F430730

General Info

Members Datasets Scaffolds Average Seq Length
387 163 387 112

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_102078540|Ga0068868_1020785401
Length 130
Sequence MTAAVNRPVTHSRLWAPSMSRSIIARYVNPWKYKREQAEAARVAALRSRDGDECRRCRRPLRFDLTAGHDLGPKVEEIAPTSEGELSALEALCLTHRRCNAVGADNTAEVTERARRKNEAELFARSRKRA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 5.17
Rhizosphere 94.06
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10221913 3300001989 Bacteria 554
2 JGI24737J22298_10009433 3300001990 Bacteria 3246
3 JGI24743J22301_10010618 3300001991 Bacteria 1646
4 JGI24744J21845_10009819 3300002077 Unclassified 1964
5 JGI24742J22300_10110396 3300002244 Unclassified 537
6 Ga0070658_10061146 3300005327 Bacteria 3068
7 Ga0070658_10228724 3300005327 Unclassified 1574
8 Ga0070676_10676600 3300005328 Unclassified 751
9 Ga0070683_100728435 3300005329 Bacteria 950
10 Ga0070690_100276641 3300005330 Bacteria 1196
11 Ga0070670_100054951 3300005331 Bacteria 3418
12 Ga0070670_100062023 3300005331 Bacteria 3209
13 Ga0070670_100150014 3300005331 Bacteria 2018
14 Ga0070670_100210850 3300005331 Bacteria 1689
15 Ga0068869_100178291 3300005334 Bacteria 1664
16 Ga0068869_100900696 3300005334 Bacteria 765
17 Ga0070666_10111066 3300005335 Bacteria 1896
18 Ga0070666_10298875 3300005335 Bacteria 1146
19 Ga0070680_100427727 3300005336 Bacteria 1130
20 Ga0070682_100333903 3300005337 Bacteria 1124
21 Ga0070682_101646607 3300005337 Unclassified 556
22 Ga0068868_100802119 3300005338 Unclassified 849
23 Ga0068868_102078540 3300005338 Unclassified 540
24 Ga0070660_100045178 3300005339 Bacteria 3371
25 Ga0070660_100113194 3300005339 Unclassified 2160
26 Ga0070660_100223802 3300005339 Bacteria 1530
27 Ga0070660_100424431 3300005339 Bacteria 1101
28 Ga0070660_100686048 3300005339 Unclassified 858
29 Ga0070661_100019329 3300005344 Plasmid 4855
30 Ga0070661_100050635 3300005344 Bacteria 3039
31 Ga0070661_100076029 3300005344 Bacteria 2475
32 Ga0070661_100969169 3300005344 Bacteria 704
33 Ga0070661_101887595 3300005344 Unclassified 508
34 Ga0070668_100337524 3300005347 Bacteria 1272
35 Ga0070668_100386003 3300005347 Unclassified 1193
36 Ga0070668_101536913 3300005347 Unclassified 609
37 Ga0070669_101112880 3300005353 Unclassified 680
38 Ga0070669_101225506 3300005353 Bacteria 649
39 Ga0070671_100037704 3300005355 Bacteria 4009
40 Ga0070671_100059737 3300005355 Bacteria 3173
41 Ga0070671_100090252 3300005355 Bacteria 2565
42 Ga0070671_100356578 3300005355 Archaea 1248
43 Ga0070671_100788799 3300005355 Bacteria 827
44 Ga0070671_101441760 3300005355 Bacteria 609
45 Ga0070674_100032098 3300005356 Bacteria 3486
46 Ga0070674_100481052 3300005356 Bacteria 1030
47 Ga0070673_100037810 3300005364 Bacteria 3680
48 Ga0070673_100144979 3300005364 Unclassified 2007
49 Ga0070659_100002302 3300005366 Bacteria 13605
50 Ga0070659_100012307 3300005366 Bacteria 6341
51 Ga0070659_100040493 3300005366 Bacteria 3641
52 Ga0070659_100406607 3300005366 Unclassified 1150
53 Ga0070659_100476594 3300005366 Bacteria 1061
54 Ga0070659_100549576 3300005366 Bacteria 988
55 Ga0070659_101121912 3300005366 Bacteria 694
56 Ga0070667_100018020 3300005367 Bacteria 5852
57 Ga0070714_100137913 3300005435 Bacteria 2187
58 Ga0070713_102030045 3300005436 Unclassified 558
59 Ga0070663_100158398 3300005455 Unclassified 1741
60 Ga0070663_100315335 3300005455 Unclassified 1256
61 Ga0070663_100367953 3300005455 Unclassified 1168
62 Ga0070663_100706019 3300005455 Bacteria 857
63 Ga0070663_102115733 3300005455 Bacteria 507
64 Ga0070678_100111295 3300005456 Bacteria 2143
65 Ga0070678_100272683 3300005456 Unclassified 1427
66 Ga0070662_100157598 3300005457 Bacteria 1773
67 Ga0070662_100291196 3300005457 Bacteria 1324
68 Ga0070662_100348382 3300005457 Bacteria 1213
69 Ga0070662_100619547 3300005457 Bacteria 911
70 Ga0070662_100685367 3300005457 Bacteria 866
71 Ga0070662_100882602 3300005457 Bacteria 762
72 Ga0070662_101156802 3300005457 Bacteria 664
73 Ga0070681_10497891 3300005458 Bacteria 1131
74 Ga0070679_100958483 3300005530 Bacteria 799
75 Ga0070679_101241042 3300005530 Unclassified 691
76 Ga0070684_100665562 3300005535 Unclassified 970
77 Ga0068853_100172198 3300005539 Bacteria 1959
78 Ga0068853_100282600 3300005539 Bacteria 1530
79 Ga0068853_100831824 3300005539 Bacteria 885
80 Ga0070672_100315557 3300005543 Bacteria 1328
81 Ga0070696_100094448 3300005546 Bacteria 2134
82 Ga0070693_100290170 3300005547 Unclassified 1099
83 Ga0070665_100020213 3300005548 Bacteria 6685
84 Ga0070665_100710172 3300005548 Bacteria 1018
85 Ga0070665_101284389 3300005548 Unclassified 742
86 Ga0068855_100825803 3300005563 Unclassified 983
87 Ga0070664_100059977 3300005564 Bacteria 3238
88 Ga0070664_100107117 3300005564 Bacteria 2436
89 Ga0070664_100311660 3300005564 Bacteria 1424
90 Ga0070664_100638219 3300005564 Unclassified 989
91 Ga0070664_101023935 3300005564 Bacteria 776
92 Ga0068857_100004537 3300005577 Bacteria 11744
93 Ga0068857_101530950 3300005577 Bacteria 650
94 Ga0068854_100240081 3300005578 Unclassified 1442
95 Ga0068856_100371011 3300005614 Bacteria 1450
96 Ga0068856_100425622 3300005614 Bacteria 1348
97 Ga0068856_101258777 3300005614 Unclassified 755
98 Ga0070702_100155588 3300005615 Bacteria 1472
99 Ga0068852_100035229 3300005616 Bacteria 4173
100 Ga0068852_100138385 3300005616 Unclassified 2250
101 Ga0068852_100279884 3300005616 Bacteria 1608
102 Ga0068852_100330710 3300005616 Bacteria 1482
103 Ga0068852_100512923 3300005616 Unclassified 1195
104 Ga0068852_100709978 3300005616 Bacteria 1016
105 Ga0068864_100077523 3300005618 Bacteria 2906
106 Ga0068864_100272001 3300005618 Bacteria 1579
107 Ga0068864_100769173 3300005618 Bacteria 945
108 Ga0068866_10157105 3300005718 Unclassified 1323
109 Ga0068861_100209557 3300005719 Unclassified 1641
110 Ga0068861_100425320 3300005719 Bacteria 1184
111 Ga0068851_10171402 3300005834 Bacteria 1198
112 Ga0068851_10723125 3300005834 Unclassified 614
113 Ga0068870_10277967 3300005840 Bacteria 1048
114 Ga0068863_100027210 3300005841 Bacteria 5453
115 Ga0068862_100942182 3300005844 Unclassified 851
116 Ga0075364_10879007 3300006051 Bacteria 610
117 Ga0075366_10140512 3300006195 Bacteria 1460
118 Ga0097621_100704124 3300006237 Bacteria 930
119 Ga0068871_100213299 3300006358 Archaea 1670
120 Ga0068871_100258067 3300006358 Unclassified 1520
121 Ga0111539_11742743 3300009094 Unclassified 722
122 Ga0105245_10753929 3300009098 Bacteria 1009
123 Ga0105245_12726568 3300009098 Unclassified 547
124 Ga0105243_10059114 3300009148 Bacteria 3058
125 Ga0105242_10448813 3300009176 Unclassified 1215
126 Ga0105248_10018004 3300009177 Bacteria 7798
127 Ga0105248_10042715 3300009177 Bacteria 5084
128 Ga0105248_10048368 3300009177 Bacteria 4771
129 Ga0105248_10062870 3300009177 Bacteria 4167
130 Ga0105248_11184309 3300009177 Bacteria 864
131 Ga0105238_10438109 3300009551 Bacteria 1303
132 Ga0105249_10913898 3300009553 Unclassified 945
133 Ga0105246_10024202 3300011119 Bacteria 3942
134 Ga0105246_10394978 3300011119 Bacteria 1147
135 Ga0157373_10173301 3300013100 Bacteria 1518
136 Ga0157373_10376658 3300013100 Unclassified 1015
137 Ga0157371_10072013 3300013102 Bacteria 2447
138 Ga0157370_10005854 3300013104 Bacteria 13734
139 Ga0157369_10331446 3300013105 Unclassified 1581
140 Ga0157369_10387141 3300013105 Bacteria 1451
141 Ga0157374_10004605 3300013296 Bacteria 11567
142 Ga0157374_10453015 3300013296 Unclassified 1285
143 Ga0157378_10088970 3300013297 Bacteria 2803
144 Ga0157378_10236857 3300013297 Bacteria 1742
145 Ga0163162_10017328 3300013306 Bacteria 7048
146 Ga0157372_10403918 3300013307 Bacteria 1592
147 Ga0157372_12695490 3300013307 Unclassified 570
148 Ga0157375_10045269 3300013308 Bacteria 4282
149 Ga0157375_10275052 3300013308 Unclassified 1846
150 Ga0157375_10376905 3300013308 Unclassified 1585
151 Ga0157375_10576808 3300013308 Bacteria 1285
152 Ga0157375_10677773 3300013308 Bacteria 1186
153 Ga0157375_10723465 3300013308 Bacteria 1148
154 Ga0163163_10011197 3300014325 Bacteria 8126
155 Ga0157380_10223134 3300014326 Bacteria 1687
156 Ga0157377_11377485 3300014745 Unclassified 555
157 Ga0157376_10110948 3300014969 Bacteria 2414
158 Ga0207656_10256732 3300025321 Bacteria 857
159 Ga0207656_10379163 3300025321 Unclassified 709
160 Ga0207682_10012934 3300025893 Bacteria 3255
161 Ga0207642_10035157 3300025899 Bacteria 2137
162 Ga0207688_10058478 3300025901 Bacteria 2169
163 Ga0207688_10433644 3300025901 Bacteria 818
164 Ga0207647_10053136 3300025904 Bacteria 2498
165 Ga0207647_10114867 3300025904 Bacteria 1590
166 Ga0207647_10186268 3300025904 Bacteria 1204
167 Ga0207645_10770768 3300025907 Bacteria 654
168 Ga0207645_10770769 3300025907 Unclassified 654
169 Ga0207643_10035845 3300025908 Bacteria 2783
170 Ga0207705_10147877 3300025909 Unclassified 1759
171 Ga0207705_10483322 3300025909 Bacteria 961
172 Ga0207707_10280725 3300025912 Bacteria 1443
173 Ga0207693_10352234 3300025915 Bacteria 1152
174 Ga0207660_10158589 3300025917 Bacteria 1744
175 Ga0207657_10047434 3300025919 Bacteria 3756
176 Ga0207657_10052786 3300025919 Bacteria 3526
177 Ga0207657_10233247 3300025919 Bacteria 1471
178 Ga0207649_10030588 3300025920 Bacteria 3191
179 Ga0207649_10087415 3300025920 Bacteria 2033
180 Ga0207649_10108964 3300025920 Bacteria 1847
181 Ga0207649_10111189 3300025920 Bacteria 1830
182 Ga0207649_10176290 3300025920 Bacteria 1493
183 Ga0207649_10258554 3300025920 Bacteria 1257
184 Ga0207649_10420491 3300025920 Bacteria 1003
185 Ga0207694_10481075 3300025924 Bacteria 1038
186 Ga0207650_10017413 3300025925 Bacteria 5032
187 Ga0207650_10050846 3300025925 Bacteria 3066
188 Ga0207650_10245803 3300025925 Bacteria 1447
189 Ga0207650_10318196 3300025925 Bacteria 1274
190 Ga0207650_11644575 3300025925 Unclassified 545
191 Ga0207659_10037903 3300025926 Bacteria 3350
192 Ga0207687_10626034 3300025927 Bacteria 909
193 Ga0207664_10214295 3300025929 Bacteria 1667
194 Ga0207664_10314584 3300025929 Unclassified 1380
195 Ga0207644_10000166 3300025931 Bacteria 47729
196 Ga0207644_10011676 3300025931 Bacteria 5817
197 Ga0207644_10092728 3300025931 Unclassified 2254
198 Ga0207644_10182204 3300025931 Bacteria 1647
199 Ga0207644_10297588 3300025931 Bacteria 1299
200 Ga0207644_10588048 3300025931 Bacteria 923
201 Ga0207690_10001687 3300025932 Bacteria 13611
202 Ga0207690_10012989 3300025932 Bacteria 4993
203 Ga0207690_10210131 3300025932 Bacteria 1483
204 Ga0207690_10844006 3300025932 Bacteria 758
205 Ga0207690_11234335 3300025932 Bacteria 624
206 Ga0207706_10012458 3300025933 Bacteria 7749
207 Ga0207706_10012607 3300025933 Bacteria 7698
208 Ga0207706_10281448 3300025933 Unclassified 1450
209 Ga0207706_10685965 3300025933 Bacteria 876
210 Ga0207706_10727932 3300025933 Bacteria 846
211 Ga0207706_10977324 3300025933 Unclassified 712
212 Ga0207706_10979740 3300025933 Bacteria 711
213 Ga0207686_11466822 3300025934 Unclassified 562
214 Ga0207709_10334450 3300025935 Unclassified 1138
215 Ga0207669_10190339 3300025937 Bacteria 1479
216 Ga0207691_10019100 3300025940 Bacteria 6490
217 Ga0207691_10021940 3300025940 Bacteria 6025
218 Ga0207691_10110277 3300025940 Bacteria 2448
219 Ga0207691_10254937 3300025940 Unclassified 1513
220 Ga0207711_10025930 3300025941 Bacteria 4916
221 Ga0207711_10067636 3300025941 Bacteria 3093
222 Ga0207711_11111094 3300025941 Bacteria 731
223 Ga0207711_11128566 3300025941 Unclassified 725
224 Ga0207711_12095282 3300025941 Unclassified 508
225 Ga0207689_10122472 3300025942 Bacteria 2139
226 Ga0207689_10137641 3300025942 Unclassified 2011
227 Ga0207661_10329201 3300025944 Bacteria 1375
228 Ga0207679_10296374 3300025945 Bacteria 1392
229 Ga0207679_10530675 3300025945 Bacteria 1054
230 Ga0207679_10987173 3300025945 Bacteria 772
231 Ga0207667_10294755 3300025949 Bacteria 1657
232 Ga0207667_10471828 3300025949 Unclassified 1274
233 Ga0207651_10032427 3300025960 Bacteria 3355
234 Ga0207651_10061004 3300025960 Bacteria 2621
235 Ga0207651_10541792 3300025960 Bacteria 1011
236 Ga0207651_10991403 3300025960 Bacteria 750
237 Ga0207712_10501134 3300025961 Unclassified 1038
238 Ga0207668_10285117 3300025972 Bacteria 1356
239 Ga0207668_10459954 3300025972 Archaea 1088
240 Ga0207668_11182336 3300025972 Unclassified 687
241 Ga0207640_11415231 3300025981 Bacteria 623
242 Ga0207677_10189376 3300026023 Bacteria 1626
243 Ga0207677_11079154 3300026023 Unclassified 731
244 Ga0207639_10123938 3300026041 Bacteria 2128
245 Ga0207639_10270719 3300026041 Bacteria 1490
246 Ga0207639_10427534 3300026041 Bacteria 1198
247 Ga0207639_10755264 3300026041 Bacteria 904
248 Ga0207678_10030926 3300026067 Bacteria 4673
249 Ga0207678_10187341 3300026067 Unclassified 1768
250 Ga0207678_11316761 3300026067 Bacteria 639
251 Ga0207702_10075830 3300026078 Bacteria 2906
252 Ga0207702_10624861 3300026078 Unclassified 1058
253 Ga0207702_11376630 3300026078 Bacteria 699
254 Ga0207641_10501792 3300026088 Bacteria 1178
255 Ga0207648_10028853 3300026089 Bacteria 4918
256 Ga0207676_10022258 3300026095 Bacteria 4659
257 Ga0207676_10489929 3300026095 Bacteria 1166
258 Ga0207674_10000082 3300026116 Bacteria 101650
259 Ga0207675_100258646 3300026118 Unclassified 1686
260 Ga0207683_10013235 3300026121 Bacteria 7034
261 Ga0207683_10108202 3300026121 Bacteria 2488
262 Ga0207683_10131318 3300026121 Bacteria 2253
263 Ga0207698_10210084 3300026142 Unclassified 1750
264 Ga0207698_10395422 3300026142 Unclassified 1319
265 Ga0207698_10549862 3300026142 Bacteria 1131
266 Ga0268266_10044566 3300028379 Unclassified 3792
267 Ga0268266_10279270 3300028379 Bacteria 1552
268 Ga0268266_11175824 3300028379 Unclassified 742
269 Ga0268265_10452368 3300028380 Bacteria 1200
270 Ga0307408_100586321 3300031548 Bacteria 989
271 Ga0307413_10237565 3300031824 Unclassified 1343
272 Ga0307410_10053064 3300031852 Plasmid 2742
273 Ga0307406_10647289 3300031901 Bacteria 877
274 Ga0307412_10068980 3300031911 Bacteria 2406
275 Ga0307409_100012533 3300031995 Bacteria 5408
276 Ga0307409_101100719 3300031995 Unclassified 816
277 Ga0307416_100004457 3300032002 Bacteria 8444
278 Ga0395899_0033705 3300037312 Bacteria 3846
279 Ga0395899_0067035 3300037312 Unclassified 2634
280 Ga0395899_0082299 3300037312 Bacteria 2341
281 Ga0395899_0084364 3300037312 Unclassified 2309
282 Ga0395899_0091397 3300037312 Unclassified 2205
283 Ga0395899_0097676 3300037312 Bacteria 2123
284 Ga0395899_0117928 3300037312 Unclassified 1903
285 Ga0395899_0436809 3300037312 Bacteria 860
286 Ga0395900_0013739 3300037418 Bacteria 8265
287 Ga0395900_0026185 3300037418 Bacteria 5972
288 Ga0395900_0072658 3300037418 Bacteria 3536
289 Ga0395900_0125859 3300037418 Bacteria 2628
290 Ga0395900_0164119 3300037418 Bacteria 2264
291 Ga0395900_0171536 3300037418 Unclassified 2208
292 Ga0395900_0175819 3300037418 Bacteria 2177
293 Ga0395900_0197618 3300037418 Unclassified 2036
294 Ga0395900_0223191 3300037418 Bacteria 1898
295 Ga0395900_0279047 3300037418 Unclassified 1663
296 Ga0395900_0359992 3300037418 Unclassified 1426
297 Ga0395900_0409226 3300037418 Unclassified 1319
298 Ga0395900_0638484 3300037418 Unclassified 1002
299 Ga0395900_0951666 3300037418 Bacteria 780
300 Ga0395898_0020643 3300037466 Bacteria 6690
301 Ga0395898_0030803 3300037466 Bacteria 5366
302 Ga0395898_0050851 3300037466 Bacteria 4054
303 Ga0395898_0092066 3300037466 Bacteria 2916
304 Ga0395898_0172498 3300037466 Bacteria 2067
305 Ga0395898_0270130 3300037466 Unclassified 1622
306 Ga0395898_0318480 3300037466 Unclassified 1484
307 Ga0395898_0331339 3300037466 Bacteria 1451
308 Ga0395898_0530287 3300037466 Bacteria 1119
309 Ga0395898_0571390 3300037466 Unclassified 1073
310 Ga0395898_0681324 3300037466 Bacteria 970
311 Ga0395898_0944493 3300037466 Bacteria 799
312 Ga0395905_0002477 3300037471 Bacteria 20432
313 Ga0395905_0005585 3300037471 Bacteria 12813
314 Ga0395905_0008253 3300037471 Bacteria 10287
315 Ga0395905_0009662 3300037471 Bacteria 9414
316 Ga0395905_0021356 3300037471 Bacteria 6122
317 Ga0395905_0072347 3300037471 Unclassified 3232
318 Ga0395905_0161174 3300037471 Bacteria 2108
319 Ga0395905_0178525 3300037471 Bacteria 1993
320 Ga0395905_0220741 3300037471 Bacteria 1774
321 Ga0395905_0246728 3300037471 Unclassified 1668
322 Ga0395905_0332754 3300037471 Bacteria 1409
323 Ga0395905_0394461 3300037471 Unclassified 1278
324 Ga0395905_0458796 3300037471 Unclassified 1172
325 Ga0395905_0461173 3300037471 Unclassified 1169
326 Ga0395905_0614983 3300037471 Bacteria 988
327 Ga0395905_0821098 3300037471 Bacteria 832
328 Ga0395905_1002243 3300037471 Bacteria 738
329 Ga0395905_1022646 3300037471 Unclassified 729
330 Ga0395905_1053368 3300037471 Unclassified 716
331 Ga0395905_1074589 3300037471 Bacteria 708
332 Ga0395905_1774697 3300037471 Unclassified 522
333 Ga0436364_1473023 3300037853 Bacteria 1554
334 Ga0395901_0021774 3300038443 Bacteria 6569
335 Ga0395901_0051759 3300038443 Bacteria 4269
336 Ga0395901_0073941 3300038443 Bacteria 3555
337 Ga0395901_0116415 3300038443 Bacteria 2807
338 Ga0395901_0143341 3300038443 Bacteria 2511
339 Ga0395901_0175994 3300038443 Bacteria 2244
340 Ga0395901_0181234 3300038443 Bacteria 2209
341 Ga0395901_0206161 3300038443 Unclassified 2059
342 Ga0395901_0224553 3300038443 Bacteria 1962
343 Ga0395901_0461208 3300038443 Bacteria 1298
344 Ga0395901_0714391 3300038443 Unclassified 998
345 Ga0395901_0738375 3300038443 Bacteria 978
346 Ga0395901_0781725 3300038443 Bacteria 945
347 Ga0395901_1001504 3300038443 Bacteria 811
348 Ga0395901_1632103 3300038443 Bacteria 597
349 Ga0439448_0219601 3300042005 Bacteria 668
350 Ga0466972_0107413 3300044658 Unclassified 1319
351 Ga0466972_0317030 3300044658 Bacteria 728
352 Ga0466966_0157275 3300044684 Bacteria 1384
353 Ga0466957_0050059 3300044842 Bacteria 2542
354 Ga0466960_0013380 3300044901 Bacteria 3485
355 Ga0466958_0791535 3300045836 Unclassified 618
356 Ga0466967_0313290 3300045976 Bacteria 1512
357 Ga0466967_1476924 3300045976 Unclassified 677
358 Ga0495629_0428706 3300046459 Bacteria 897
359 Ga0495663_0035672 3300046525 Bacteria 1494
360 Ga0495598_0006148 3300046537 Bacteria 2699
361 Ga0495621_0000088 3300046539 Bacteria 18635
362 Ga0495669_0019471 3300046684 Bacteria 2929
363 Ga0495669_0196176 3300046684 Bacteria 964
364 Ga0495670_0000192 3300046691 Bacteria 27204
365 Ga0495680_0844456 3300047322 Unclassified 595
366 Ga0496100_0330198 3300048903 Bacteria 1148
367 Ga0496100_0403544 3300048903 Unclassified 1041
368 Ga0496101_1218919 3300048904 Unclassified 589
369 Ga0496101_1229560 3300048904 Bacteria 586
370 Ga0496102_0586948 3300048905 Unclassified 1037
371 Ga0496102_0791558 3300048905 Bacteria 871
372 Ga0496103_0067295 3300048906 Unclassified 2237
373 Ga0496108_0029914 3300048911 Bacteria 4514
374 Ga0496108_0290373 3300048911 Bacteria 1424
375 Ga0496109_0103700 3300048912 Bacteria 2640
376 Ga0496109_0108630 3300048912 Bacteria 2578
377 Ga0496109_0582100 3300048912 Unclassified 1055
378 Ga0496109_0970841 3300048912 Bacteria 787
379 Ga0496110_1536668 3300048913 Unclassified 575
380 Ga0496112_0045619 3300048915 Bacteria 4297
381 Ga0496112_0499117 3300048915 Unclassified 1152
382 Ga0496113_0223391 3300048916 Bacteria 1501
383 Ga0496113_0912381 3300048916 Unclassified 694
384 Ga0496114_0566043 3300048917 Archaea 1003
385 Ga0496115_0223188 3300048918 Archaea 1555
386 Ga0501067_0055831 3300049583 Bacteria 2188
387 Ga0501069_0589030 3300049585 Bacteria 667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100054951 Ga0070670_1000549515 93
2 3300005334 Ga0068869_100178291 Ga0068869_1001782913 93
3 3300005355 Ga0070671_101441760 Ga0070671_1014417601 93
4 3300005455 Ga0070663_100706019 Ga0070663_1007060192 93
5 3300005457 Ga0070662_101156802 Ga0070662_1011568021 93
6 3300005618 Ga0068864_100769173 Ga0068864_1007691732 93
7 3300011119 Ga0105246_10394978 Ga0105246_103949781 93
8 3300013308 Ga0157375_10576808 Ga0157375_105768081 93
9 3300025907 Ga0207645_10770768 Ga0207645_107707681 93
10 3300025908 Ga0207643_10035845 Ga0207643_100358453 93
11 3300025925 Ga0207650_10017413 Ga0207650_100174133 93
12 3300025933 Ga0207706_10979740 Ga0207706_109797402 93
13 3300025942 Ga0207689_10122472 Ga0207689_101224723 93
14 3300025972 Ga0207668_10459954 Ga0207668_104599542 93
15 3300026067 Ga0207678_11316761 Ga0207678_113167611 93
16 3300005337 Ga0070682_100333903 Ga0070682_1003339032 105
17 3300005457 Ga0070662_100291196 Ga0070662_1002911962 105
18 3300005548 Ga0070665_100710172 Ga0070665_1007101722 105
19 3300005616 Ga0068852_100709978 Ga0068852_1007099783 105
20 3300005834 Ga0068851_10171402 Ga0068851_101714023 105
21 3300006051 Ga0075364_10879007 Ga0075364_108790071 105
22 3300009094 Ga0111539_11742743 Ga0111539_117427432 105
23 3300025321 Ga0207656_10256732 Ga0207656_102567322 105
24 3300025925 Ga0207650_11644575 Ga0207650_116445752 105
25 3300025933 Ga0207706_10685965 Ga0207706_106859652 105
26 3300026041 Ga0207639_10427534 Ga0207639_104275342 105
27 3300028379 Ga0268266_10044566 Ga0268266_100445664 105
28 3300044658 Ga0466972_0107413 Ga0466972_0107413_862_1191 106
29 3300044684 Ga0466966_0157275 Ga0466966_0157275_189_518 106
30 3300044842 Ga0466957_0050059 Ga0466957_0050059_1640_1969 106
31 3300045836 Ga0466958_0791535 Ga0466958_0791535_236_565 106
32 3300005339 Ga0070660_100223802 Ga0070660_1002238023 107
33 3300005344 Ga0070661_100050635 Ga0070661_1000506353 107
34 3300005366 Ga0070659_100040493 Ga0070659_1000404935 107
35 3300005455 Ga0070663_100315335 Ga0070663_1003153352 107
36 3300005457 Ga0070662_100619547 Ga0070662_1006195471 107
37 3300005530 Ga0070679_100958483 Ga0070679_1009584832 107
38 3300005539 Ga0068853_100282600 Ga0068853_1002826002 107
39 3300005564 Ga0070664_100059977 Ga0070664_1000599775 107
40 3300025920 Ga0207649_10176290 Ga0207649_101762903 107
41 3300025932 Ga0207690_10210131 Ga0207690_102101313 107
42 3300025944 Ga0207661_10329201 Ga0207661_103292012 107
43 3300026041 Ga0207639_10270719 Ga0207639_102707192 107
44 3300031548 Ga0307408_100586321 Ga0307408_1005863212 107
45 3300031911 Ga0307412_10068980 Ga0307412_100689803 107
46 3300032002 Ga0307416_100004457 Ga0307416_10000445710 107
47 3300005327 Ga0070658_10228724 Ga0070658_102287242 108
48 3300005339 Ga0070660_100113194 Ga0070660_1001131942 108
49 3300005339 Ga0070660_100424431 Ga0070660_1004244311 108
50 3300005366 Ga0070659_100406607 Ga0070659_1004066071 108
51 3300005455 Ga0070663_100367953 Ga0070663_1003679531 108
52 3300005530 Ga0070679_101241042 Ga0070679_1012410421 108
53 3300005564 Ga0070664_100638219 Ga0070664_1006382192 108
54 3300005614 Ga0068856_101258777 Ga0068856_1012587772 108
55 3300005616 Ga0068852_100138385 Ga0068852_1001383853 108
56 3300005834 Ga0068851_10723125 Ga0068851_107231251 108
57 3300013105 Ga0157369_10331446 Ga0157369_103314462 108
58 3300013296 Ga0157374_10453015 Ga0157374_104530152 108
59 3300025321 Ga0207656_10379163 Ga0207656_103791632 108
60 3300025909 Ga0207705_10147877 Ga0207705_101478772 108
61 3300025919 Ga0207657_10052786 Ga0207657_100527865 108
62 3300025920 Ga0207649_10030588 Ga0207649_100305883 108
63 3300025933 Ga0207706_10727932 Ga0207706_107279321 108
64 3300026067 Ga0207678_10187341 Ga0207678_101873412 108
65 3300026078 Ga0207702_10624861 Ga0207702_106248612 108
66 3300026142 Ga0207698_10210084 Ga0207698_102100842 108
67 3300037312 Ga0395899_0084364 Ga0395899_0084364_1513_1860 108
68 3300037418 Ga0395900_0072658 Ga0395900_0072658_1910_2257 108
69 3300037471 Ga0395905_0332754 Ga0395905_0332754_546_893 108
70 3300038443 Ga0395901_0051759 Ga0395901_0051759_3801_4148 108
71 3300005355 Ga0070671_100037704 Ga0070671_1000377042 109
72 3300005435 Ga0070714_100137913 Ga0070714_1001379133 109
73 3300005614 Ga0068856_100371011 Ga0068856_1003710112 109
74 3300005614 Ga0068856_100425622 Ga0068856_1004256223 109
75 3300009177 Ga0105248_10062870 Ga0105248_100628707 109
76 3300025929 Ga0207664_10314584 Ga0207664_103145842 109
77 3300025931 Ga0207644_10297588 Ga0207644_102975882 109
78 3300025941 Ga0207711_11111094 Ga0207711_111110942 109
79 3300026078 Ga0207702_10075830 Ga0207702_100758303 109
80 3300026078 Ga0207702_11376630 Ga0207702_113766302 109
81 3300037312 Ga0395899_0436809 Ga0395899_0436809_362_694 109
82 3300037418 Ga0395900_0638484 Ga0395900_0638484_338_670 109
83 3300037466 Ga0395898_0318480 Ga0395898_0318480_51_383 109
84 3300037466 Ga0395898_0681324 Ga0395898_0681324_415_747 109
85 3300037471 Ga0395905_0178525 Ga0395905_0178525_47_379 109
86 3300037471 Ga0395905_0394461 Ga0395905_0394461_572_904 109
87 3300037471 Ga0395905_0461173 Ga0395905_0461173_533_865 109
88 3300037853 Ga0436364_1473023 Ga0436364_1473023_972_1322 109
89 3300038443 Ga0395901_0181234 Ga0395901_0181234_1013_1345 109
90 3300045976 Ga0466967_0313290 Ga0466967_0313290_880_1221 109
91 3300045976 Ga0466967_1476924 Ga0466967_1476924_291_632 109
92 3300048903 Ga0496100_0330198 Ga0496100_0330198_575_922 109
93 3300048911 Ga0496108_0290373 Ga0496108_0290373_238_585 109
94 3300048912 Ga0496109_0103700 Ga0496109_0103700_1921_2268 109
95 3300048915 Ga0496112_0499117 Ga0496112_0499117_37_384 109
96 3300001991 JGI24743J22301_10010618 JGI24743J22301_100106181 110
97 3300002244 JGI24742J22300_10110396 JGI24742J22300_101103961 110
98 3300005327 Ga0070658_10061146 Ga0070658_100611463 110
99 3300005330 Ga0070690_100276641 Ga0070690_1002766412 110
100 3300005331 Ga0070670_100150014 Ga0070670_1001500143 110
101 3300005331 Ga0070670_100210850 Ga0070670_1002108502 110
102 3300005335 Ga0070666_10111066 Ga0070666_101110663 110
103 3300005344 Ga0070661_100019329 Ga0070661_1000193293 110
104 3300005344 Ga0070661_100969169 Ga0070661_1009691692 110
105 3300005347 Ga0070668_100337524 Ga0070668_1003375242 110
106 3300005355 Ga0070671_100090252 Ga0070671_1000902524 110
107 3300005355 Ga0070671_100356578 Ga0070671_1003565782 110
108 3300005356 Ga0070674_100032098 Ga0070674_1000320981 110
109 3300005364 Ga0070673_100037810 Ga0070673_1000378104 110
110 3300005366 Ga0070659_101121912 Ga0070659_1011219122 110
111 3300005367 Ga0070667_100018020 Ga0070667_1000180208 110
112 3300005455 Ga0070663_102115733 Ga0070663_1021157331 110
113 3300005456 Ga0070678_100111295 Ga0070678_1001112953 110
114 3300005457 Ga0070662_100157598 Ga0070662_1001575982 110
115 3300005457 Ga0070662_100685367 Ga0070662_1006853672 110
116 3300005543 Ga0070672_100315557 Ga0070672_1003155572 110
117 3300005548 Ga0070665_100020213 Ga0070665_1000202132 110
118 3300005548 Ga0070665_101284389 Ga0070665_1012843892 110
119 3300005564 Ga0070664_100107117 Ga0070664_1001071174 110
120 3300005564 Ga0070664_100311660 Ga0070664_1003116603 110
121 3300005577 Ga0068857_101530950 Ga0068857_1015309501 110
122 3300005840 Ga0068870_10277967 Ga0068870_102779673 110
123 3300006237 Ga0097621_100704124 Ga0097621_1007041242 110
124 3300006358 Ga0068871_100213299 Ga0068871_1002132992 110
125 3300009177 Ga0105248_10018004 Ga0105248_1001800410 110
126 3300009177 Ga0105248_10042715 Ga0105248_100427159 110
127 3300009177 Ga0105248_10048368 Ga0105248_100483682 110
128 3300009551 Ga0105238_10438109 Ga0105238_104381093 110
129 3300013296 Ga0157374_10004605 Ga0157374_100046053 110
130 3300013306 Ga0163162_10017328 Ga0163162_1001732814 110
131 3300013308 Ga0157375_10045269 Ga0157375_100452693 110
132 3300013308 Ga0157375_10275052 Ga0157375_102750522 110
133 3300013308 Ga0157375_10677773 Ga0157375_106777732 110
134 3300014969 Ga0157376_10110948 Ga0157376_101109485 110
135 3300025901 Ga0207688_10058478 Ga0207688_100584785 110
136 3300025909 Ga0207705_10483322 Ga0207705_104833222 110
137 3300025920 Ga0207649_10111189 Ga0207649_101111892 110
138 3300025920 Ga0207649_10258554 Ga0207649_102585542 110
139 3300025924 Ga0207694_10481075 Ga0207694_104810752 110
140 3300025925 Ga0207650_10245803 Ga0207650_102458033 110
141 3300025926 Ga0207659_10037903 Ga0207659_100379035 110
142 3300025931 Ga0207644_10011676 Ga0207644_100116761 110
143 3300025931 Ga0207644_10092728 Ga0207644_100927284 110
144 3300025932 Ga0207690_11234335 Ga0207690_112343352 110
145 3300025933 Ga0207706_10012458 Ga0207706_100124589 110
146 3300025933 Ga0207706_10012607 Ga0207706_1001260710 110
147 3300025940 Ga0207691_10021940 Ga0207691_100219403 110
148 3300025940 Ga0207691_10110277 Ga0207691_101102772 110
149 3300025940 Ga0207691_10254937 Ga0207691_102549372 110
150 3300025941 Ga0207711_10067636 Ga0207711_100676366 110
151 3300025941 Ga0207711_12095282 Ga0207711_120952821 110
152 3300025945 Ga0207679_10296374 Ga0207679_102963742 110
153 3300025945 Ga0207679_10987173 Ga0207679_109871731 110
154 3300025960 Ga0207651_10032427 Ga0207651_100324273 110
155 3300025960 Ga0207651_10541792 Ga0207651_105417922 110
156 3300025960 Ga0207651_10991403 Ga0207651_109914031 110
157 3300025972 Ga0207668_10285117 Ga0207668_102851172 110
158 3300026023 Ga0207677_10189376 Ga0207677_101893763 110
159 3300026095 Ga0207676_10489929 Ga0207676_104899292 110
160 3300026121 Ga0207683_10108202 Ga0207683_101082022 110
161 3300026121 Ga0207683_10131318 Ga0207683_101313185 110
162 3300028379 Ga0268266_10279270 Ga0268266_102792702 110
163 3300028379 Ga0268266_11175824 Ga0268266_111758241 110
164 3300031824 Ga0307413_10237565 Ga0307413_102375652 110
165 3300031852 Ga0307410_10053064 Ga0307410_100530644 110
166 3300031901 Ga0307406_10647289 Ga0307406_106472892 110
167 3300031995 Ga0307409_100012533 Ga0307409_1000125336 110
168 3300031995 Ga0307409_101100719 Ga0307409_1011007191 110
169 3300037312 Ga0395899_0082299 Ga0395899_0082299_813_1148 110
170 3300037418 Ga0395900_0164119 Ga0395900_0164119_1388_1723 110
171 3300037466 Ga0395898_0172498 Ga0395898_0172498_325_660 110
172 3300037471 Ga0395905_0009662 Ga0395905_0009662_7521_7856 110
173 3300037471 Ga0395905_0161174 Ga0395905_0161174_699_1034 110
174 3300038443 Ga0395901_0073941 Ga0395901_0073941_1863_2198 110
175 3300044658 Ga0466972_0317030 Ga0466972_0317030_189_533 110
176 3300046459 Ga0495629_0428706 Ga0495629_0428706_115_453 110
177 3300046525 Ga0495663_0035672 Ga0495663_0035672_506_853 110
178 3300046537 Ga0495598_0006148 Ga0495598_0006148_1190_1537 110
179 3300046539 Ga0495621_0000088 Ga0495621_0000088_11491_11838 110
180 3300046684 Ga0495669_0019471 Ga0495669_0019471_1943_2290 110
181 3300046684 Ga0495669_0196176 Ga0495669_0196176_193_537 110
182 3300046691 Ga0495670_0000192 Ga0495670_0000192_636_983 110
183 3300047322 Ga0495680_0844456 Ga0495680_0844456_194_541 110
184 3300048903 Ga0496100_0403544 Ga0496100_0403544_354_692 110
185 3300048904 Ga0496101_1229560 Ga0496101_1229560_99_446 110
186 3300048912 Ga0496109_0582100 Ga0496109_0582100_492_839 110
187 3300048917 Ga0496114_0566043 Ga0496114_0566043_519_857 110
188 3300048918 Ga0496115_0223188 Ga0496115_0223188_825_1163 110
189 3300001989 JGI24739J22299_10221913 JGI24739J22299_102219132 111
190 3300001990 JGI24737J22298_10009433 JGI24737J22298_100094332 111
191 3300002077 JGI24744J21845_10009819 JGI24744J21845_100098192 111
192 3300005328 Ga0070676_10676600 Ga0070676_106766002 111
193 3300005329 Ga0070683_100728435 Ga0070683_1007284351 111
194 3300005331 Ga0070670_100062023 Ga0070670_1000620236 111
195 3300005334 Ga0068869_100900696 Ga0068869_1009006962 111
196 3300005335 Ga0070666_10298875 Ga0070666_102988752 111
197 3300005336 Ga0070680_100427727 Ga0070680_1004277272 111
198 3300005337 Ga0070682_101646607 Ga0070682_1016466071 111
199 3300005338 Ga0068868_100802119 Ga0068868_1008021192 111
200 3300005338 Ga0068868_102078540 Ga0068868_1020785401 111
201 3300005339 Ga0070660_100045178 Ga0070660_1000451782 111
202 3300005339 Ga0070660_100686048 Ga0070660_1006860481 111
203 3300005344 Ga0070661_100076029 Ga0070661_1000760293 111
204 3300005344 Ga0070661_101887595 Ga0070661_1018875951 111
205 3300005347 Ga0070668_100386003 Ga0070668_1003860033 111
206 3300005347 Ga0070668_101536913 Ga0070668_1015369131 111
207 3300005353 Ga0070669_101112880 Ga0070669_1011128802 111
208 3300005353 Ga0070669_101225506 Ga0070669_1012255061 111
209 3300005355 Ga0070671_100059737 Ga0070671_1000597372 111
210 3300005355 Ga0070671_100788799 Ga0070671_1007887991 111
211 3300005356 Ga0070674_100481052 Ga0070674_1004810521 111
212 3300005364 Ga0070673_100144979 Ga0070673_1001449793 111
213 3300005366 Ga0070659_100002302 Ga0070659_10000230216 111
214 3300005366 Ga0070659_100012307 Ga0070659_1000123078 111
215 3300005366 Ga0070659_100476594 Ga0070659_1004765942 111
216 3300005366 Ga0070659_100549576 Ga0070659_1005495762 111
217 3300005436 Ga0070713_102030045 Ga0070713_1020300452 111
218 3300005455 Ga0070663_100158398 Ga0070663_1001583981 111
219 3300005456 Ga0070678_100272683 Ga0070678_1002726832 111
220 3300005457 Ga0070662_100348382 Ga0070662_1003483821 111
221 3300005457 Ga0070662_100882602 Ga0070662_1008826022 111
222 3300005458 Ga0070681_10497891 Ga0070681_104978912 111
223 3300005535 Ga0070684_100665562 Ga0070684_1006655622 111
224 3300005539 Ga0068853_100172198 Ga0068853_1001721982 111
225 3300005539 Ga0068853_100831824 Ga0068853_1008318241 111
226 3300005546 Ga0070696_100094448 Ga0070696_1000944482 111
227 3300005547 Ga0070693_100290170 Ga0070693_1002901703 111
228 3300005563 Ga0068855_100825803 Ga0068855_1008258032 111
229 3300005564 Ga0070664_101023935 Ga0070664_1010239352 111
230 3300005577 Ga0068857_100004537 Ga0068857_10000453717 111
231 3300005578 Ga0068854_100240081 Ga0068854_1002400813 111
232 3300005615 Ga0070702_100155588 Ga0070702_1001555882 111
233 3300005616 Ga0068852_100035229 Ga0068852_1000352292 111
234 3300005616 Ga0068852_100279884 Ga0068852_1002798843 111
235 3300005616 Ga0068852_100330710 Ga0068852_1003307101 111
236 3300005616 Ga0068852_100512923 Ga0068852_1005129232 111
237 3300005618 Ga0068864_100077523 Ga0068864_1000775233 111
238 3300005618 Ga0068864_100272001 Ga0068864_1002720012 111
239 3300005718 Ga0068866_10157105 Ga0068866_101571052 111
240 3300005719 Ga0068861_100209557 Ga0068861_1002095573 111
241 3300005719 Ga0068861_100425320 Ga0068861_1004253203 111
242 3300005841 Ga0068863_100027210 Ga0068863_1000272101 111
243 3300005844 Ga0068862_100942182 Ga0068862_1009421822 111
244 3300006195 Ga0075366_10140512 Ga0075366_101405123 111
245 3300006358 Ga0068871_100258067 Ga0068871_1002580671 111
246 3300009098 Ga0105245_10753929 Ga0105245_107539292 111
247 3300009098 Ga0105245_12726568 Ga0105245_127265681 111
248 3300009148 Ga0105243_10059114 Ga0105243_100591145 111
249 3300009176 Ga0105242_10448813 Ga0105242_104488132 111
250 3300009177 Ga0105248_11184309 Ga0105248_111843092 111
251 3300009553 Ga0105249_10913898 Ga0105249_109138982 111
252 3300011119 Ga0105246_10024202 Ga0105246_100242024 111
253 3300013100 Ga0157373_10173301 Ga0157373_101733013 111
254 3300013100 Ga0157373_10376658 Ga0157373_103766582 111
255 3300013102 Ga0157371_10072013 Ga0157371_100720135 111
256 3300013104 Ga0157370_10005854 Ga0157370_100058541 111
257 3300013105 Ga0157369_10387141 Ga0157369_103871411 111
258 3300013297 Ga0157378_10088970 Ga0157378_100889702 111
259 3300013297 Ga0157378_10236857 Ga0157378_102368574 111
260 3300013307 Ga0157372_10403918 Ga0157372_104039181 111
261 3300013307 Ga0157372_12695490 Ga0157372_126954902 111
262 3300013308 Ga0157375_10376905 Ga0157375_103769053 111
263 3300013308 Ga0157375_10723465 Ga0157375_107234652 111
264 3300014325 Ga0163163_10011197 Ga0163163_100111974 111
265 3300014326 Ga0157380_10223134 Ga0157380_102231342 111
266 3300014745 Ga0157377_11377485 Ga0157377_113774851 111
267 3300025893 Ga0207682_10012934 Ga0207682_100129344 111
268 3300025899 Ga0207642_10035157 Ga0207642_100351573 111
269 3300025901 Ga0207688_10433644 Ga0207688_104336442 111
270 3300025904 Ga0207647_10053136 Ga0207647_100531366 111
271 3300025904 Ga0207647_10114867 Ga0207647_101148674 111
272 3300025904 Ga0207647_10186268 Ga0207647_101862682 111
273 3300025907 Ga0207645_10770769 Ga0207645_107707691 111
274 3300025912 Ga0207707_10280725 Ga0207707_102807252 111
275 3300025915 Ga0207693_10352234 Ga0207693_103522342 111
276 3300025917 Ga0207660_10158589 Ga0207660_101585892 111
277 3300025919 Ga0207657_10047434 Ga0207657_100474344 111
278 3300025919 Ga0207657_10233247 Ga0207657_102332471 111
279 3300025920 Ga0207649_10087415 Ga0207649_100874153 111
280 3300025920 Ga0207649_10108964 Ga0207649_101089642 111
281 3300025920 Ga0207649_10420491 Ga0207649_104204912 111
282 3300025925 Ga0207650_10050846 Ga0207650_100508465 111
283 3300025925 Ga0207650_10318196 Ga0207650_103181962 111
284 3300025927 Ga0207687_10626034 Ga0207687_106260342 111
285 3300025929 Ga0207664_10214295 Ga0207664_102142952 111
286 3300025931 Ga0207644_10000166 Ga0207644_1000016645 111
287 3300025931 Ga0207644_10182204 Ga0207644_101822043 111
288 3300025931 Ga0207644_10588048 Ga0207644_105880482 111
289 3300025932 Ga0207690_10001687 Ga0207690_100016876 111
290 3300025932 Ga0207690_10012989 Ga0207690_100129896 111
291 3300025932 Ga0207690_10844006 Ga0207690_108440062 111
292 3300025933 Ga0207706_10281448 Ga0207706_102814482 111
293 3300025933 Ga0207706_10977324 Ga0207706_109773242 111
294 3300025934 Ga0207686_11466822 Ga0207686_114668221 111
295 3300025935 Ga0207709_10334450 Ga0207709_103344502 111
296 3300025937 Ga0207669_10190339 Ga0207669_101903392 111
297 3300025940 Ga0207691_10019100 Ga0207691_100191006 111
298 3300025941 Ga0207711_10025930 Ga0207711_100259303 111
299 3300025941 Ga0207711_11128566 Ga0207711_111285662 111
300 3300025942 Ga0207689_10137641 Ga0207689_101376411 111
301 3300025945 Ga0207679_10530675 Ga0207679_105306752 111
302 3300025949 Ga0207667_10294755 Ga0207667_102947552 111
303 3300025949 Ga0207667_10471828 Ga0207667_104718283 111
304 3300025960 Ga0207651_10061004 Ga0207651_100610045 111
305 3300025961 Ga0207712_10501134 Ga0207712_105011342 111
306 3300025972 Ga0207668_11182336 Ga0207668_111823361 111
307 3300025981 Ga0207640_11415231 Ga0207640_114152312 111
308 3300026023 Ga0207677_11079154 Ga0207677_110791542 111
309 3300026041 Ga0207639_10123938 Ga0207639_101239384 111
310 3300026041 Ga0207639_10755264 Ga0207639_107552641 111
311 3300026067 Ga0207678_10030926 Ga0207678_100309268 111
312 3300026088 Ga0207641_10501792 Ga0207641_105017921 111
313 3300026089 Ga0207648_10028853 Ga0207648_100288533 111
314 3300026095 Ga0207676_10022258 Ga0207676_100222582 111
315 3300026116 Ga0207674_10000082 Ga0207674_10000082116 111
316 3300026118 Ga0207675_100258646 Ga0207675_1002586463 111
317 3300026121 Ga0207683_10013235 Ga0207683_100132359 111
318 3300026142 Ga0207698_10395422 Ga0207698_103954221 111
319 3300026142 Ga0207698_10549862 Ga0207698_105498622 111
320 3300028380 Ga0268265_10452368 Ga0268265_104523682 111
321 3300037312 Ga0395899_0033705 Ga0395899_0033705_204_542 111
322 3300037312 Ga0395899_0067035 Ga0395899_0067035_1786_2124 111
323 3300037312 Ga0395899_0091397 Ga0395899_0091397_1585_1923 111
324 3300037312 Ga0395899_0097676 Ga0395899_0097676_197_541 111
325 3300037312 Ga0395899_0117928 Ga0395899_0117928_1429_1767 111
326 3300037418 Ga0395900_0013739 Ga0395900_0013739_4317_4655 111
327 3300037418 Ga0395900_0026185 Ga0395900_0026185_2012_2356 111
328 3300037418 Ga0395900_0125859 Ga0395900_0125859_2080_2418 111
329 3300037418 Ga0395900_0171536 Ga0395900_0171536_912_1250 111
330 3300037418 Ga0395900_0175819 Ga0395900_0175819_1223_1561 111
331 3300037418 Ga0395900_0197618 Ga0395900_0197618_137_475 111
332 3300037418 Ga0395900_0223191 Ga0395900_0223191_1359_1697 111
333 3300037418 Ga0395900_0279047 Ga0395900_0279047_1281_1619 111
334 3300037418 Ga0395900_0359992 Ga0395900_0359992_992_1330 111
335 3300037418 Ga0395900_0409226 Ga0395900_0409226_387_725 111
336 3300037418 Ga0395900_0951666 Ga0395900_0951666_217_555 111
337 3300037466 Ga0395898_0020643 Ga0395898_0020643_781_1119 111
338 3300037466 Ga0395898_0030803 Ga0395898_0030803_2275_2613 111
339 3300037466 Ga0395898_0050851 Ga0395898_0050851_1587_1925 111
340 3300037466 Ga0395898_0092066 Ga0395898_0092066_2130_2474 111
341 3300037466 Ga0395898_0270130 Ga0395898_0270130_357_695 111
342 3300037466 Ga0395898_0331339 Ga0395898_0331339_587_925 111
343 3300037466 Ga0395898_0530287 Ga0395898_0530287_700_1038 111
344 3300037466 Ga0395898_0571390 Ga0395898_0571390_558_902 111
345 3300037466 Ga0395898_0944493 Ga0395898_0944493_433_771 111
346 3300037471 Ga0395905_0002477 Ga0395905_0002477_5642_5980 111
347 3300037471 Ga0395905_0005585 Ga0395905_0005585_4911_5249 111
348 3300037471 Ga0395905_0008253 Ga0395905_0008253_7709_8053 111
349 3300037471 Ga0395905_0021356 Ga0395905_0021356_5635_5973 111
350 3300037471 Ga0395905_0072347 Ga0395905_0072347_2817_3155 111
351 3300037471 Ga0395905_0220741 Ga0395905_0220741_384_722 111
352 3300037471 Ga0395905_0246728 Ga0395905_0246728_1055_1405 111
353 3300037471 Ga0395905_0458796 Ga0395905_0458796_457_795 111
354 3300037471 Ga0395905_0614983 Ga0395905_0614983_436_774 111
355 3300037471 Ga0395905_0821098 Ga0395905_0821098_318_656 111
356 3300037471 Ga0395905_1002243 Ga0395905_1002243_155_493 111
357 3300037471 Ga0395905_1022646 Ga0395905_1022646_20_358 111
358 3300037471 Ga0395905_1053368 Ga0395905_1053368_239_577 111
359 3300037471 Ga0395905_1074589 Ga0395905_1074589_119_457 111
360 3300037471 Ga0395905_1774697 Ga0395905_1774697_165_503 111
361 3300038443 Ga0395901_0021774 Ga0395901_0021774_2839_3177 111
362 3300038443 Ga0395901_0116415 Ga0395901_0116415_1862_2200 111
363 3300038443 Ga0395901_0143341 Ga0395901_0143341_800_1144 111
364 3300038443 Ga0395901_0175994 Ga0395901_0175994_227_565 111
365 3300038443 Ga0395901_0206161 Ga0395901_0206161_1585_1923 111
366 3300038443 Ga0395901_0224553 Ga0395901_0224553_250_588 111
367 3300038443 Ga0395901_0461208 Ga0395901_0461208_111_449 111
368 3300038443 Ga0395901_0714391 Ga0395901_0714391_227_565 111
369 3300038443 Ga0395901_0738375 Ga0395901_0738375_617_955 111
370 3300038443 Ga0395901_0781725 Ga0395901_0781725_18_356 111
371 3300038443 Ga0395901_1001504 Ga0395901_1001504_88_426 111
372 3300038443 Ga0395901_1632103 Ga0395901_1632103_212_550 111
373 3300042005 Ga0439448_0219601 Ga0439448_0219601_234_584 111
374 3300044901 Ga0466960_0013380 Ga0466960_0013380_2053_2400 111
375 3300048904 Ga0496101_1218919 Ga0496101_1218919_161_496 111
376 3300048905 Ga0496102_0586948 Ga0496102_0586948_81_416 111
377 3300048905 Ga0496102_0791558 Ga0496102_0791558_49_387 111
378 3300048906 Ga0496103_0067295 Ga0496103_0067295_1826_2161 111
379 3300048911 Ga0496108_0029914 Ga0496108_0029914_1735_2073 111
380 3300048912 Ga0496109_0108630 Ga0496109_0108630_2100_2438 111
381 3300048912 Ga0496109_0970841 Ga0496109_0970841_100_438 111
382 3300048913 Ga0496110_1536668 Ga0496110_1536668_116_454 111
383 3300048915 Ga0496112_0045619 Ga0496112_0045619_3307_3645 111
384 3300048916 Ga0496113_0223391 Ga0496113_0223391_56_394 111
385 3300048916 Ga0496113_0912381 Ga0496113_0912381_265_603 111
386 3300049583 Ga0501067_0055831 Ga0501067_0055831_1531_1875 111
387 3300049585 Ga0501069_0589030 Ga0501069_0589030_97_441 111

Structural Annotation

Top 5 Hits

ID Description Score Start End
5czz-assembly1.cif.gz_A crystal structure of staphylococcus aureus cas9 in complex with sgrna and target dna (ttgaat pam) 0.732 19 78
6je9-assembly1.cif.gz_A crystal structure of nme1cas9-sgrna dimer mediated by double protein inhibitor acriic3 monomers 0.7279 19 79
7mpz-assembly1.cif.gz_A hnh nuclease domain from g. stearothermophilus cas9 0.6836 16 84
8f43-assembly1.cif.gz_A hnh nuclease domain from g. stearothermophilus cas9, k597a mutant 0.6775 20 93
7el1-assembly1.cif.gz_A structure of a protein from bacteria 0.672 22 88
ID Description Score Start End Superfamily
af_Q59DP4_75_148_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.7359 33 80 2.10.110.10
af_B4FIG1_104_154_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6729 31 80 3.30.40.10
af_B4FY47_2_133_1.10.220.150 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;Arf GTPase activating protein 0.6535 13 41 1.10.220.150
af_Q6PCD5_270_339_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6431 31 80 3.30.40.10
af_P32572_2_163_1.10.220.150 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;Arf GTPase activating protein 0.6208 12 41 1.10.220.150
ID Description Score Start End GO Terms
AF-A0A175RXM3-F1-model_v4 HNH nuclease domain-containing protein 0.8704 22 83 GO:0003676
GO:0004519
GO:0008270
AF-A0A5M9ZK96-F1-model_v4 Uncharacterized protein 0.8577 25 82
AF-A0A0S9KD92-F1-model_v4 HNH domain-containing protein 0.8438 24 81 GO:0003676
GO:0004519
GO:0008270
AF-A0A5M9ZVQ2-F1-model_v4 DUF2116 family Zn-ribbon domain-containing protein 0.8365 24 80
AF-A0A3C2B3U3-F1-model_v4 HNH domain-containing protein 0.8361 25 84 GO:0003676
GO:0004519
GO:0008270

Feature Viewer

pLDDT pTM Quality
82.22 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map