732 Ga0496102_0034795
733 Ga0496102_0079152
734 Ga0496108_0226075
735 Ga0496109_0055775
736 Ga0496110_0164352
737 Ga0496111_0138359
738 Ga0496113_0052467
739 Ga0496122_0019569
740 Ga0496123_0005792
741 Ga0501198_000006
742 Ga0501209_002850
743 Ga0501222_000007
744 nmdc:mga03683_5252_c1
745 nmdc:mga03n38_2426_c1
746 nmdc:mga00v17_36998_c1
747 nmdc:mga0k408_14707_c1
748 nmdc:mga0k408_203_c2
749 nmdc:mga0k408_3682_c1
750 nmdc:mga06z11_6653_c1
751 nmdc:mga05p37_109994_c1
752 nmdc:mga05p37_211_c1
753 nmdc:mga09592_221138_c1
754 nmdc:mga09592_311_c1
755 nmdc:mga0qj67_33680_c1
756 nmdc:mga0qj67_8468_c1
757 nmdc:mga06r32_220197_c1
758 nmdc:mga06r32_244778_c1
759 nmdc:mga08y16_103324_c1
760 nmdc:mga0rr50_54374_c1
761 nmdc:mga0sz30_26204_c1
762 Ga0500655_001489
763 Ga0500636_0000086
764 Ga0500625_014769
765 Ga0466962_0017199
766 2808984966
767 2809131853
768 2809151335
769 2852620815
770 2919709066
771 2998346625
772 8047677869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

131

381

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.947 58 430
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.9185 59 431
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.916 58 430
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8813 61 391
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8699 61 391
ID Description Score Start End Superfamily
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9003 58 403 3.40.190.10
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8971 145 251 3.40.190.10
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8664 58 403 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8656 146 251 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.846 144 250 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7X9K6E8-F1-model_v4 deleted 0.9911 123 432
AF-A0A7X9K6E8-F1-model_v4 deleted 0.9879 123 432
AF-H0PXH3-F1-model_v4 Assimilatory nitrate transport system, periplasmic-binding protein 0.9872 49 432 GO:0005886
GO:0012505
AF-A0A2X5CFR1-F1-model_v4 deleted 0.9855 65 366
AF-A0A0Q7XEK8-F1-model_v4 Nitrate transporter 0.9852 59 431 GO:0005886
GO:0012505

Map