F430682

General Info

Members Datasets Scaffolds Average Seq Length
386 278 358 339

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221575|2643885780
Length 380
Sequence LTAPSGFRHSEHEDDARGCGDGCGIRSTQNRHRFANEGLAPVVELTKREGGEDDHHVSTGSLQGWDKVEALTADAYAFGLGETRGLVADYIPILAETDPELFGVCVAEVDGSIHSAGDAAVEFSIQSISKAFVYALVCEELGHDLVKEHVGVNNTGLAFNSVMAIELNYGHPMNPMVNAGALATTALVPGGSPAEQWELIRQGLSRFAGHPLELDGEVYRSEMATNQRNMAIARLLESYRRIEIDPLKVVDVYTKQCALRVSARDIAVMGATLADGGVNPITGEQVVSAAVCRDTLSVLAANGMYERSGEWLFEIGLPGKSGVAGGIVTISPGKAGIGVFSPRLDSAGNSVRGQAATSFLSRSLGLNIFASDVSPTRLEP

Samples

Sample ID Description Type Environment
1 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221566 Microbacterium sp. Root166 Isolate Unclassified
4 2643221572 Leifsonia sp. Root60 Isolate Unclassified
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2643221613 Oerskovia sp. Root22 Isolate Unclassified
7 2643221616 Leifsonia sp. Root227 Isolate Unclassified
8 2643221630 Microbacterium sp. Root322 Isolate Unclassified
9 2643221649 Leifsonia sp. Root4 Isolate Unclassified
10 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
11 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
12 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
13 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
14 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
15 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
16 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
17 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
18 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
19 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
20 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
21 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
22 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
23 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
24 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
25 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
26 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
27 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
28 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
275 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
276 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
277 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
278 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0
Isolates 7.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 0
Rhizoplane 7.25
Rhizosphere 81.09
Stem 0
Stem Tuber 0.26
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1005286 3300001977 Bacteria 2018
2 JGI24743J22301_10004666 3300001991 Bacteria 2245
3 JGI25162J39368_1010040 3300002737 Bacteria 1223
4 JGI25154J39366_1001702 3300002738 Bacteria 7211
5 JGI25164J39214_1000658 3300002772 Bacteria 14139
6 JGI25165J46597_1000005 3300003214 Bacteria 623702
7 rootH2_10009998 3300003320 Bacteria 5926
8 JGI25404J52841_10007563 3300003659 Bacteria 2300
9 Ga0065714_10085576 3300005288 Bacteria 2142
10 Ga0070658_10221679 3300005327 Bacteria 1599
11 Ga0070683_100087079 3300005329 Bacteria 2929
12 Ga0070690_100107175 3300005330 Bacteria 1860
13 Ga0070690_100241154 3300005330 Unclassified 1275
14 Ga0068869_100026450 3300005334 Bacteria 4040
15 Ga0070680_100050860 3300005336 Bacteria 3380
16 Ga0070682_100073871 3300005337 Bacteria 2188
17 Ga0068868_100022734 3300005338 Bacteria 4737
18 Ga0068868_100130323 3300005338 Bacteria 2057
19 Ga0068868_100298189 3300005338 Bacteria 1368
20 Ga0070660_100242227 3300005339 Bacteria 1469
21 Ga0070689_100149788 3300005340 Bacteria 1881
22 Ga0070691_10059957 3300005341 Bacteria 1829
23 Ga0070661_100063836 3300005344 Bacteria 2705
24 Ga0070692_10138388 3300005345 Bacteria 1375
25 Ga0070692_10167341 3300005345 Unclassified 1264
26 Ga0070668_100126531 3300005347 Bacteria 2047
27 Ga0070668_100206927 3300005347 Bacteria 1612
28 Ga0070669_100079456 3300005353 Bacteria 2439
29 Ga0070675_100134071 3300005354 Bacteria 2113
30 Ga0070675_100206924 3300005354 Bacteria 1705
31 Ga0070675_100255111 3300005354 Bacteria 1536
32 Ga0070671_100349175 3300005355 Bacteria 1262
33 Ga0070673_100163093 3300005364 Bacteria 1897
34 Ga0070688_100042006 3300005365 Bacteria 2810
35 Ga0070688_100055596 3300005365 Bacteria 2483
36 Ga0070659_100096203 3300005366 Bacteria 2378
37 Ga0070659_100213959 3300005366 Bacteria 1589
38 Ga0070667_100096587 3300005367 Bacteria 2548
39 Ga0070667_100140476 3300005367 Bacteria 2114
40 Ga0070703_10067021 3300005406 Bacteria 1189
41 Ga0070713_100199344 3300005436 Bacteria 1807
42 Ga0070713_100298959 3300005436 Bacteria 1481
43 Ga0070710_10015183 3300005437 Bacteria 3893
44 Ga0070710_10039608 3300005437 Bacteria 2593
45 Ga0070710_10126102 3300005437 Bacteria 1555
46 Ga0070701_10043038 3300005438 Bacteria 2308
47 Ga0070711_100032631 3300005439 Bacteria 3463
48 Ga0070711_100114782 3300005439 Bacteria 1982
49 Ga0070711_100148659 3300005439 Bacteria 1764
50 Ga0070705_100083417 3300005440 Bacteria 1969
51 Ga0070705_100158867 3300005440 Bacteria 1509
52 Ga0070700_100099577 3300005441 Bacteria 1912
53 Ga0070700_100125277 3300005441 Unclassified 1726
54 Ga0070694_100034047 3300005444 Bacteria 3357
55 Ga0070663_100117596 3300005455 Unclassified 2004
56 Ga0070678_100098817 3300005456 Bacteria 2257
57 Ga0070662_100125865 3300005457 Bacteria 1970
58 Ga0070662_100159251 3300005457 Bacteria 1765
59 Ga0070681_10029252 3300005458 Bacteria 5531
60 Ga0068867_100045964 3300005459 Bacteria 3205
61 Ga0068867_100125338 3300005459 Bacteria 1990
62 Ga0070685_10033414 3300005466 Bacteria 2890
63 Ga0070685_10135226 3300005466 Bacteria 1546
64 Ga0070679_100093474 3300005530 Bacteria 2995
65 Ga0070684_100168737 3300005535 Bacteria 1987
66 Ga0068853_100202073 3300005539 Bacteria 1809
67 Ga0070672_100207283 3300005543 Unclassified 1641
68 Ga0070695_100097252 3300005545 Bacteria 1977
69 Ga0070695_100120574 3300005545 Bacteria 1793
70 Ga0070696_100055483 3300005546 Bacteria 2762
71 Ga0070696_100120367 3300005546 Bacteria 1899
72 Ga0070693_100046755 3300005547 Bacteria 2459
73 Ga0070665_100233042 3300005548 Bacteria 1841
74 Ga0070665_100271296 3300005548 Bacteria 1698
75 Ga0070704_100170964 3300005549 Bacteria 1728
76 Ga0070704_100182336 3300005549 Bacteria 1680
77 Ga0068855_100444792 3300005563 Bacteria 1415
78 Ga0068857_100123414 3300005577 Bacteria 2333
79 Ga0068854_100040993 3300005578 Bacteria 3269
80 Ga0068854_100050498 3300005578 Bacteria 2976
81 Ga0068854_100119021 3300005578 Bacteria 2002
82 Ga0070702_100075833 3300005615 Bacteria 2000
83 Ga0070702_100080872 3300005615 Bacteria 1945
84 Ga0070702_100117475 3300005615 Bacteria 1659
85 Ga0068852_100095944 3300005616 Bacteria 2664
86 Ga0068852_100158070 3300005616 Bacteria 2113
87 Ga0068859_100080312 3300005617 Bacteria 3302
88 Ga0068859_100254272 3300005617 Bacteria 1847
89 Ga0068859_100341121 3300005617 Bacteria 1592
90 Ga0068864_100040667 3300005618 Bacteria 3976
91 Ga0068864_100317991 3300005618 Bacteria 1461
92 Ga0068866_10211500 3300005718 Bacteria 1165
93 Ga0068861_100094200 3300005719 Unclassified 2369
94 Ga0068861_100155360 3300005719 Bacteria 1881
95 Ga0068858_100048638 3300005842 Bacteria 3928
96 Ga0068858_100158381 3300005842 Bacteria 2131
97 Ga0068860_100274397 3300005843 Unclassified 1646
98 Ga0068862_100178207 3300005844 Bacteria 1906
99 Ga0081540_1000487 3300005983 Bacteria 38975
100 Ga0070715_10045678 3300006163 Bacteria 1858
101 Ga0070712_100008907 3300006175 Bacteria 6322
102 Ga0070712_100082332 3300006175 Bacteria 2334
103 Ga0097621_100173297 3300006237 Bacteria 1861
104 Ga0097621_100268666 3300006237 Bacteria 1498
105 Ga0097621_100321160 3300006237 Bacteria 1371
106 Ga0068865_100095574 3300006881 Bacteria 2165
107 Ga0068865_100331807 3300006881 Bacteria 1227
108 Ga0097620_100080313 3300006931 Bacteria 3302
109 Ga0097620_100254257 3300006931 Bacteria 1847
110 Ga0097620_100341102 3300006931 Bacteria 1592
111 Ga0105250_10099639 3300009092 Bacteria 1185
112 Ga0105240_10217540 3300009093 Bacteria 2228
113 Ga0105245_10181973 3300009098 Bacteria 2009
114 Ga0105245_10275730 3300009098 Bacteria 1642
115 Ga0105247_10018001 3300009101 Bacteria 4238
116 Ga0105247_10052379 3300009101 Bacteria 2516
117 Ga0105243_10084012 3300009148 Bacteria 2606
118 Ga0105243_10144098 3300009148 Bacteria 2036
119 Ga0105243_10333373 3300009148 Bacteria 1387
120 Ga0105241_10193966 3300009174 Bacteria 1692
121 Ga0105242_10064335 3300009176 Bacteria 3023
122 Ga0105248_10198007 3300009177 Bacteria 2264
123 Ga0105248_10233434 3300009177 Bacteria 2071
124 Ga0105237_10213346 3300009545 Bacteria 1930
125 Ga0105237_10257924 3300009545 Unclassified 1746
126 Ga0105238_10213018 3300009551 Bacteria 1908
127 Ga0105238_10294212 3300009551 Bacteria 1606
128 Ga0105249_10175114 3300009553 Bacteria 2083
129 Ga0105249_10178639 3300009553 Bacteria 2063
130 Ga0105239_10109875 3300010375 Bacteria 3056
131 Ga0105239_10201243 3300010375 Unclassified 2231
132 Ga0105246_10018882 3300011119 Bacteria 4397
133 Ga0105246_10104814 3300011119 Bacteria 2066
134 Ga0157347_1001950 3300012502 Bacteria 1705
135 Ga0157371_10077558 3300013102 Bacteria 2353
136 Ga0157374_10048525 3300013296 Bacteria 3939
137 Ga0157374_10247045 3300013296 Bacteria 1755
138 Ga0157374_10456670 3300013296 Bacteria 1279
139 Ga0157378_10041895 3300013297 Bacteria 4062
140 Ga0157378_10228340 3300013297 Bacteria 1772
141 Ga0163162_10122037 3300013306 Bacteria 2711
142 Ga0163162_10140522 3300013306 Bacteria 2528
143 Ga0163162_10373796 3300013306 Bacteria 1558
144 Ga0157372_10261161 3300013307 Bacteria 2011
145 Ga0157375_10349381 3300013308 Bacteria 1645
146 Ga0163163_10069068 3300014325 Bacteria 3517
147 Ga0163163_10106087 3300014325 Bacteria 2835
148 Ga0163163_10243057 3300014325 Bacteria 1850
149 Ga0157380_10242963 3300014326 Bacteria 1624
150 Ga0157377_10084238 3300014745 Bacteria 1864
151 Ga0157377_10213310 3300014745 Bacteria 1232
152 Ga0157379_10440961 3300014968 Unclassified 1201
153 Ga0157376_10172401 3300014969 Bacteria 1971
154 Ga0157376_10398820 3300014969 Bacteria 1330
155 Ga0163161_10062105 3300017792 Bacteria 2721
156 Ga0163161_10095724 3300017792 Bacteria 2203
157 Ga0207427_100028 3300025231 Bacteria 388949
158 Ga0209437_100211 3300025233 Bacteria 108544
159 Ga0209646_1000092 3300025246 Bacteria 185930
160 Ga0209233_1000001 3300025261 Bacteria 2992747
161 Ga0207653_10034423 3300025885 Bacteria 1645
162 Ga0207692_10065631 3300025898 Bacteria 1894
163 Ga0207692_10146647 3300025898 Bacteria 1347
164 Ga0207642_10051558 3300025899 Bacteria 1862
165 Ga0207710_10049682 3300025900 Bacteria 1880
166 Ga0207688_10044556 3300025901 Bacteria 2472
167 Ga0207688_10062356 3300025901 Bacteria 2102
168 Ga0207680_10326212 3300025903 Bacteria 1074
169 Ga0207685_10063128 3300025905 Bacteria 1474
170 Ga0207685_10132226 3300025905 Bacteria 1109
171 Ga0207654_10165074 3300025911 Bacteria 1433
172 Ga0207671_10118125 3300025914 Bacteria 2025
173 Ga0207693_10007872 3300025915 Bacteria 8752
174 Ga0207693_10084211 3300025915 Bacteria 2491
175 Ga0207663_10110748 3300025916 Bacteria 1862
176 Ga0207663_10115296 3300025916 Bacteria 1830
177 Ga0207662_10035700 3300025918 Bacteria 2904
178 Ga0207657_10208055 3300025919 Bacteria 1571
179 Ga0207649_10067195 3300025920 Bacteria 2275
180 Ga0207681_10041212 3300025923 Bacteria 3078
181 Ga0207687_10207295 3300025927 Bacteria 1536
182 Ga0207700_10065189 3300025928 Bacteria 2778
183 Ga0207664_10022253 3300025929 Bacteria 4730
184 Ga0207644_10163005 3300025931 Bacteria 1734
185 Ga0207690_10091063 3300025932 Bacteria 2155
186 Ga0207706_10031088 3300025933 Bacteria 4758
187 Ga0207706_10064247 3300025933 Bacteria 3231
188 Ga0207706_10065881 3300025933 Bacteria 3188
189 Ga0207686_10078525 3300025934 Bacteria 2147
190 Ga0207709_10188111 3300025935 Bacteria 1464
191 Ga0207669_10064164 3300025937 Bacteria 2271
192 Ga0207704_10088372 3300025938 Unclassified 2027
193 Ga0207704_10143403 3300025938 Bacteria 1674
194 Ga0207704_10165704 3300025938 Bacteria 1578
195 Ga0207665_10006623 3300025939 Bacteria 7685
196 Ga0207665_10015897 3300025939 Bacteria 4941
197 Ga0207665_10024492 3300025939 Bacteria 3979
198 Ga0207689_10017789 3300025942 Bacteria 6006
199 Ga0207689_10033748 3300025942 Bacteria 4251
200 Ga0207689_10059801 3300025942 Bacteria 3134
201 Ga0207679_10121063 3300025945 Bacteria 2083
202 Ga0207712_10163458 3300025961 Bacteria 1733
203 Ga0207668_10207284 3300025972 Bacteria 1565
204 Ga0207640_10190830 3300025981 Bacteria 1544
205 Ga0207658_10112610 3300025986 Bacteria 2154
206 Ga0207677_10016470 3300026023 Bacteria 4381
207 Ga0207677_10119637 3300026023 Bacteria 1978
208 Ga0207639_10098142 3300026041 Bacteria 2360
209 Ga0207639_10208413 3300026041 Bacteria 1681
210 Ga0207678_10005119 3300026067 Bacteria 11759
211 Ga0207678_10105441 3300026067 Unclassified 2405
212 Ga0207708_10096462 3300026075 Bacteria 2285
213 Ga0207708_10149987 3300026075 Bacteria 1834
214 Ga0207641_10039260 3300026088 Bacteria 3959
215 Ga0207648_10008805 3300026089 Bacteria 9722
216 Ga0207648_10062339 3300026089 Bacteria 3250
217 Ga0207674_10063502 3300026116 Bacteria 3728
218 Ga0207675_100112496 3300026118 Bacteria 2570
219 Ga0207675_100205046 3300026118 Bacteria 1895
220 Ga0207675_100325337 3300026118 Bacteria 1502
221 Ga0207683_10018398 3300026121 Bacteria 5962
222 Ga0207683_10176561 3300026121 Bacteria 1936
223 Ga0207698_10182001 3300026142 Bacteria 1862
224 Ga0268266_10087924 3300028379 Bacteria 2720
225 Ga0268266_10226929 3300028379 Bacteria 1719
226 Ga0268265_10067939 3300028380 Bacteria 2761
227 Ga0268264_10166335 3300028381 Bacteria 1991
228 Ga0307406_10000101 3300031901 Bacteria 49370
229 Ga0307409_100140052 3300031995 Bacteria 2083
230 Ga0307415_100029662 3300032126 Bacteria 3499
231 Ga0373930_0006918 3300034816 Bacteria 1934
232 Ga0373926_0004607 3300035083 Bacteria 4525
233 Ga0373934_0003014 3300035086 Bacteria 6154
234 Ga0373944_0016496 3300035089 Bacteria 2084
235 Ga0373932_0004221 3300035112 Bacteria 3414
236 Ga0373936_0009724 3300035113 Bacteria 3627
237 Ga0373945_0016516 3300035116 Bacteria 2490
238 Ga0373953_0097055 3300035117 Bacteria 1237
239 Ga0373954_0088944 3300035118 Bacteria 1481
240 Ga0373956_0020901 3300035119 Bacteria 2790
241 Ga0373957_0003543 3300035120 Bacteria 4631
242 Ga0373943_0001529 3300035170 Bacteria 10470
243 Ga0373955_0001588 3300035172 Bacteria 9720
244 Ga0373942_0021658 3300035207 Bacteria 1624
245 Ga0316574_0110061 3300035398 Bacteria 1765
246 Ga0373924_0000085 3300035410 Bacteria 25341
247 Ga0373931_0072675 3300035691 Bacteria 1881
248 Ga0373927_0007572 3300035695 Bacteria 7348
249 Ga0373933_0003231 3300035724 Bacteria 9103
250 Ga0373947_0004578 3300035725 Bacteria 8112
251 Ga0373947_0094877 3300035725 Unclassified 1866
252 Ga0373937_0373189 3300036401 Unclassified 1352
253 Ga0373925_0007677 3300037068 Bacteria 7858
254 Ga0436361_0267822 3300039447 Bacteria 3076
255 Ga0466970_0027213 3300044765 Bacteria 2999
256 Ga0466960_0017615 3300044901 Bacteria 3118
257 Ga0495627_005060 3300046453 Bacteria 5389
258 Ga0495603_0007258 3300046455 Bacteria 6656
259 Ga0495653_0006255 3300046463 Bacteria 9769
260 Ga0495580_0013865 3300046472 Bacteria 6138
261 Ga0495582_0012944 3300046473 Bacteria 4596
262 Ga0495639_0017121 3300046475 Bacteria 3147
263 Ga0495664_0010231 3300046477 Bacteria 5262
264 Ga0495594_0007230 3300046499 Bacteria 5711
265 Ga0495606_0000578 3300046507 Bacteria 58225
266 Ga0495608_0163871 3300046511 Bacteria 1412
267 Ga0495618_0039227 3300046514 Bacteria 2977
268 Ga0495628_0022239 3300046516 Bacteria 5211
269 Ga0495630_0086203 3300046517 Bacteria 2371
270 Ga0495666_0035403 3300046526 Bacteria 2434
271 Ga0495652_0057386 3300046529 Bacteria 3301
272 Ga0495665_0008167 3300046531 Bacteria 5676
273 Ga0495640_0064644 3300046533 Bacteria 2472
274 Ga0495586_0013174 3300046535 Bacteria 4383
275 Ga0495586_0125699 3300046535 Bacteria 1434
276 Ga0495587_0148416 3300046536 Bacteria 1336
277 Ga0495645_0183681 3300046543 Bacteria 1430
278 Ga0495668_0002025 3300046616 Bacteria 17678
279 Ga0495625_0000749 3300046660 Bacteria 45382
280 Ga0495623_0041177 3300046679 Bacteria 2948
281 Ga0495646_0001369 3300046680 Bacteria 14434
282 Ga0495647_0010788 3300046681 Bacteria 3119
283 Ga0495658_0002174 3300046683 Bacteria 9917
284 Ga0495613_0008527 3300046689 Bacteria 7606
285 Ga0495624_0024908 3300046690 Bacteria 3936
286 Ga0495600_0005286 3300046809 Bacteria 7776
287 Ga0495604_0107484 3300047317 Bacteria 2039
288 Ga0495674_0012579 3300047319 Bacteria 7972
289 Ga0495674_0037261 3300047319 Bacteria 4369
290 Ga0495676_0003136 3300047321 Bacteria 14948
291 Ga0495680_0057692 3300047322 Bacteria 3001
292 Ga0495683_0042443 3300047323 Bacteria 2293
293 Ga0495684_0008285 3300047471 Bacteria 8049
294 Ga0495593_0005433 3300047673 Bacteria 7526
295 Ga0495614_0026344 3300048089 Bacteria 2505
296 Ga0495626_0000046 3300048091 Bacteria 162660
297 Ga0496100_0171043 3300048903 Bacteria 1565
298 Ga0496101_0188857 3300048904 Bacteria 1589
299 Ga0496102_0031731 3300048905 Bacteria 4742
300 Ga0496102_0215325 3300048905 Bacteria 1810
301 Ga0496102_0237822 3300048905 Bacteria 1717
302 Ga0496102_0460769 3300048905 Bacteria 1192
303 Ga0496103_0066410 3300048906 Bacteria 2251
304 Ga0496104_0050340 3300048907 Bacteria 3930
305 Ga0496105_0068520 3300048908 Bacteria 2931
306 Ga0496105_0109869 3300048908 Bacteria 2276
307 Ga0496105_0218489 3300048908 Bacteria 1552
308 Ga0496106_0072571 3300048909 Bacteria 2632
309 Ga0496106_0119314 3300048909 Bacteria 2060
310 Ga0496106_0333413 3300048909 Bacteria 1218
311 Ga0496107_0073401 3300048910 Bacteria 2488
312 Ga0496107_0121495 3300048910 Bacteria 1924
313 Ga0496108_0000807 3300048911 Bacteria 24310
314 Ga0496109_0001725 3300048912 Bacteria 18234
315 Ga0496110_0028552 3300048913 Bacteria 4793
316 Ga0496110_0063745 3300048913 Bacteria 3257
317 Ga0496111_0176183 3300048914 Bacteria 1589
318 Ga0496112_0300260 3300048915 Bacteria 1551
319 Ga0496113_0081271 3300048916 Bacteria 2483
320 Ga0496114_0058877 3300048917 Bacteria 3208
321 Ga0496114_0095144 3300048917 Bacteria 2534
322 Ga0496114_0098870 3300048917 Bacteria 2488
323 Ga0496115_0151645 3300048918 Bacteria 1914
324 Ga0496115_0212562 3300048918 Bacteria 1597
325 Ga0496117_0001098 3300048920 Bacteria 40887
326 Ga0496117_0010419 3300048920 Bacteria 8478
327 Ga0496117_0169949 3300048920 Bacteria 1266
328 Ga0496118_0052036 3300048921 Bacteria 3128
329 Ga0496122_0000756 3300048925 Bacteria 62664
330 Ga0496122_0125053 3300048925 Bacteria 1648
331 Ga0496123_0000172 3300048926 Bacteria 130598
332 Ga0496124_0001516 3300048927 Bacteria 33813
333 Ga0496125_0000640 3300048928 Bacteria 58381
334 Ga0496125_0023376 3300048928 Bacteria 5706
335 Ga0496125_0041918 3300048928 Bacteria 3907
336 Ga0496126_0001762 3300048929 Bacteria 32014
337 Ga0496126_0002423 3300048929 Bacteria 25250
338 Ga0496126_0038783 3300048929 Bacteria 4428
339 Ga0496126_0239578 3300048929 Bacteria 1516
340 Ga0501032_0067328 3300049569 Bacteria 2392
341 Ga0501033_0020843 3300049570 Bacteria 4949
342 Ga0501034_0108185 3300049571 Bacteria 2771
343 Ga0501034_0198298 3300049571 Bacteria 1966
344 Ga0501036_0098340 3300049572 Bacteria 2474
345 Ga0501038_0029962 3300049574 Bacteria 4818
346 Ga0501039_0173990 3300049575 Bacteria 1693
347 Ga0501047_0057724 3300049581 Bacteria 3753
348 Ga0501044_0034817 3300049823 Bacteria 5279
349 Ga0501044_0104649 3300049823 Bacteria 2844
350 Ga0495601_0024584 3300053077 Bacteria 3711
351 Ga0495612_0002609 3300053078 Bacteria 7437
352 Ga0500635_0000016 3300053080 Bacteria 124879
353 Ga0495595_0064010 3300053084 Bacteria 1727
354 Ga0495619_0006660 3300053085 Bacteria 7310
355 Ga0500556_0000467 3300053104 Bacteria 28516
356 Ga0500568_0001019 3300053139 Bacteria 19182
357 Ga0500616_0000113 3300053153 Bacteria 150722
358 Ga0500616_0000701 3300053153 Bacteria 38992

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0460769 Ga0496102_0460769_30_1016 300
2 3300026067 Ga0207678_10005119 Ga0207678_1000511910 307
3 3300034816 Ga0373930_0006918 Ga0373930_0006918_935_1861 307
4 3300035725 Ga0373947_0094877 Ga0373947_0094877_924_1850 307
5 3300046455 Ga0495603_0007258 Ga0495603_0007258_40_966 307
6 3300046477 Ga0495664_0010231 Ga0495664_0010231_3646_4572 307
7 3300046516 Ga0495628_0022239 Ga0495628_0022239_1534_2460 307
8 3300046531 Ga0495665_0008167 Ga0495665_0008167_4691_5617 307
9 3300046535 Ga0495586_0125699 Ga0495586_0125699_21_947 307
10 3300047319 Ga0495674_0012579 Ga0495674_0012579_5949_6875 307
11 3300053077 Ga0495601_0024584 Ga0495601_0024584_825_1751 307
12 3300053104 Ga0500556_0000467 Ga0500556_0000467_6074_7033 317
13 3300046453 Ga0495627_005060 Ga0495627_005060_4383_5378 319
14 3300053153 Ga0500616_0000701 Ga0500616_0000701_23965_25002 319
15 iso_pu_bacteria 2932431166 2932431818 322
16 3300014325 Ga0163163_10069068 Ga0163163_100690684 323
17 3300031995 Ga0307409_100140052 Ga0307409_1001400522 323
18 3300032126 Ga0307415_100029662 Ga0307415_1000296624 323
19 3300039447 Ga0436361_0267822 Ga0436361_0267822_1804_2790 323
20 iso_pu_bacteria 2939657138 2939659555 325
21 3300048920 Ga0496117_0001098 Ga0496117_0001098_31237_32253 326
22 3300048925 Ga0496122_0125053 Ga0496122_0125053_505_1521 326
23 3300048928 Ga0496125_0000640 Ga0496125_0000640_27638_28654 326
24 3300048928 Ga0496125_0023376 Ga0496125_0023376_2920_3936 326
25 3300048929 Ga0496126_0002423 Ga0496126_0002423_24023_25039 326
26 3300048929 Ga0496126_0239578 Ga0496126_0239578_26_1042 326
27 3300049823 Ga0501044_0104649 Ga0501044_0104649_110_1123 326
28 iso_pu_bacteria 2554235227 2555230350 326
29 iso_pu_bacteria 2643221572 2643875651 326
30 iso_pu_bacteria 2643221669 2644382706 326
31 iso_pu_bacteria 2654587600 2655033945 326
32 iso_pu_bacteria 2747842429 2747952859 326
33 iso_pu_bacteria 2857723135 2857723835 326
34 iso_pu_bacteria 2945968032 2945971183 326
35 iso_pu_bacteria 2995726249 2995727483 326
36 iso_pu_bacteria 8001781756 8001787047 326
37 iso_pu_bacteria 8055034563 8055037811 326
38 3300003320 rootH2_10009998 rootH2_100099982 327
39 3300003659 JGI25404J52841_10007563 JGI25404J52841_100075632 327
40 3300005327 Ga0070658_10221679 Ga0070658_102216793 327
41 3300005329 Ga0070683_100087079 Ga0070683_1000870793 327
42 3300005330 Ga0070690_100241154 Ga0070690_1002411542 327
43 3300005336 Ga0070680_100050860 Ga0070680_1000508604 327
44 3300005338 Ga0068868_100298189 Ga0068868_1002981892 327
45 3300005344 Ga0070661_100063836 Ga0070661_1000638363 327
46 3300005354 Ga0070675_100206924 Ga0070675_1002069243 327
47 3300005355 Ga0070671_100349175 Ga0070671_1003491752 327
48 3300005366 Ga0070659_100096203 Ga0070659_1000962034 327
49 3300005367 Ga0070667_100140476 Ga0070667_1001404762 327
50 3300005436 Ga0070713_100199344 Ga0070713_1001993442 327
51 3300005436 Ga0070713_100298959 Ga0070713_1002989591 327
52 3300005437 Ga0070710_10126102 Ga0070710_101261022 327
53 3300005439 Ga0070711_100148659 Ga0070711_1001486592 327
54 3300005440 Ga0070705_100083417 Ga0070705_1000834172 327
55 3300005444 Ga0070694_100034047 Ga0070694_1000340474 327
56 3300005458 Ga0070681_10029252 Ga0070681_100292523 327
57 3300005530 Ga0070679_100093474 Ga0070679_1000934743 327
58 3300005535 Ga0070684_100168737 Ga0070684_1001687373 327
59 3300005545 Ga0070695_100120574 Ga0070695_1001205741 327
60 3300005546 Ga0070696_100120367 Ga0070696_1001203672 327
61 3300005548 Ga0070665_100271296 Ga0070665_1002712962 327
62 3300005549 Ga0070704_100170964 Ga0070704_1001709642 327
63 3300005577 Ga0068857_100123414 Ga0068857_1001234142 327
64 3300005578 Ga0068854_100050498 Ga0068854_1000504984 327
65 3300005615 Ga0070702_100075833 Ga0070702_1000758333 327
66 3300005616 Ga0068852_100095944 Ga0068852_1000959443 327
67 3300005617 Ga0068859_100080312 Ga0068859_1000803124 327
68 3300005618 Ga0068864_100040667 Ga0068864_1000406673 327
69 3300005718 Ga0068866_10211500 Ga0068866_102115002 327
70 3300005983 Ga0081540_1000487 Ga0081540_100048725 327
71 3300006237 Ga0097621_100321160 Ga0097621_1003211602 327
72 3300006881 Ga0068865_100331807 Ga0068865_1003318072 327
73 3300006931 Ga0097620_100080313 Ga0097620_1000803134 327
74 3300009093 Ga0105240_10217540 Ga0105240_102175403 327
75 3300009098 Ga0105245_10275730 Ga0105245_102757303 327
76 3300009148 Ga0105243_10333373 Ga0105243_103333732 327
77 3300009551 Ga0105238_10294212 Ga0105238_102942122 327
78 3300011119 Ga0105246_10104814 Ga0105246_101048142 327
79 3300012502 Ga0157347_1001950 Ga0157347_10019502 327
80 3300013102 Ga0157371_10077558 Ga0157371_100775583 327
81 3300013296 Ga0157374_10456670 Ga0157374_104566701 327
82 3300013306 Ga0163162_10373796 Ga0163162_103737962 327
83 3300014325 Ga0163163_10106087 Ga0163163_101060873 327
84 3300014969 Ga0157376_10398820 Ga0157376_103988202 327
85 3300025885 Ga0207653_10034423 Ga0207653_100344232 327
86 3300025898 Ga0207692_10065631 Ga0207692_100656311 327
87 3300025901 Ga0207688_10044556 Ga0207688_100445563 327
88 3300025903 Ga0207680_10326212 Ga0207680_103262121 327
89 3300025905 Ga0207685_10132226 Ga0207685_101322261 327
90 3300025918 Ga0207662_10035700 Ga0207662_100357002 327
91 3300025919 Ga0207657_10208055 Ga0207657_102080552 327
92 3300025920 Ga0207649_10067195 Ga0207649_100671953 327
93 3300025928 Ga0207700_10065189 Ga0207700_100651893 327
94 3300025929 Ga0207664_10022253 Ga0207664_100222532 327
95 3300025931 Ga0207644_10163005 Ga0207644_101630051 327
96 3300025933 Ga0207706_10064247 Ga0207706_100642473 327
97 3300025938 Ga0207704_10143403 Ga0207704_101434032 327
98 3300025939 Ga0207665_10015897 Ga0207665_100158973 327
99 3300025942 Ga0207689_10059801 Ga0207689_100598015 327
100 3300025945 Ga0207679_10121063 Ga0207679_101210632 327
101 3300026041 Ga0207639_10098142 Ga0207639_100981423 327
102 3300026116 Ga0207674_10063502 Ga0207674_100635023 327
103 3300026118 Ga0207675_100205046 Ga0207675_1002050463 327
104 3300026121 Ga0207683_10018398 Ga0207683_100183986 327
105 3300035083 Ga0373926_0004607 Ga0373926_0004607_2846_3856 327
106 3300035086 Ga0373934_0003014 Ga0373934_0003014_632_1636 327
107 3300035089 Ga0373944_0016496 Ga0373944_0016496_846_1856 327
108 3300035112 Ga0373932_0004221 Ga0373932_0004221_111_1115 327
109 3300035113 Ga0373936_0009724 Ga0373936_0009724_2297_3307 327
110 3300035116 Ga0373945_0016516 Ga0373945_0016516_154_1164 327
111 3300035117 Ga0373953_0097055 Ga0373953_0097055_168_1178 327
112 3300035118 Ga0373954_0088944 Ga0373954_0088944_236_1246 327
113 3300035119 Ga0373956_0020901 Ga0373956_0020901_693_1703 327
114 3300035120 Ga0373957_0003543 Ga0373957_0003543_766_1770 327
115 3300035170 Ga0373943_0001529 Ga0373943_0001529_998_2008 327
116 3300035172 Ga0373955_0001588 Ga0373955_0001588_2438_3448 327
117 3300035207 Ga0373942_0021658 Ga0373942_0021658_534_1544 327
118 3300035410 Ga0373924_0000085 Ga0373924_0000085_23510_24520 327
119 3300035695 Ga0373927_0007572 Ga0373927_0007572_5681_6691 327
120 3300035724 Ga0373933_0003231 Ga0373933_0003231_143_1153 327
121 3300035725 Ga0373947_0004578 Ga0373947_0004578_6283_7293 327
122 3300036401 Ga0373937_0373189 Ga0373937_0373189_109_1119 327
123 3300037068 Ga0373925_0007677 Ga0373925_0007677_382_1392 327
124 3300046463 Ga0495653_0006255 Ga0495653_0006255_7241_8251 327
125 3300046472 Ga0495580_0013865 Ga0495580_0013865_4334_5344 327
126 3300046473 Ga0495582_0012944 Ga0495582_0012944_254_1264 327
127 3300046475 Ga0495639_0017121 Ga0495639_0017121_1643_2647 327
128 3300046499 Ga0495594_0007230 Ga0495594_0007230_3066_4076 327
129 3300046511 Ga0495608_0163871 Ga0495608_0163871_231_1241 327
130 3300046514 Ga0495618_0039227 Ga0495618_0039227_1155_2159 327
131 3300046517 Ga0495630_0086203 Ga0495630_0086203_517_1527 327
132 3300046526 Ga0495666_0035403 Ga0495666_0035403_434_1444 327
133 3300046529 Ga0495652_0057386 Ga0495652_0057386_776_1786 327
134 3300046533 Ga0495640_0064644 Ga0495640_0064644_186_1196 327
135 3300046535 Ga0495586_0013174 Ga0495586_0013174_2881_3891 327
136 3300046536 Ga0495587_0148416 Ga0495587_0148416_160_1170 327
137 3300046543 Ga0495645_0183681 Ga0495645_0183681_141_1145 327
138 3300046679 Ga0495623_0041177 Ga0495623_0041177_1607_2617 327
139 3300046680 Ga0495646_0001369 Ga0495646_0001369_3507_4517 327
140 3300046681 Ga0495647_0010788 Ga0495647_0010788_1214_2224 327
141 3300046683 Ga0495658_0002174 Ga0495658_0002174_2870_3874 327
142 3300046689 Ga0495613_0008527 Ga0495613_0008527_5854_6864 327
143 3300046690 Ga0495624_0024908 Ga0495624_0024908_234_1244 327
144 3300046809 Ga0495600_0005286 Ga0495600_0005286_5251_6261 327
145 3300047317 Ga0495604_0107484 Ga0495604_0107484_237_1247 327
146 3300047319 Ga0495674_0037261 Ga0495674_0037261_2397_3407 327
147 3300047321 Ga0495676_0003136 Ga0495676_0003136_744_1754 327
148 3300047322 Ga0495680_0057692 Ga0495680_0057692_1758_2768 327
149 3300047471 Ga0495684_0008285 Ga0495684_0008285_692_1702 327
150 3300047673 Ga0495593_0005433 Ga0495593_0005433_254_1264 327
151 3300048089 Ga0495614_0026344 Ga0495614_0026344_769_1779 327
152 3300048905 Ga0496102_0215325 Ga0496102_0215325_328_1332 327
153 3300048907 Ga0496104_0050340 Ga0496104_0050340_2060_3064 327
154 3300048908 Ga0496105_0068520 Ga0496105_0068520_795_1805 327
155 3300048908 Ga0496105_0109869 Ga0496105_0109869_460_1452 327
156 3300048910 Ga0496107_0073401 Ga0496107_0073401_347_1357 327
157 3300048913 Ga0496110_0028552 Ga0496110_0028552_2431_3435 327
158 3300048916 Ga0496113_0081271 Ga0496113_0081271_1074_2084 327
159 3300048917 Ga0496114_0095144 Ga0496114_0095144_232_1224 327
160 3300048918 Ga0496115_0212562 Ga0496115_0212562_424_1428 327
161 3300048920 Ga0496117_0169949 Ga0496117_0169949_60_1058 327
162 3300048921 Ga0496118_0052036 Ga0496118_0052036_2047_3096 327
163 3300048928 Ga0496125_0041918 Ga0496125_0041918_63_1076 327
164 3300048929 Ga0496126_0001762 Ga0496126_0001762_22625_23674 327
165 3300049574 Ga0501038_0029962 Ga0501038_0029962_1331_2335 327
166 3300053078 Ga0495612_0002609 Ga0495612_0002609_5272_6276 327
167 3300053084 Ga0495595_0064010 Ga0495595_0064010_292_1302 327
168 3300053085 Ga0495619_0006660 Ga0495619_0006660_206_1216 327
169 iso_pu_bacteria 2585428157 2588108555 327
170 iso_pu_bacteria 2643221566 2643847645 327
171 iso_pu_bacteria 2910809715 2910813653 327
172 iso_pu_bacteria 2946041624 2946041752 327
173 iso_pu_bacteria 8045830549 8045832015 327
174 iso_pu_bacteria 8055037949 8055039095 327
175 3300005618 Ga0068864_100317991 Ga0068864_1003179912 328
176 3300044765 Ga0466970_0027213 Ga0466970_0027213_229_1278 328
177 3300044901 Ga0466960_0017615 Ga0466960_0017615_209_1258 328
178 3300048905 Ga0496102_0031731 Ga0496102_0031731_2874_3872 328
179 3300048909 Ga0496106_0333413 Ga0496106_0333413_19_1017 328
180 3300048920 Ga0496117_0010419 Ga0496117_0010419_1355_2428 328
181 3300053153 Ga0500616_0000113 Ga0500616_0000113_148648_149667 328
182 iso_pu_bacteria 2643221575 2643885780 328
183 3300035398 Ga0316574_0110061 Ga0316574_0110061_503_1522 329
184 3300049569 Ga0501032_0067328 Ga0501032_0067328_423_1436 329
185 3300049570 Ga0501033_0020843 Ga0501033_0020843_2697_3710 329
186 3300049571 Ga0501034_0108185 Ga0501034_0108185_469_1482 329
187 3300049571 Ga0501034_0198298 Ga0501034_0198298_140_1153 329
188 3300049572 Ga0501036_0098340 Ga0501036_0098340_972_1985 329
189 3300049575 Ga0501039_0173990 Ga0501039_0173990_117_1130 329
190 iso_pu_bacteria 2643221616 2644097759 329
191 iso_pu_bacteria 2643221649 2644278537 329
192 3300002738 JGI25154J39366_1001702 JGI25154J39366_10017026 330
193 3300025246 Ga0209646_1000092 Ga0209646_100009258 330
194 3300048917 Ga0496114_0058877 Ga0496114_0058877_1864_2892 330
195 3300048925 Ga0496122_0000756 Ga0496122_0000756_42877_43890 330
196 3300048926 Ga0496123_0000172 Ga0496123_0000172_52019_53032 330
197 3300048927 Ga0496124_0001516 Ga0496124_0001516_9551_10564 330
198 3300005330 Ga0070690_100107175 Ga0070690_1001071752 331
199 3300005338 Ga0068868_100022734 Ga0068868_1000227342 331
200 3300005338 Ga0068868_100130323 Ga0068868_1001303231 331
201 3300005339 Ga0070660_100242227 Ga0070660_1002422271 331
202 3300005340 Ga0070689_100149788 Ga0070689_1001497881 331
203 3300005341 Ga0070691_10059957 Ga0070691_100599572 331
204 3300005345 Ga0070692_10138388 Ga0070692_101383881 331
205 3300005345 Ga0070692_10167341 Ga0070692_101673411 331
206 3300005347 Ga0070668_100126531 Ga0070668_1001265311 331
207 3300005353 Ga0070669_100079456 Ga0070669_1000794563 331
208 3300005354 Ga0070675_100255111 Ga0070675_1002551112 331
209 3300005364 Ga0070673_100163093 Ga0070673_1001630932 331
210 3300005365 Ga0070688_100042006 Ga0070688_1000420063 331
211 3300005366 Ga0070659_100213959 Ga0070659_1002139591 331
212 3300005367 Ga0070667_100096587 Ga0070667_1000965872 331
213 3300005437 Ga0070710_10015183 Ga0070710_100151832 331
214 3300005437 Ga0070710_10039608 Ga0070710_100396082 331
215 3300005438 Ga0070701_10043038 Ga0070701_100430381 331
216 3300005439 Ga0070711_100032631 Ga0070711_1000326312 331
217 3300005439 Ga0070711_100114782 Ga0070711_1001147821 331
218 3300005440 Ga0070705_100158867 Ga0070705_1001588671 331
219 3300005441 Ga0070700_100099577 Ga0070700_1000995771 331
220 3300005441 Ga0070700_100125277 Ga0070700_1001252771 331
221 3300005455 Ga0070663_100117596 Ga0070663_1001175962 331
222 3300005456 Ga0070678_100098817 Ga0070678_1000988173 331
223 3300005457 Ga0070662_100125865 Ga0070662_1001258652 331
224 3300005457 Ga0070662_100159251 Ga0070662_1001592511 331
225 3300005459 Ga0068867_100045964 Ga0068867_1000459643 331
226 3300005459 Ga0068867_100125338 Ga0068867_1001253381 331
227 3300005466 Ga0070685_10033414 Ga0070685_100334141 331
228 3300005539 Ga0068853_100202073 Ga0068853_1002020731 331
229 3300005543 Ga0070672_100207283 Ga0070672_1002072831 331
230 3300005545 Ga0070695_100097252 Ga0070695_1000972522 331
231 3300005546 Ga0070696_100055483 Ga0070696_1000554833 331
232 3300005547 Ga0070693_100046755 Ga0070693_1000467553 331
233 3300005548 Ga0070665_100233042 Ga0070665_1002330422 331
234 3300005549 Ga0070704_100182336 Ga0070704_1001823361 331
235 3300005563 Ga0068855_100444792 Ga0068855_1004447921 331
236 3300005578 Ga0068854_100040993 Ga0068854_1000409934 331
237 3300005578 Ga0068854_100119021 Ga0068854_1001190213 331
238 3300005615 Ga0070702_100080872 Ga0070702_1000808723 331
239 3300005616 Ga0068852_100158070 Ga0068852_1001580702 331
240 3300005617 Ga0068859_100254272 Ga0068859_1002542721 331
241 3300005617 Ga0068859_100341121 Ga0068859_1003411211 331
242 3300005719 Ga0068861_100094200 Ga0068861_1000942002 331
243 3300005719 Ga0068861_100155360 Ga0068861_1001553601 331
244 3300005842 Ga0068858_100158381 Ga0068858_1001583811 331
245 3300005843 Ga0068860_100274397 Ga0068860_1002743971 331
246 3300006163 Ga0070715_10045678 Ga0070715_100456781 331
247 3300006175 Ga0070712_100008907 Ga0070712_1000089073 331
248 3300006175 Ga0070712_100082332 Ga0070712_1000823323 331
249 3300006237 Ga0097621_100173297 Ga0097621_1001732972 331
250 3300006237 Ga0097621_100268666 Ga0097621_1002686662 331
251 3300006881 Ga0068865_100095574 Ga0068865_1000955743 331
252 3300006931 Ga0097620_100254257 Ga0097620_1002542572 331
253 3300006931 Ga0097620_100341102 Ga0097620_1003411021 331
254 3300009092 Ga0105250_10099639 Ga0105250_100996391 331
255 3300009098 Ga0105245_10181973 Ga0105245_101819733 331
256 3300009101 Ga0105247_10052379 Ga0105247_100523792 331
257 3300009148 Ga0105243_10084012 Ga0105243_100840122 331
258 3300009148 Ga0105243_10144098 Ga0105243_101440982 331
259 3300009174 Ga0105241_10193966 Ga0105241_101939662 331
260 3300009176 Ga0105242_10064335 Ga0105242_100643353 331
261 3300009177 Ga0105248_10233434 Ga0105248_102334341 331
262 3300009545 Ga0105237_10213346 Ga0105237_102133463 331
263 3300009553 Ga0105249_10178639 Ga0105249_101786391 331
264 3300010375 Ga0105239_10109875 Ga0105239_101098751 331
265 3300010375 Ga0105239_10201243 Ga0105239_102012432 331
266 3300013296 Ga0157374_10247045 Ga0157374_102470451 331
267 3300013297 Ga0157378_10041895 Ga0157378_100418956 331
268 3300013297 Ga0157378_10228340 Ga0157378_102283401 331
269 3300013306 Ga0163162_10122037 Ga0163162_101220372 331
270 3300013306 Ga0163162_10140522 Ga0163162_101405222 331
271 3300013307 Ga0157372_10261161 Ga0157372_102611611 331
272 3300013308 Ga0157375_10349381 Ga0157375_103493811 331
273 3300014326 Ga0157380_10242963 Ga0157380_102429631 331
274 3300014745 Ga0157377_10213310 Ga0157377_102133101 331
275 3300014968 Ga0157379_10440961 Ga0157379_104409611 331
276 3300014969 Ga0157376_10172401 Ga0157376_101724013 331
277 3300017792 Ga0163161_10062105 Ga0163161_100621052 331
278 3300017792 Ga0163161_10095724 Ga0163161_100957242 331
279 3300025898 Ga0207692_10146647 Ga0207692_101466471 331
280 3300025899 Ga0207642_10051558 Ga0207642_100515583 331
281 3300025900 Ga0207710_10049682 Ga0207710_100496823 331
282 3300025901 Ga0207688_10062356 Ga0207688_100623563 331
283 3300025905 Ga0207685_10063128 Ga0207685_100631282 331
284 3300025911 Ga0207654_10165074 Ga0207654_101650742 331
285 3300025914 Ga0207671_10118125 Ga0207671_101181251 331
286 3300025915 Ga0207693_10007872 Ga0207693_100078723 331
287 3300025915 Ga0207693_10084211 Ga0207693_100842111 331
288 3300025916 Ga0207663_10110748 Ga0207663_101107481 331
289 3300025916 Ga0207663_10115296 Ga0207663_101152961 331
290 3300025923 Ga0207681_10041212 Ga0207681_100412123 331
291 3300025927 Ga0207687_10207295 Ga0207687_102072952 331
292 3300025932 Ga0207690_10091063 Ga0207690_100910632 331
293 3300025933 Ga0207706_10065881 Ga0207706_100658811 331
294 3300025934 Ga0207686_10078525 Ga0207686_100785253 331
295 3300025935 Ga0207709_10188111 Ga0207709_101881111 331
296 3300025937 Ga0207669_10064164 Ga0207669_100641643 331
297 3300025938 Ga0207704_10088372 Ga0207704_100883721 331
298 3300025938 Ga0207704_10165704 Ga0207704_101657042 331
299 3300025939 Ga0207665_10006623 Ga0207665_100066233 331
300 3300025939 Ga0207665_10024492 Ga0207665_100244925 331
301 3300025942 Ga0207689_10017789 Ga0207689_100177894 331
302 3300025961 Ga0207712_10163458 Ga0207712_101634581 331
303 3300025972 Ga0207668_10207284 Ga0207668_102072841 331
304 3300025986 Ga0207658_10112610 Ga0207658_101126102 331
305 3300026023 Ga0207677_10119637 Ga0207677_101196371 331
306 3300026041 Ga0207639_10208413 Ga0207639_102084131 331
307 3300026067 Ga0207678_10105441 Ga0207678_101054412 331
308 3300026075 Ga0207708_10096462 Ga0207708_100964621 331
309 3300026089 Ga0207648_10008805 Ga0207648_100088056 331
310 3300026118 Ga0207675_100112496 Ga0207675_1001124962 331
311 3300026121 Ga0207683_10176561 Ga0207683_101765613 331
312 3300028379 Ga0268266_10226929 Ga0268266_102269291 331
313 3300028380 Ga0268265_10067939 Ga0268265_100679392 331
314 3300028381 Ga0268264_10166335 Ga0268264_101663353 331
315 3300031901 Ga0307406_10000101 Ga0307406_1000010114 331
316 3300035691 Ga0373931_0072675 Ga0373931_0072675_134_1129 331
317 3300046507 Ga0495606_0000578 Ga0495606_0000578_1981_2997 331
318 3300046616 Ga0495668_0002025 Ga0495668_0002025_6060_7076 331
319 3300046660 Ga0495625_0000749 Ga0495625_0000749_3856_4872 331
320 3300047323 Ga0495683_0042443 Ga0495683_0042443_156_1172 331
321 3300048091 Ga0495626_0000046 Ga0495626_0000046_70851_71867 331
322 3300048903 Ga0496100_0171043 Ga0496100_0171043_68_1063 331
323 3300048904 Ga0496101_0188857 Ga0496101_0188857_150_1223 331
324 3300048905 Ga0496102_0237822 Ga0496102_0237822_165_1238 331
325 3300048906 Ga0496103_0066410 Ga0496103_0066410_598_1671 331
326 3300048909 Ga0496106_0072571 Ga0496106_0072571_479_1552 331
327 3300048909 Ga0496106_0119314 Ga0496106_0119314_948_1943 331
328 3300048910 Ga0496107_0121495 Ga0496107_0121495_603_1676 331
329 3300048917 Ga0496114_0098870 Ga0496114_0098870_1050_2123 331
330 3300048918 Ga0496115_0151645 Ga0496115_0151645_668_1741 331
331 3300053080 Ga0500635_0000016 Ga0500635_0000016_81337_82359 331
332 3300053139 Ga0500568_0001019 Ga0500568_0001019_17888_18889 331
333 iso_pu_bacteria 2643221613 2644081213 331
334 iso_pu_bacteria 2857729791 2857731464 331
335 iso_pu_bacteria 2935890801 2935892248 331
336 iso_pu_bacteria 2643221630 2644170876 332
337 iso_pu_bacteria 2852663356 2852664589 332
338 iso_pu_bacteria 2884763398 2884766987 332
339 iso_pu_bacteria 8004182704 8004185869 332
340 3300005288 Ga0065714_10085576 Ga0065714_100855762 333
341 3300048908 Ga0496105_0218489 Ga0496105_0218489_23_1060 333
342 3300048929 Ga0496126_0038783 Ga0496126_0038783_1391_2479 333
343 3300049581 Ga0501047_0057724 Ga0501047_0057724_437_1459 333
344 3300049823 Ga0501044_0034817 Ga0501044_0034817_2246_3268 333
345 3300002737 JGI25162J39368_1010040 JGI25162J39368_10100401 334
346 3300002772 JGI25164J39214_1000658 JGI25164J39214_10006586 334
347 3300003214 JGI25165J46597_1000005 JGI25165J46597_100000579 334
348 3300025231 Ga0207427_100028 Ga0207427_10002873 334
349 3300025233 Ga0209437_100211 Ga0209437_10021157 334
350 3300025261 Ga0209233_1000001 Ga0209233_1000001571 334
351 3300001977 JGI24746J21847_1005286 JGI24746J21847_10052862 335
352 3300001991 JGI24743J22301_10004666 JGI24743J22301_100046663 335
353 3300005334 Ga0068869_100026450 Ga0068869_1000264501 335
354 3300005337 Ga0070682_100073871 Ga0070682_1000738713 335
355 3300005347 Ga0070668_100206927 Ga0070668_1002069272 335
356 3300005354 Ga0070675_100134071 Ga0070675_1001340711 335
357 3300005365 Ga0070688_100055596 Ga0070688_1000555962 335
358 3300005406 Ga0070703_10067021 Ga0070703_100670211 335
359 3300005466 Ga0070685_10135226 Ga0070685_101352262 335
360 3300005615 Ga0070702_100117475 Ga0070702_1001174751 335
361 3300005842 Ga0068858_100048638 Ga0068858_1000486381 335
362 3300005844 Ga0068862_100178207 Ga0068862_1001782071 335
363 3300009101 Ga0105247_10018001 Ga0105247_100180014 335
364 3300009177 Ga0105248_10198007 Ga0105248_101980071 335
365 3300009545 Ga0105237_10257924 Ga0105237_102579242 335
366 3300009551 Ga0105238_10213018 Ga0105238_102130182 335
367 3300009553 Ga0105249_10175114 Ga0105249_101751141 335
368 3300011119 Ga0105246_10018882 Ga0105246_100188822 335
369 3300013296 Ga0157374_10048525 Ga0157374_100485252 335
370 3300014325 Ga0163163_10243057 Ga0163163_102430571 335
371 3300014745 Ga0157377_10084238 Ga0157377_100842382 335
372 3300025933 Ga0207706_10031088 Ga0207706_100310882 335
373 3300025942 Ga0207689_10033748 Ga0207689_100337483 335
374 3300025981 Ga0207640_10190830 Ga0207640_101908302 335
375 3300026023 Ga0207677_10016470 Ga0207677_100164704 335
376 3300026075 Ga0207708_10149987 Ga0207708_101499872 335
377 3300026088 Ga0207641_10039260 Ga0207641_100392602 335
378 3300026089 Ga0207648_10062339 Ga0207648_100623392 335
379 3300026118 Ga0207675_100325337 Ga0207675_1003253371 335
380 3300026142 Ga0207698_10182001 Ga0207698_101820012 335
381 3300028379 Ga0268266_10087924 Ga0268266_100879242 335
382 3300048911 Ga0496108_0000807 Ga0496108_0000807_7951_8958 335
383 3300048912 Ga0496109_0001725 Ga0496109_0001725_2548_3555 335
384 3300048913 Ga0496110_0063745 Ga0496110_0063745_2101_3108 335
385 3300048914 Ga0496111_0176183 Ga0496111_0176183_122_1129 335
386 3300048915 Ga0496112_0300260 Ga0496112_0300260_205_1212 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04960

Glutaminase

Glutaminase

85

369

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u60-assembly1.cif.gz_A mcsg apc5046 probable glutaminase ybas 0.9709 16 325
1u60-assembly1.cif.gz_A mcsg apc5046 probable glutaminase ybas 0.9679 16 325
8ec6-assembly1.cif.gz_E cryo-em structure of the glutaminase c core filament (fgac) 0.9435 16 313
5jyo-assembly1.cif.gz_D allosteric inhibition of kidney isoform of glutaminase 0.9413 16 324
5jyp-assembly1.cif.gz_A allosteric inhibition of kidney isoform of glutaminase 0.9413 16 324
ID Description Score Start End Superfamily
1u60D00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9706 16 325 3.40.710.10
1u60D00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9675 16 325 3.40.710.10
af_F1RDU2_183_512_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9467 16 328 3.40.710.10
af_P0A6W0_5_308_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.939 22 323 3.40.710.10
1mkiB02 Mainly Alpha;Orthogonal Bundle;Probable Glutaminase Ybgj; Chain: A, domain 2; 0.9356 82 212 1.10.1500.10
ID Description Score Start End GO Terms
AF-A0A4R6S253-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9821 2 333 GO:0004359
GO:0006537
GO:0006543
AF-A0A6G0ABF4-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9811 17 255 GO:0004359
GO:0006537
GO:0006543
AF-A0A1P8NIL4-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9808 2 331 GO:0004359
GO:0006537
GO:0006543
AF-A0A653XA51-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9788 8 328 GO:0004359
GO:0006537
GO:0006543
AF-A0A3N5KTY6-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9759 16 323 GO:0004359
GO:0006537
GO:0006543

Feature Viewer

pLDDT pTM Quality
91.01 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map