F430836

General Info

Members Datasets Scaffolds Average Seq Length
387 215 384 270

Family's Representative Sequence

Representative Sequence 3300025903|Ga0207680_10151041|Ga0207680_101510412
Length 331
Sequence VSHVTSAVTEAFGKAAADNRAALVGYLPAGFPSVAGAIEGALAMAQAGADVIEVGLPYSDPLMDGPVIADAVHRALAAGTRVTDVLRTVEAVAAAGVPVLVMTYWNPVDRYGVRAFARDLAAAGGSGLITPDLTIEEAGSWLDASAEHDLDRVFLVAPSSTDERVAMIARACRGFVYAASLMGITGTRDAVSGDASGLVERVREHTSLPVAVGLGVSNGAQATQVAAFADGVIVGSAFVRRLGEQGIPAIRDLTAELAASVRRPAPGGGDHGAIEPAPGLENAGRIDKDDLTVAGHGDAAHDRTRGLDLVAACLFIFGHVRGYAKIHAGQP

Samples

Sample ID Description Type Environment
1 2643221721 Oerskovia sp. Root918 Isolate Unclassified
2 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
128 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
129 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 2.07
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.65
Rhizosphere 90.44
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10008310 3300003659 Bacteria 2208
2 Ga0070683_100087430 3300005329 Bacteria 2923
3 Ga0070683_100157726 3300005329 Bacteria 2152
4 Ga0070666_10417703 3300005335 Bacteria 966
5 Ga0070680_100100114 3300005336 Bacteria 2405
6 Ga0070680_100704805 3300005336 Bacteria 869
7 Ga0070687_100014887 3300005343 Bacteria 3504
8 Ga0070661_100028507 3300005344 Bacteria 4028
9 Ga0070675_100598612 3300005354 Bacteria 1000
10 Ga0070671_100060240 3300005355 Bacteria 3160
11 Ga0070659_100018541 3300005366 Bacteria 5251
12 Ga0070659_100381033 3300005366 Bacteria 1188
13 Ga0070709_10000736 3300005434 Bacteria 18505
14 Ga0070709_10006305 3300005434 Bacteria 6460
15 Ga0070709_10021875 3300005434 Bacteria 3732
16 Ga0070709_10022936 3300005434 Bacteria 3658
17 Ga0070709_10032011 3300005434 Bacteria 3168
18 Ga0070714_100039183 3300005435 Bacteria 3988
19 Ga0070714_100041240 3300005435 Bacteria 3894
20 Ga0070714_100050700 3300005435 Bacteria 3537
21 Ga0070714_100120694 3300005435 Bacteria 2331
22 Ga0070714_100215671 3300005435 Bacteria 1761
23 Ga0070713_100009888 3300005436 Bacteria 6863
24 Ga0070713_100031180 3300005436 Bacteria 4243
25 Ga0070713_100222349 3300005436 Bacteria 1713
26 Ga0070713_100275052 3300005436 Bacteria 1543
27 Ga0070710_10000156 3300005437 Bacteria 31483
28 Ga0070710_10008090 3300005437 Bacteria 5113
29 Ga0070710_10102968 3300005437 Bacteria 1703
30 Ga0070711_100001307 3300005439 Bacteria 13557
31 Ga0070711_100004145 3300005439 Bacteria 8519
32 Ga0070711_100015387 3300005439 Bacteria 4842
33 Ga0070700_100130078 3300005441 Bacteria 1698
34 Ga0070694_100044485 3300005444 Bacteria 2971
35 Ga0070708_100021091 3300005445 Bacteria 5503
36 Ga0070708_100032264 3300005445 Bacteria 4541
37 Ga0070708_100043175 3300005445 Bacteria 3961
38 Ga0070708_100176506 3300005445 Bacteria 1996
39 Ga0070708_100396486 3300005445 Bacteria 1301
40 Ga0070663_100034785 3300005455 Bacteria 3491
41 Ga0070663_100064401 3300005455 Bacteria 2649
42 Ga0070678_100015523 3300005456 Bacteria 4844
43 Ga0070662_100075355 3300005457 Bacteria 2498
44 Ga0070681_10033550 3300005458 Bacteria 5152
45 Ga0070681_10097322 3300005458 Bacteria 2890
46 Ga0070706_100002251 3300005467 Bacteria 19550
47 Ga0070706_100003840 3300005467 Bacteria 14685
48 Ga0070706_100005868 3300005467 Bacteria 11644
49 Ga0070706_100008241 3300005467 Bacteria 9720
50 Ga0070706_100020631 3300005467 Bacteria 6073
51 Ga0070706_100046234 3300005467 Bacteria 4019
52 Ga0070706_100563196 3300005467 Bacteria 1060
53 Ga0070707_100001697 3300005468 Bacteria 21256
54 Ga0070707_100014052 3300005468 Bacteria 7501
55 Ga0070707_100024798 3300005468 Bacteria 5685
56 Ga0070707_100060695 3300005468 Bacteria 3626
57 Ga0070707_100067937 3300005468 Bacteria 3429
58 Ga0070707_100278275 3300005468 Bacteria 1626
59 Ga0070707_100359805 3300005468 Bacteria 1414
60 Ga0070698_100000192 3300005471 Bacteria 58336
61 Ga0070698_100003640 3300005471 Bacteria 16926
62 Ga0070698_100003959 3300005471 Bacteria 16291
63 Ga0070698_100006542 3300005471 Bacteria 12636
64 Ga0070698_100010216 3300005471 Bacteria 10026
65 Ga0070698_100032466 3300005471 Bacteria 5408
66 Ga0070698_100037948 3300005471 Bacteria 4966
67 Ga0070698_100407240 3300005471 Bacteria 1294
68 Ga0070698_100685239 3300005471 Bacteria 967
69 Ga0070699_100001377 3300005518 Bacteria 22335
70 Ga0070699_100065645 3300005518 Bacteria 3150
71 Ga0070699_100090111 3300005518 Bacteria 2680
72 Ga0070679_100002003 3300005530 Bacteria 18279
73 Ga0070679_100041363 3300005530 Bacteria 4587
74 Ga0070684_100019353 3300005535 Bacteria 5629
75 Ga0070684_100030575 3300005535 Bacteria 4576
76 Ga0070697_100008219 3300005536 Bacteria 8146
77 Ga0070672_100013385 3300005543 Bacteria 5794
78 Ga0070693_100033517 3300005547 Bacteria 2835
79 Ga0070665_100149650 3300005548 Bacteria 2337
80 Ga0070664_100046753 3300005564 Bacteria 3656
81 Ga0068856_100090004 3300005614 Bacteria 3052
82 Ga0068856_100541308 3300005614 Bacteria 1185
83 Ga0068856_100549475 3300005614 Bacteria 1176
84 Ga0070702_100005141 3300005615 Bacteria 6057
85 Ga0068859_100163459 3300005617 Bacteria 2305
86 Ga0068864_100518811 3300005618 Bacteria 1148
87 Ga0068851_10007725 3300005834 Bacteria 4946
88 Ga0068863_100075497 3300005841 Bacteria 3189
89 Ga0068863_100385086 3300005841 Bacteria 1370
90 Ga0081540_1000322 3300005983 Bacteria 49507
91 Ga0070717_10057771 3300006028 Bacteria 3207
92 Ga0070717_10060027 3300006028 Bacteria 3148
93 Ga0070717_10063559 3300006028 Bacteria 3064
94 Ga0070717_10065738 3300006028 Bacteria 3015
95 Ga0070717_10158672 3300006028 Bacteria 1961
96 Ga0070717_10162453 3300006028 Bacteria 1938
97 Ga0070715_10045111 3300006163 Bacteria 1867
98 Ga0070715_10066231 3300006163 Bacteria 1601
99 Ga0070715_10080940 3300006163 Bacteria 1474
100 Ga0070716_100000365 3300006173 Bacteria 18621
101 Ga0070716_100013716 3300006173 Bacteria 4136
102 Ga0070716_100021698 3300006173 Bacteria 3386
103 Ga0070716_100034045 3300006173 Bacteria 2790
104 Ga0070712_100000642 3300006175 Bacteria 20552
105 Ga0070712_100010662 3300006175 Bacteria 5803
106 Ga0070712_100039566 3300006175 Bacteria 3227
107 Ga0070712_100252422 3300006175 Bacteria 1410
108 Ga0070712_100372060 3300006175 Bacteria 1174
109 Ga0068871_100160181 3300006358 Bacteria 1924
110 Ga0075434_100024075 3300006871 Bacteria 5947
111 Ga0075434_100335196 3300006871 Bacteria 1533
112 Ga0075436_100011288 3300006914 Bacteria 6128
113 Ga0075436_100041466 3300006914 Bacteria 3176
114 Ga0097620_100163458 3300006931 Bacteria 2305
115 Ga0075435_100017227 3300007076 Bacteria 5462
116 Ga0075435_100282318 3300007076 Bacteria 1417
117 Ga0105247_10299564 3300009101 Bacteria 1115
118 Ga0105243_10129470 3300009148 Bacteria 2139
119 Ga0105242_10121521 3300009176 Bacteria 2242
120 Ga0105237_10629666 3300009545 Bacteria 1080
121 Ga0105238_10340538 3300009551 Bacteria 1488
122 Ga0105249_10871758 3300009553 Bacteria 966
123 Ga0099796_10013785 3300010159 Bacteria 2318
124 Ga0105246_10608008 3300011119 Bacteria 946
125 Ga0157316_1000738 3300012510 Bacteria 1821
126 Ga0157373_10099352 3300013100 Bacteria 2048
127 Ga0157371_10014729 3300013102 Bacteria 5885
128 Ga0157370_10234200 3300013104 Bacteria 1699
129 Ga0157369_10045514 3300013105 Bacteria 4772
130 Ga0157369_10067753 3300013105 Bacteria 3836
131 Ga0157369_10383080 3300013105 Bacteria 1460
132 Ga0157378_10176366 3300013297 Bacteria 2008
133 Ga0157375_10361733 3300013308 Bacteria 1617
134 Ga0163163_10084742 3300014325 Bacteria 3176
135 Ga0157379_10248646 3300014968 Bacteria 1614
136 Ga0197907_10002768 3300020069 Bacteria 2394
137 Ga0206351_10866342 3300020077 Bacteria 1176
138 Ga0206354_10394181 3300020081 Bacteria 1159
139 Ga0206353_10227842 3300020082 Bacteria 1676
140 Ga0206353_10492043 3300020082 Bacteria 1728
141 Ga0213874_10059893 3300021377 Bacteria 1190
142 Ga0213875_10000730 3300021388 Bacteria 25049
143 Ga0213875_10033254 3300021388 Bacteria 2435
144 Ga0224712_10001262 3300022467 Bacteria 5726
145 Ga0224712_10025208 3300022467 Bacteria 2088
146 Ga0207692_10003806 3300025898 Bacteria 5931
147 Ga0207692_10005596 3300025898 Bacteria 5044
148 Ga0207692_10009094 3300025898 Bacteria 4136
149 Ga0207692_10166813 3300025898 Bacteria 1273
150 Ga0207692_10223211 3300025898 Bacteria 1118
151 Ga0207680_10151041 3300025903 Bacteria 1549
152 Ga0207685_10044272 3300025905 Bacteria 1682
153 Ga0207685_10117579 3300025905 Bacteria 1162
154 Ga0207699_10002590 3300025906 Bacteria 8531
155 Ga0207699_10009777 3300025906 Bacteria 4790
156 Ga0207699_10023839 3300025906 Bacteria 3336
157 Ga0207699_10030924 3300025906 Bacteria 3001
158 Ga0207699_10062166 3300025906 Bacteria 2250
159 Ga0207684_10000446 3300025910 Bacteria 54436
160 Ga0207684_10003086 3300025910 Bacteria 16463
161 Ga0207684_10021398 3300025910 Bacteria 5521
162 Ga0207684_10113606 3300025910 Bacteria 2318
163 Ga0207684_10121418 3300025910 Bacteria 2240
164 Ga0207684_10125693 3300025910 Bacteria 2201
165 Ga0207684_10126218 3300025910 Bacteria 2196
166 Ga0207707_10026867 3300025912 Bacteria 5030
167 Ga0207707_10028502 3300025912 Bacteria 4880
168 Ga0207707_10213722 3300025912 Bacteria 1680
169 Ga0207693_10009557 3300025915 Bacteria 7897
170 Ga0207693_10010514 3300025915 Bacteria 7510
171 Ga0207693_10180165 3300025915 Bacteria 1662
172 Ga0207663_10013504 3300025916 Bacteria 4441
173 Ga0207663_10040231 3300025916 Bacteria 2840
174 Ga0207663_10066656 3300025916 Bacteria 2305
175 Ga0207663_10098528 3300025916 Bacteria 1957
176 Ga0207663_10099063 3300025916 Bacteria 1953
177 Ga0207660_10017349 3300025917 Bacteria 4782
178 Ga0207660_10158988 3300025917 Bacteria 1742
179 Ga0207662_10001797 3300025918 Bacteria 10524
180 Ga0207657_10007772 3300025919 Bacteria 10949
181 Ga0207649_10366311 3300025920 Bacteria 1071
182 Ga0207649_10482675 3300025920 Bacteria 940
183 Ga0207652_10131569 3300025921 Bacteria 2232
184 Ga0207652_10139868 3300025921 Bacteria 2164
185 Ga0207646_10000470 3300025922 Bacteria 53859
186 Ga0207646_10004059 3300025922 Bacteria 16158
187 Ga0207646_10016420 3300025922 Bacteria 6947
188 Ga0207646_10030925 3300025922 Bacteria 4849
189 Ga0207646_10050344 3300025922 Bacteria 3728
190 Ga0207646_10059546 3300025922 Bacteria 3411
191 Ga0207659_10357755 3300025926 Bacteria 1212
192 Ga0207700_10001856 3300025928 Bacteria 11967
193 Ga0207700_10002174 3300025928 Bacteria 11232
194 Ga0207700_10006887 3300025928 Bacteria 6910
195 Ga0207700_10061559 3300025928 Bacteria 2847
196 Ga0207700_10486064 3300025928 Bacteria 1091
197 Ga0207664_10002078 3300025929 Bacteria 13174
198 Ga0207664_10004095 3300025929 Bacteria 9836
199 Ga0207664_10006150 3300025929 Bacteria 8230
200 Ga0207664_10006585 3300025929 Bacteria 8001
201 Ga0207664_10026822 3300025929 Bacteria 4359
202 Ga0207664_10076740 3300025929 Bacteria 2705
203 Ga0207664_10123390 3300025929 Bacteria 2171
204 Ga0207664_10139875 3300025929 Bacteria 2047
205 Ga0207664_10151285 3300025929 Bacteria 1972
206 Ga0207664_10409980 3300025929 Bacteria 1206
207 Ga0207644_10252849 3300025931 Bacteria 1406
208 Ga0207690_10283780 3300025932 Bacteria 1290
209 Ga0207706_10191649 3300025933 Bacteria 1794
210 Ga0207709_10535566 3300025935 Bacteria 919
211 Ga0207665_10000207 3300025939 Bacteria 39551
212 Ga0207665_10013063 3300025939 Bacteria 5457
213 Ga0207665_10017032 3300025939 Bacteria 4773
214 Ga0207665_10056665 3300025939 Bacteria 2646
215 Ga0207665_10266029 3300025939 Bacteria 1272
216 Ga0207691_10016886 3300025940 Bacteria 6925
217 Ga0207711_10502216 3300025941 Bacteria 1130
218 Ga0207661_10078065 3300025944 Bacteria 2724
219 Ga0207661_10231561 3300025944 Bacteria 1636
220 Ga0207661_10259521 3300025944 Bacteria 1547
221 Ga0207678_10001648 3300026067 Bacteria 20470
222 Ga0207708_10031861 3300026075 Bacteria 4003
223 Ga0207702_10054814 3300026078 Bacteria 3379
224 Ga0207702_10280270 3300026078 Bacteria 1575
225 Ga0207641_10019538 3300026088 Bacteria 5561
226 Ga0207676_10042395 3300026095 Bacteria 3500
227 Ga0207674_10005313 3300026116 Bacteria 15320
228 Ga0207674_10035633 3300026116 Bacteria 5193
229 Ga0207683_10012233 3300026121 Bacteria 7325
230 Ga0207698_10174223 3300026142 Bacteria 1898
231 Ga0268265_10276330 3300028380 Bacteria 1501
232 Ga0265326_10001423 3300028558 Bacteria 8429
233 Ga0265319_1001883 3300028563 Bacteria 11916
234 Ga0265334_10000162 3300028573 Bacteria 40960
235 Ga0265318_10015064 3300028577 Bacteria 3228
236 Ga0265323_10002554 3300028653 Bacteria 8276
237 Ga0265336_10005180 3300028666 Bacteria 4841
238 Ga0265336_10006509 3300028666 Bacteria 4206
239 Ga0265338_10000986 3300028800 Bacteria 47980
240 Ga0265338_10001519 3300028800 Bacteria 37467
241 Ga0265338_10003673 3300028800 Bacteria 21387
242 Ga0265338_10004932 3300028800 Bacteria 17719
243 Ga0265324_10002638 3300029957 Bacteria 8985
244 Ga0265332_10001899 3300031238 Bacteria 11071
245 Ga0265320_10012479 3300031240 Bacteria 4940
246 Ga0265340_10001476 3300031247 Bacteria 13482
247 Ga0265339_10157144 3300031249 Bacteria 1146
248 Ga0265316_10006830 3300031344 Bacteria 10845
249 Ga0316579_10032348 3300031691 Bacteria 2398
250 Ga0265314_10024675 3300031711 Bacteria 4553
251 Ga0265342_10003983 3300031712 Bacteria 11821
252 Ga0316578_10206043 3300031728 Bacteria 1183
253 Ga0316577_10040602 3300031733 Bacteria 2602
254 Ga0316583_10014477 3300032133 Bacteria 2842
255 Ga0316585_10005211 3300032137 Bacteria 3662
256 Ga0316214_1005999 3300033545 Bacteria 1600
257 Ga0373938_0044714 3300034957 Bacteria 995
258 Ga0373926_0003455 3300035083 Bacteria 5096
259 Ga0373929_0002759 3300035085 Bacteria 3207
260 Ga0373944_0013139 3300035089 Bacteria 2291
261 Ga0373952_0071591 3300035092 Bacteria 868
262 Ga0373936_0014157 3300035113 Bacteria 3047
263 Ga0373939_0025530 3300035114 Bacteria 1657
264 Ga0373953_0003078 3300035117 Bacteria 5125
265 Ga0373957_0037253 3300035120 Bacteria 1816
266 Ga0373957_0047520 3300035120 Bacteria 1632
267 Ga0373943_0074512 3300035170 Bacteria 1726
268 Ga0373946_0065091 3300035171 Bacteria 1560
269 Ga0373946_0147797 3300035171 Bacteria 1094
270 Ga0316574_0352755 3300035398 Bacteria 930
271 Ga0373924_0044523 3300035410 Bacteria 1824
272 Ga0373935_0024315 3300035692 Bacteria 3728
273 Ga0373935_0167642 3300035692 Bacteria 1500
274 Ga0373935_0190898 3300035692 Bacteria 1411
275 Ga0373927_0296577 3300035695 Bacteria 1064
276 Ga0373933_0070378 3300035724 Bacteria 2128
277 Ga0373933_0124548 3300035724 Bacteria 1616
278 Ga0373933_0129350 3300035724 Bacteria 1586
279 Ga0373947_0000002 3300035725 Bacteria 383924
280 Ga0373937_0012696 3300036401 Bacteria 7412
281 Ga0373937_0225215 3300036401 Bacteria 1765
282 Ga0373937_0490580 3300036401 Bacteria 1167
283 Ga0372808_002484 3300036459 Bacteria 2138
284 Ga0316582_0052356 3300036647 Bacteria 2594
285 Ga0316584_0064000 3300036712 Bacteria 2753
286 Ga0373925_0000010 3300037068 Bacteria 229059
287 Ga0373925_0009881 3300037068 Bacteria 6934
288 Ga0395900_0262721 3300037418 Bacteria 1723
289 Ga0395898_0181568 3300037466 Bacteria 2011
290 Ga0395898_0259516 3300037466 Bacteria 1657
291 Ga0316581_0004253 3300037588 Bacteria 3640
292 Ga0436364_0086889 3300037853 Bacteria 54583
293 Ga0436364_0381327 3300037853 Bacteria 2155
294 Ga0436364_0749920 3300037853 Bacteria 3430
295 Ga0436364_0863834 3300037853 Bacteria 14069
296 Ga0436364_0988896 3300037853 Bacteria 3478
297 Ga0436364_1094569 3300037853 Bacteria 4433
298 Ga0436365_1331796 3300039437 Bacteria 2892
299 Ga0436363_1009944 3300039450 Bacteria 1455
300 Ga0466963_0032046 3300044694 Bacteria 3401
301 Ga0466968_0211457 3300044735 Bacteria 911
302 Ga0466958_0276088 3300045836 Bacteria 1077
303 Ga0466958_0375860 3300045836 Bacteria 916
304 Ga0466967_0200796 3300045976 Bacteria 1888
305 Ga0466967_0546521 3300045976 Bacteria 1140
306 Ga0495592_0008430 3300046454 Bacteria 7734
307 Ga0495651_0082375 3300046462 Bacteria 2427
308 Ga0495653_0082973 3300046463 Bacteria 2364
309 Ga0495582_0001019 3300046473 Bacteria 15685
310 Ga0495662_0004234 3300046476 Bacteria 7224
311 Ga0495664_0044793 3300046477 Bacteria 2622
312 Ga0495608_0116040 3300046511 Bacteria 1718
313 Ga0495618_0026264 3300046514 Bacteria 3619
314 Ga0495628_0032028 3300046516 Bacteria 4248
315 Ga0495628_0044922 3300046516 Bacteria 3513
316 Ga0495630_0074585 3300046517 Bacteria 2555
317 Ga0495652_0142995 3300046529 Bacteria 1879
318 Ga0495652_0149278 3300046529 Bacteria 1828
319 Ga0495665_0002197 3300046531 Bacteria 10566
320 Ga0495640_0011159 3300046533 Bacteria 6916
321 Ga0495640_0020935 3300046533 Bacteria 4809
322 Ga0495586_0015744 3300046535 Bacteria 4022
323 Ga0495587_0003673 3300046536 Bacteria 10213
324 Ga0495645_0165735 3300046543 Bacteria 1524
325 Ga0495667_0370831 3300046559 Bacteria 903
326 Ga0495634_0050913 3300046642 Bacteria 2779
327 Ga0495657_0026740 3300046675 Bacteria 4083
328 Ga0495657_0047880 3300046675 Bacteria 2887
329 Ga0495657_0048199 3300046675 Bacteria 2875
330 Ga0495599_0015008 3300046678 Bacteria 4801
331 Ga0495599_0095529 3300046678 Bacteria 1854
332 Ga0495599_0133462 3300046678 Bacteria 1541
333 Ga0495623_0023569 3300046679 Bacteria 3971
334 Ga0495623_0082449 3300046679 Bacteria 1987
335 Ga0495646_0164479 3300046680 Bacteria 1226
336 Ga0495658_0053556 3300046683 Bacteria 2292
337 Ga0495624_0021822 3300046690 Bacteria 4242
338 Ga0495600_0138298 3300046809 Bacteria 1581
339 Ga0495581_0002197 3300047315 Bacteria 11002
340 Ga0495604_0008984 3300047317 Bacteria 7903
341 Ga0495604_0062922 3300047317 Bacteria 2833
342 Ga0495674_0013363 3300047319 Bacteria 7721
343 Ga0495680_0005150 3300047322 Bacteria 12342
344 Ga0495680_0041017 3300047322 Bacteria 3682
345 Ga0495675_0007336 3300047444 Bacteria 6793
346 Ga0495684_0044939 3300047471 Bacteria 3380
347 Ga0495684_0053591 3300047471 Bacteria 3077
348 Ga0495684_0195633 3300047471 Bacteria 1493
349 Ga0495684_0282062 3300047471 Bacteria 1198
350 Ga0495593_0001064 3300047673 Bacteria 16030
351 Ga0495602_0059230 3300048088 Bacteria 3344
352 Ga0495602_0137506 3300048088 Bacteria 1938
353 Ga0496102_0154219 3300048905 Bacteria 2159
354 Ga0496104_0000511 3300048907 Bacteria 33274
355 Ga0496104_0035275 3300048907 Bacteria 4670
356 Ga0496106_0058139 3300048909 Bacteria 2926
357 Ga0496107_0054970 3300048910 Bacteria 2874
358 Ga0496108_0009062 3300048911 Bacteria 8062
359 Ga0496109_0478166 3300048912 Bacteria 1176
360 Ga0496110_0320629 3300048913 Bacteria 1411
361 Ga0496112_0000637 3300048915 Bacteria 24324
362 Ga0496112_0030403 3300048915 Bacteria 5226
363 Ga0496112_0180362 3300048915 Bacteria 2076
364 Ga0496113_0027481 3300048916 Bacteria 4080
365 Ga0496114_0070028 3300048917 Bacteria 2945
366 Ga0496114_0163177 3300048917 Bacteria 1939
367 Ga0496115_0025544 3300048918 Bacteria 4600
368 Ga0496115_0062245 3300048918 Bacteria 3010
369 Ga0496115_0160719 3300048918 Bacteria 1856
370 Ga0496115_0227994 3300048918 Bacteria 1537
371 Ga0496126_0026368 3300048929 Bacteria 5574
372 Ga0496126_0040904 3300048929 Bacteria 4294
373 Ga0496126_0172151 3300048929 Bacteria 1844
374 Ga0496126_0506621 3300048929 Bacteria 964
375 Ga0501047_0051988 3300049581 Bacteria 3960
376 Ga0501070_0161226 3300049586 Bacteria 1849
377 nmdc:mga0n895_40909_c1 3300050512 Bacteria 4504
378 nmdc:mga0n895_514910_c1 3300050512 Bacteria 1204
379 nmdc:mga0rr50_338372_c1 3300050513 Bacteria 1264
380 nmdc:mga0rr50_4442_c1 3300050513 Bacteria 8253
381 nmdc:mga0a205_157374_c1 3300050515 Bacteria 2170
382 Ga0495601_0224762 3300053077 Bacteria 1226
383 Ga0495612_0008662 3300053078 Bacteria 4126
384 Ga0495619_0003789 3300053085 Bacteria 9724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100335196 Ga0075434_1003351962 250
2 3300050512 nmdc:mga0n895_514910_c1 nmdc:mga0n895_514910_c1_149_1012 254
3 3300005434 Ga0070709_10021875 Ga0070709_100218752 255
4 iso_pu_bacteria 3002998708 3003009159 256
5 iso_pu_bacteria 8053945823 8053947400 256
6 3300005445 Ga0070708_100021091 Ga0070708_1000210912 257
7 3300005467 Ga0070706_100002251 Ga0070706_1000022515 257
8 3300005471 Ga0070698_100006542 Ga0070698_1000065422 257
9 3300006028 Ga0070717_10065738 Ga0070717_100657382 257
10 3300013105 Ga0157369_10045514 Ga0157369_100455143 257
11 3300026142 Ga0207698_10174223 Ga0207698_101742232 257
12 3300005458 Ga0070681_10033550 Ga0070681_100335502 259
13 3300005530 Ga0070679_100002003 Ga0070679_1000020032 259
14 3300007076 Ga0075435_100017227 Ga0075435_1000172271 259
15 3300025912 Ga0207707_10028502 Ga0207707_100285022 259
16 3300025921 Ga0207652_10131569 Ga0207652_101315692 259
17 3300049586 Ga0501070_0161226 Ga0501070_0161226_145_963 259
18 3300005329 Ga0070683_100087430 Ga0070683_1000874301 260
19 3300005329 Ga0070683_100157726 Ga0070683_1001577262 260
20 3300005336 Ga0070680_100100114 Ga0070680_1001001141 260
21 3300005366 Ga0070659_100381033 Ga0070659_1003810331 260
22 3300005434 Ga0070709_10032011 Ga0070709_100320112 260
23 3300005435 Ga0070714_100215671 Ga0070714_1002156711 260
24 3300005436 Ga0070713_100031180 Ga0070713_1000311801 260
25 3300005455 Ga0070663_100064401 Ga0070663_1000644012 260
26 3300005530 Ga0070679_100041363 Ga0070679_1000413633 260
27 3300005535 Ga0070684_100019353 Ga0070684_1000193533 260
28 3300005614 Ga0068856_100541308 Ga0068856_1005413082 260
29 3300005614 Ga0068856_100549475 Ga0068856_1005494751 260
30 3300013104 Ga0157370_10234200 Ga0157370_102342002 260
31 3300013105 Ga0157369_10067753 Ga0157369_100677532 260
32 3300013105 Ga0157369_10383080 Ga0157369_103830801 260
33 3300020077 Ga0206351_10866342 Ga0206351_108663422 260
34 3300020081 Ga0206354_10394181 Ga0206354_103941811 260
35 3300020082 Ga0206353_10492043 Ga0206353_104920432 260
36 3300022467 Ga0224712_10025208 Ga0224712_100252081 260
37 3300025912 Ga0207707_10026867 Ga0207707_100268672 260
38 3300025917 Ga0207660_10017349 Ga0207660_100173491 260
39 3300025917 Ga0207660_10158988 Ga0207660_101589881 260
40 3300025920 Ga0207649_10366311 Ga0207649_103663111 260
41 3300025921 Ga0207652_10139868 Ga0207652_101398681 260
42 3300025928 Ga0207700_10486064 Ga0207700_104860641 260
43 3300025929 Ga0207664_10026822 Ga0207664_100268222 260
44 3300025929 Ga0207664_10409980 Ga0207664_104099802 260
45 3300025932 Ga0207690_10283780 Ga0207690_102837801 260
46 3300025939 Ga0207665_10266029 Ga0207665_102660292 260
47 3300025944 Ga0207661_10078065 Ga0207661_100780651 260
48 3300025944 Ga0207661_10259521 Ga0207661_102595212 260
49 3300026078 Ga0207702_10280270 Ga0207702_102802701 260
50 3300026116 Ga0207674_10035633 Ga0207674_100356336 260
51 3300028558 Ga0265326_10001423 Ga0265326_100014232 260
52 3300028563 Ga0265319_1001883 Ga0265319_10018834 260
53 3300028573 Ga0265334_10000162 Ga0265334_1000016219 260
54 3300028577 Ga0265318_10015064 Ga0265318_100150643 260
55 3300028653 Ga0265323_10002554 Ga0265323_100025543 260
56 3300028666 Ga0265336_10005180 Ga0265336_100051802 260
57 3300028800 Ga0265338_10000986 Ga0265338_1000098645 260
58 3300028800 Ga0265338_10003673 Ga0265338_100036735 260
59 3300028800 Ga0265338_10004932 Ga0265338_1000493212 260
60 3300029957 Ga0265324_10002638 Ga0265324_100026383 260
61 3300031238 Ga0265332_10001899 Ga0265332_100018995 260
62 3300031240 Ga0265320_10012479 Ga0265320_100124793 260
63 3300031247 Ga0265340_10001476 Ga0265340_100014767 260
64 3300031249 Ga0265339_10157144 Ga0265339_101571442 260
65 3300031344 Ga0265316_10006830 Ga0265316_100068302 260
66 3300031711 Ga0265314_10024675 Ga0265314_100246753 260
67 3300031712 Ga0265342_10003983 Ga0265342_100039836 260
68 3300037068 Ga0373925_0000010 Ga0373925_0000010_161200_161997 260
69 3300037418 Ga0395900_0262721 Ga0395900_0262721_863_1669 260
70 3300037466 Ga0395898_0181568 Ga0395898_0181568_529_1335 260
71 3300037466 Ga0395898_0259516 Ga0395898_0259516_40_837 260
72 3300045836 Ga0466958_0375860 Ga0466958_0375860_59_856 260
73 3300045976 Ga0466967_0546521 Ga0466967_0546521_135_932 260
74 3300048905 Ga0496102_0154219 Ga0496102_0154219_954_1751 260
75 3300048912 Ga0496109_0478166 Ga0496109_0478166_361_1158 260
76 3300048929 Ga0496126_0026368 Ga0496126_0026368_3302_4099 260
77 3300005468 Ga0070707_100067937 Ga0070707_1000679372 261
78 3300005471 Ga0070698_100685239 Ga0070698_1006852391 261
79 3300006175 Ga0070712_100252422 Ga0070712_1002524222 261
80 3300025922 Ga0207646_10016420 Ga0207646_100164207 261
81 3300028666 Ga0265336_10006509 Ga0265336_100065092 261
82 3300028800 Ga0265338_10001519 Ga0265338_1000151922 261
83 3300033545 Ga0316214_1005999 Ga0316214_10059991 261
84 3300037853 Ga0436364_0381327 Ga0436364_0381327_1044_1844 261
85 3300048918 Ga0496115_0062245 Ga0496115_0062245_808_1608 261
86 3300048929 Ga0496126_0040904 Ga0496126_0040904_2909_3709 261
87 3300049581 Ga0501047_0051988 Ga0501047_0051988_1423_2223 261
88 3300005434 Ga0070709_10000736 Ga0070709_100007364 262
89 3300005434 Ga0070709_10006305 Ga0070709_100063052 262
90 3300005434 Ga0070709_10022936 Ga0070709_100229364 262
91 3300005435 Ga0070714_100039183 Ga0070714_1000391834 262
92 3300005435 Ga0070714_100041240 Ga0070714_1000412402 262
93 3300005435 Ga0070714_100050700 Ga0070714_1000507002 262
94 3300005436 Ga0070713_100009888 Ga0070713_1000098886 262
95 3300005436 Ga0070713_100222349 Ga0070713_1002223492 262
96 3300005436 Ga0070713_100275052 Ga0070713_1002750522 262
97 3300005437 Ga0070710_10000156 Ga0070710_1000015628 262
98 3300005437 Ga0070710_10008090 Ga0070710_100080902 262
99 3300005439 Ga0070711_100001307 Ga0070711_1000013079 262
100 3300005439 Ga0070711_100004145 Ga0070711_1000041452 262
101 3300005439 Ga0070711_100015387 Ga0070711_1000153873 262
102 3300005445 Ga0070708_100032264 Ga0070708_1000322642 262
103 3300005445 Ga0070708_100043175 Ga0070708_1000431752 262
104 3300005467 Ga0070706_100003840 Ga0070706_1000038402 262
105 3300005467 Ga0070706_100005868 Ga0070706_1000058684 262
106 3300005467 Ga0070706_100008241 Ga0070706_1000082413 262
107 3300005467 Ga0070706_100020631 Ga0070706_1000206312 262
108 3300005467 Ga0070706_100046234 Ga0070706_1000462342 262
109 3300005467 Ga0070706_100563196 Ga0070706_1005631961 262
110 3300005468 Ga0070707_100001697 Ga0070707_1000016972 262
111 3300005468 Ga0070707_100060695 Ga0070707_1000606952 262
112 3300005471 Ga0070698_100000192 Ga0070698_10000019228 262
113 3300005471 Ga0070698_100003640 Ga0070698_10000364018 262
114 3300005471 Ga0070698_100003959 Ga0070698_1000039595 262
115 3300005471 Ga0070698_100032466 Ga0070698_1000324666 262
116 3300005518 Ga0070699_100090111 Ga0070699_1000901112 262
117 3300006028 Ga0070717_10060027 Ga0070717_100600272 262
118 3300006028 Ga0070717_10063559 Ga0070717_100635592 262
119 3300006028 Ga0070717_10158672 Ga0070717_101586721 262
120 3300006028 Ga0070717_10162453 Ga0070717_101624532 262
121 3300006163 Ga0070715_10045111 Ga0070715_100451112 262
122 3300006163 Ga0070715_10066231 Ga0070715_100662312 262
123 3300006163 Ga0070715_10080940 Ga0070715_100809401 262
124 3300006173 Ga0070716_100000365 Ga0070716_10000036518 262
125 3300006173 Ga0070716_100013716 Ga0070716_1000137164 262
126 3300006173 Ga0070716_100021698 Ga0070716_1000216982 262
127 3300006175 Ga0070712_100000642 Ga0070712_1000006426 262
128 3300006175 Ga0070712_100010662 Ga0070712_1000106622 262
129 3300006871 Ga0075434_100024075 Ga0075434_1000240752 262
130 3300006914 Ga0075436_100011288 Ga0075436_1000112882 262
131 3300025898 Ga0207692_10003806 Ga0207692_100038062 262
132 3300025898 Ga0207692_10005596 Ga0207692_100055961 262
133 3300025898 Ga0207692_10009094 Ga0207692_100090942 262
134 3300025905 Ga0207685_10117579 Ga0207685_101175792 262
135 3300025906 Ga0207699_10002590 Ga0207699_100025905 262
136 3300025906 Ga0207699_10009777 Ga0207699_100097772 262
137 3300025906 Ga0207699_10062166 Ga0207699_100621663 262
138 3300025910 Ga0207684_10000446 Ga0207684_100004462 262
139 3300025910 Ga0207684_10003086 Ga0207684_100030865 262
140 3300025910 Ga0207684_10021398 Ga0207684_100213987 262
141 3300025910 Ga0207684_10113606 Ga0207684_101136063 262
142 3300025910 Ga0207684_10126218 Ga0207684_101262182 262
143 3300025915 Ga0207693_10009557 Ga0207693_100095573 262
144 3300025915 Ga0207693_10010514 Ga0207693_100105142 262
145 3300025915 Ga0207693_10180165 Ga0207693_101801652 262
146 3300025916 Ga0207663_10013504 Ga0207663_100135042 262
147 3300025916 Ga0207663_10040231 Ga0207663_100402313 262
148 3300025916 Ga0207663_10066656 Ga0207663_100666562 262
149 3300025916 Ga0207663_10098528 Ga0207663_100985282 262
150 3300025922 Ga0207646_10000470 Ga0207646_1000047021 262
151 3300025922 Ga0207646_10004059 Ga0207646_100040597 262
152 3300025922 Ga0207646_10059546 Ga0207646_100595462 262
153 3300025928 Ga0207700_10001856 Ga0207700_100018569 262
154 3300025928 Ga0207700_10002174 Ga0207700_1000217412 262
155 3300025928 Ga0207700_10006887 Ga0207700_100068876 262
156 3300025929 Ga0207664_10002078 Ga0207664_1000207815 262
157 3300025929 Ga0207664_10004095 Ga0207664_100040957 262
158 3300025929 Ga0207664_10006585 Ga0207664_100065853 262
159 3300025929 Ga0207664_10076740 Ga0207664_100767402 262
160 3300025939 Ga0207665_10000207 Ga0207665_1000020719 262
161 3300025939 Ga0207665_10013063 Ga0207665_100130637 262
162 3300025939 Ga0207665_10017032 Ga0207665_100170322 262
163 3300035113 Ga0373936_0014157 Ga0373936_0014157_1444_2262 262
164 3300035117 Ga0373953_0003078 Ga0373953_0003078_2597_3415 262
165 3300035120 Ga0373957_0037253 Ga0373957_0037253_227_1048 262
166 3300035120 Ga0373957_0047520 Ga0373957_0047520_70_888 262
167 3300035170 Ga0373943_0074512 Ga0373943_0074512_883_1701 262
168 3300035171 Ga0373946_0147797 Ga0373946_0147797_132_950 262
169 3300035410 Ga0373924_0044523 Ga0373924_0044523_487_1308 262
170 3300035692 Ga0373935_0024315 Ga0373935_0024315_2730_3548 262
171 3300035692 Ga0373935_0190898 Ga0373935_0190898_234_1037 262
172 3300035695 Ga0373927_0296577 Ga0373927_0296577_209_1027 262
173 3300035724 Ga0373933_0124548 Ga0373933_0124548_594_1397 262
174 3300035724 Ga0373933_0129350 Ga0373933_0129350_24_842 262
175 3300036401 Ga0373937_0012696 Ga0373937_0012696_3846_4664 262
176 3300036401 Ga0373937_0225215 Ga0373937_0225215_319_1140 262
177 3300036459 Ga0372808_002484 Ga0372808_002484_65_889 262
178 3300037068 Ga0373925_0009881 Ga0373925_0009881_2808_3626 262
179 3300046454 Ga0495592_0008430 Ga0495592_0008430_6891_7709 262
180 3300046462 Ga0495651_0082375 Ga0495651_0082375_1210_2031 262
181 3300046463 Ga0495653_0082973 Ga0495653_0082973_183_1001 262
182 3300046473 Ga0495582_0001019 Ga0495582_0001019_5204_6022 262
183 3300046476 Ga0495662_0004234 Ga0495662_0004234_3442_4260 262
184 3300046514 Ga0495618_0026264 Ga0495618_0026264_2057_2875 262
185 3300046516 Ga0495628_0032028 Ga0495628_0032028_416_1234 262
186 3300046516 Ga0495628_0044922 Ga0495628_0044922_2283_3098 262
187 3300046517 Ga0495630_0074585 Ga0495630_0074585_374_1192 262
188 3300046529 Ga0495652_0142995 Ga0495652_0142995_329_1144 262
189 3300046531 Ga0495665_0002197 Ga0495665_0002197_205_1023 262
190 3300046533 Ga0495640_0011159 Ga0495640_0011159_2851_3669 262
191 3300046533 Ga0495640_0020935 Ga0495640_0020935_1261_2076 262
192 3300046535 Ga0495586_0015744 Ga0495586_0015744_1063_1881 262
193 3300046536 Ga0495587_0003673 Ga0495587_0003673_2597_3415 262
194 3300046642 Ga0495634_0050913 Ga0495634_0050913_598_1416 262
195 3300046675 Ga0495657_0048199 Ga0495657_0048199_1758_2579 262
196 3300046678 Ga0495599_0015008 Ga0495599_0015008_3703_4521 262
197 3300046678 Ga0495599_0095529 Ga0495599_0095529_147_962 262
198 3300046679 Ga0495623_0023569 Ga0495623_0023569_2427_3245 262
199 3300046679 Ga0495623_0082449 Ga0495623_0082449_368_1189 262
200 3300046680 Ga0495646_0164479 Ga0495646_0164479_222_1043 262
201 3300046683 Ga0495658_0053556 Ga0495658_0053556_310_1128 262
202 3300046690 Ga0495624_0021822 Ga0495624_0021822_2995_3813 262
203 3300046809 Ga0495600_0138298 Ga0495600_0138298_292_1113 262
204 3300047315 Ga0495581_0002197 Ga0495581_0002197_6794_7612 262
205 3300047317 Ga0495604_0008984 Ga0495604_0008984_6487_7305 262
206 3300047319 Ga0495674_0013363 Ga0495674_0013363_5864_6679 262
207 3300047322 Ga0495680_0005150 Ga0495680_0005150_10549_11370 262
208 3300047444 Ga0495675_0007336 Ga0495675_0007336_375_1193 262
209 3300047471 Ga0495684_0195633 Ga0495684_0195633_391_1206 262
210 3300047471 Ga0495684_0282062 Ga0495684_0282062_364_1185 262
211 3300047673 Ga0495593_0001064 Ga0495593_0001064_744_1562 262
212 3300048088 Ga0495602_0059230 Ga0495602_0059230_2395_3216 262
213 3300048088 Ga0495602_0137506 Ga0495602_0137506_376_1194 262
214 3300048907 Ga0496104_0000511 Ga0496104_0000511_26706_27518 262
215 3300048911 Ga0496108_0009062 Ga0496108_0009062_1806_2618 262
216 3300048915 Ga0496112_0000637 Ga0496112_0000637_13448_14260 262
217 3300048916 Ga0496113_0027481 Ga0496113_0027481_554_1366 262
218 3300048917 Ga0496114_0163177 Ga0496114_0163177_523_1335 262
219 3300048918 Ga0496115_0025544 Ga0496115_0025544_2524_3327 262
220 3300048918 Ga0496115_0160719 Ga0496115_0160719_484_1296 262
221 3300048929 Ga0496126_0172151 Ga0496126_0172151_448_1257 262
222 3300050512 nmdc:mga0n895_40909_c1 nmdc:mga0n895_40909_c1_1912_2724 262
223 3300050513 nmdc:mga0rr50_4442_c1 nmdc:mga0rr50_4442_c1_857_1669 262
224 3300050515 nmdc:mga0a205_157374_c1 nmdc:mga0a205_157374_c1_811_1623 262
225 3300053077 Ga0495601_0224762 Ga0495601_0224762_222_1037 262
226 3300053078 Ga0495612_0008662 Ga0495612_0008662_1050_1868 262
227 3300053085 Ga0495619_0003789 Ga0495619_0003789_2185_3003 262
228 iso_pu_bacteria 2643221721 2644664355 262
229 3300005614 Ga0068856_100090004 Ga0068856_1000900042 263
230 3300005841 Ga0068863_100385086 Ga0068863_1003850861 263
231 3300007076 Ga0075435_100282318 Ga0075435_1002823182 263
232 3300021377 Ga0213874_10059893 Ga0213874_100598931 263
233 3300021388 Ga0213875_10033254 Ga0213875_100332542 263
234 3300025929 Ga0207664_10123390 Ga0207664_101233903 263
235 3300035114 Ga0373939_0025530 Ga0373939_0025530_480_1304 263
236 3300037853 Ga0436364_0749920 Ga0436364_0749920_715_1521 263
237 3300037853 Ga0436364_0988896 Ga0436364_0988896_2606_3412 263
238 3300037853 Ga0436364_1094569 Ga0436364_1094569_1808_2611 263
239 3300039437 Ga0436365_1331796 Ga0436365_1331796_857_1669 263
240 3300039450 Ga0436363_1009944 Ga0436363_1009944_387_1199 263
241 3300044694 Ga0466963_0032046 Ga0466963_0032046_2088_2891 263
242 3300045836 Ga0466958_0276088 Ga0466958_0276088_94_897 263
243 3300046675 Ga0495657_0047880 Ga0495657_0047880_593_1399 263
244 3300047317 Ga0495604_0062922 Ga0495604_0062922_99_905 263
245 3300047471 Ga0495684_0044939 Ga0495684_0044939_2324_3130 263
246 3300048907 Ga0496104_0035275 Ga0496104_0035275_113_937 263
247 3300048910 Ga0496107_0054970 Ga0496107_0054970_1866_2690 263
248 3300048915 Ga0496112_0030403 Ga0496112_0030403_3079_3903 263
249 3300048918 Ga0496115_0227994 Ga0496115_0227994_576_1379 263
250 3300050513 nmdc:mga0rr50_338372_c1 nmdc:mga0rr50_338372_c1_305_1108 263
251 3300005468 Ga0070707_100014052 Ga0070707_1000140523 264
252 3300005468 Ga0070707_100024798 Ga0070707_1000247984 264
253 3300005468 Ga0070707_100359805 Ga0070707_1003598052 264
254 3300005471 Ga0070698_100407240 Ga0070698_1004072402 264
255 3300005518 Ga0070699_100065645 Ga0070699_1000656452 264
256 3300006175 Ga0070712_100039566 Ga0070712_1000395662 264
257 3300025898 Ga0207692_10223211 Ga0207692_102232111 264
258 3300025910 Ga0207684_10125693 Ga0207684_101256932 264
259 3300025922 Ga0207646_10050344 Ga0207646_100503442 264
260 3300025929 Ga0207664_10006150 Ga0207664_100061502 264
261 3300025929 Ga0207664_10139875 Ga0207664_101398752 264
262 3300035083 Ga0373926_0003455 Ga0373926_0003455_1896_2708 264
263 3300035171 Ga0373946_0065091 Ga0373946_0065091_264_1076 264
264 3300035725 Ga0373947_0000002 Ga0373947_0000002_198884_199696 264
265 3300036401 Ga0373937_0490580 Ga0373937_0490580_337_1152 264
266 3300048915 Ga0496112_0180362 Ga0496112_0180362_42_851 264
267 3300005471 Ga0070698_100010216 Ga0070698_1000102165 265
268 3300035085 Ga0373929_0002759 Ga0373929_0002759_81_878 265
269 3300003659 JGI25404J52841_10008310 JGI25404J52841_100083102 266
270 3300005335 Ga0070666_10417703 Ga0070666_104177031 266
271 3300005336 Ga0070680_100704805 Ga0070680_1007048051 266
272 3300005343 Ga0070687_100014887 Ga0070687_1000148874 266
273 3300005344 Ga0070661_100028507 Ga0070661_1000285072 266
274 3300005354 Ga0070675_100598612 Ga0070675_1005986121 266
275 3300005355 Ga0070671_100060240 Ga0070671_1000602403 266
276 3300005366 Ga0070659_100018541 Ga0070659_1000185413 266
277 3300005435 Ga0070714_100120694 Ga0070714_1001206942 266
278 3300005437 Ga0070710_10102968 Ga0070710_101029682 266
279 3300005441 Ga0070700_100130078 Ga0070700_1001300781 266
280 3300005444 Ga0070694_100044485 Ga0070694_1000444852 266
281 3300005445 Ga0070708_100176506 Ga0070708_1001765062 266
282 3300005445 Ga0070708_100396486 Ga0070708_1003964861 266
283 3300005455 Ga0070663_100034785 Ga0070663_1000347853 266
284 3300005456 Ga0070678_100015523 Ga0070678_1000155233 266
285 3300005457 Ga0070662_100075355 Ga0070662_1000753551 266
286 3300005458 Ga0070681_10097322 Ga0070681_100973223 266
287 3300005468 Ga0070707_100278275 Ga0070707_1002782751 266
288 3300005471 Ga0070698_100037948 Ga0070698_1000379482 266
289 3300005518 Ga0070699_100001377 Ga0070699_1000013773 266
290 3300005535 Ga0070684_100030575 Ga0070684_1000305753 266
291 3300005536 Ga0070697_100008219 Ga0070697_1000082194 266
292 3300005543 Ga0070672_100013385 Ga0070672_1000133858 266
293 3300005547 Ga0070693_100033517 Ga0070693_1000335173 266
294 3300005548 Ga0070665_100149650 Ga0070665_1001496502 266
295 3300005564 Ga0070664_100046753 Ga0070664_1000467534 266
296 3300005615 Ga0070702_100005141 Ga0070702_1000051411 266
297 3300005617 Ga0068859_100163459 Ga0068859_1001634593 266
298 3300005618 Ga0068864_100518811 Ga0068864_1005188111 266
299 3300005834 Ga0068851_10007725 Ga0068851_100077253 266
300 3300005841 Ga0068863_100075497 Ga0068863_1000754973 266
301 3300005983 Ga0081540_1000322 Ga0081540_100032224 266
302 3300006028 Ga0070717_10057771 Ga0070717_100577713 266
303 3300006173 Ga0070716_100034045 Ga0070716_1000340452 266
304 3300006175 Ga0070712_100372060 Ga0070712_1003720601 266
305 3300006358 Ga0068871_100160181 Ga0068871_1001601812 266
306 3300006914 Ga0075436_100041466 Ga0075436_1000414663 266
307 3300006931 Ga0097620_100163458 Ga0097620_1001634583 266
308 3300009101 Ga0105247_10299564 Ga0105247_102995642 266
309 3300009148 Ga0105243_10129470 Ga0105243_101294701 266
310 3300009176 Ga0105242_10121521 Ga0105242_101215212 266
311 3300009545 Ga0105237_10629666 Ga0105237_106296662 266
312 3300009551 Ga0105238_10340538 Ga0105238_103405382 266
313 3300009553 Ga0105249_10871758 Ga0105249_108717581 266
314 3300010159 Ga0099796_10013785 Ga0099796_100137851 266
315 3300011119 Ga0105246_10608008 Ga0105246_106080081 266
316 3300012510 Ga0157316_1000738 Ga0157316_10007382 266
317 3300013100 Ga0157373_10099352 Ga0157373_100993522 266
318 3300013102 Ga0157371_10014729 Ga0157371_100147296 266
319 3300013297 Ga0157378_10176366 Ga0157378_101763662 266
320 3300013308 Ga0157375_10361733 Ga0157375_103617332 266
321 3300014325 Ga0163163_10084742 Ga0163163_100847421 266
322 3300014968 Ga0157379_10248646 Ga0157379_102486462 266
323 3300020069 Ga0197907_10002768 Ga0197907_100027683 266
324 3300020082 Ga0206353_10227842 Ga0206353_102278422 266
325 3300021388 Ga0213875_10000730 Ga0213875_1000073019 266
326 3300022467 Ga0224712_10001262 Ga0224712_100012626 266
327 3300025898 Ga0207692_10166813 Ga0207692_101668132 266
328 3300025903 Ga0207680_10151041 Ga0207680_101510412 266
329 3300025905 Ga0207685_10044272 Ga0207685_100442722 266
330 3300025906 Ga0207699_10023839 Ga0207699_100238392 266
331 3300025906 Ga0207699_10030924 Ga0207699_100309241 266
332 3300025910 Ga0207684_10121418 Ga0207684_101214182 266
333 3300025912 Ga0207707_10213722 Ga0207707_102137222 266
334 3300025916 Ga0207663_10099063 Ga0207663_100990632 266
335 3300025918 Ga0207662_10001797 Ga0207662_100017971 266
336 3300025919 Ga0207657_10007772 Ga0207657_100077723 266
337 3300025920 Ga0207649_10482675 Ga0207649_104826751 266
338 3300025922 Ga0207646_10030925 Ga0207646_100309252 266
339 3300025926 Ga0207659_10357755 Ga0207659_103577551 266
340 3300025928 Ga0207700_10061559 Ga0207700_100615593 266
341 3300025929 Ga0207664_10151285 Ga0207664_101512852 266
342 3300025931 Ga0207644_10252849 Ga0207644_102528492 266
343 3300025933 Ga0207706_10191649 Ga0207706_101916492 266
344 3300025935 Ga0207709_10535566 Ga0207709_105355661 266
345 3300025939 Ga0207665_10056665 Ga0207665_100566652 266
346 3300025940 Ga0207691_10016886 Ga0207691_100168868 266
347 3300025941 Ga0207711_10502216 Ga0207711_105022161 266
348 3300025944 Ga0207661_10231561 Ga0207661_102315612 266
349 3300026067 Ga0207678_10001648 Ga0207678_1000164822 266
350 3300026075 Ga0207708_10031861 Ga0207708_100318613 266
351 3300026078 Ga0207702_10054814 Ga0207702_100548143 266
352 3300026088 Ga0207641_10019538 Ga0207641_100195381 266
353 3300026095 Ga0207676_10042395 Ga0207676_100423953 266
354 3300026116 Ga0207674_10005313 Ga0207674_100053131 266
355 3300026121 Ga0207683_10012233 Ga0207683_100122333 266
356 3300028380 Ga0268265_10276330 Ga0268265_102763301 266
357 3300031691 Ga0316579_10032348 Ga0316579_100323483 266
358 3300031728 Ga0316578_10206043 Ga0316578_102060431 266
359 3300031733 Ga0316577_10040602 Ga0316577_100406023 266
360 3300032133 Ga0316583_10014477 Ga0316583_100144772 266
361 3300032137 Ga0316585_10005211 Ga0316585_100052113 266
362 3300034957 Ga0373938_0044714 Ga0373938_0044714_144_944 266
363 3300035089 Ga0373944_0013139 Ga0373944_0013139_1325_2137 266
364 3300035092 Ga0373952_0071591 Ga0373952_0071591_29_829 266
365 3300035398 Ga0316574_0352755 Ga0316574_0352755_71_898 266
366 3300035692 Ga0373935_0167642 Ga0373935_0167642_79_891 266
367 3300035724 Ga0373933_0070378 Ga0373933_0070378_838_1662 266
368 3300036647 Ga0316582_0052356 Ga0316582_0052356_638_1465 266
369 3300036712 Ga0316584_0064000 Ga0316584_0064000_1868_2695 266
370 3300037588 Ga0316581_0004253 Ga0316581_0004253_682_1509 266
371 3300037853 Ga0436364_0086889 Ga0436364_0086889_21601_22446 266
372 3300037853 Ga0436364_0863834 Ga0436364_0863834_9089_9928 266
373 3300044735 Ga0466968_0211457 Ga0466968_0211457_59_862 266
374 3300045976 Ga0466967_0200796 Ga0466967_0200796_372_1175 266
375 3300046477 Ga0495664_0044793 Ga0495664_0044793_30_833 266
376 3300046511 Ga0495608_0116040 Ga0495608_0116040_658_1461 266
377 3300046529 Ga0495652_0149278 Ga0495652_0149278_871_1674 266
378 3300046543 Ga0495645_0165735 Ga0495645_0165735_111_914 266
379 3300046559 Ga0495667_0370831 Ga0495667_0370831_16_819 266
380 3300046675 Ga0495657_0026740 Ga0495657_0026740_2929_3732 266
381 3300046678 Ga0495599_0133462 Ga0495599_0133462_92_895 266
382 3300047322 Ga0495680_0041017 Ga0495680_0041017_242_1045 266
383 3300047471 Ga0495684_0053591 Ga0495684_0053591_2216_3019 266
384 3300048909 Ga0496106_0058139 Ga0496106_0058139_1654_2487 266
385 3300048913 Ga0496110_0320629 Ga0496110_0320629_312_1145 266
386 3300048917 Ga0496114_0070028 Ga0496114_0070028_793_1626 266
387 3300048929 Ga0496126_0506621 Ga0496126_0506621_58_870 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00290

Trp_syntA

Tryptophan synthase alpha chain

12

263

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tcf-assembly2.cif.gz_E crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form 0.9879 8 262
5tch-assembly2.cif.gz_G crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form, trpa-g66v mutant 0.9853 5 263
6dwe-assembly1.cif.gz_A crystal structure of tryptophan synthase from m. tuberculosis - aminoacrylate- and brd0059-bound form 0.9838 5 264
6e9p-assembly2.cif.gz_C crystal structure of tryptophan synthase from m. tuberculosis - open form with brd0059 bound 0.9822 5 264
5tch-assembly2.cif.gz_G crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form, trpa-g66v mutant 0.9813 5 263
ID Description Score Start End Superfamily
6du1C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9748 5 264 3.20.20.70
6du1C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.971 5 264 3.20.20.70
af_B4F800_73_338_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9475 8 260 3.20.20.70
2ekcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9366 5 263 3.20.20.70
2ekcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9331 5 263 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6I2Z999-F1-model_v4 deleted 0.9833 5 165
AF-A0A2W2E360-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9805 5 242 GO:0004834
GO:0005829
GO:0006568
AF-A0A4Q5TMP9-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9799 5 263 GO:0004834
GO:0005829
GO:0006568
AF-A0A7W0NGA0-F1-model_v4 deleted 0.9789 5 262
AF-A0A0Q9TFA4-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9775 4 262 GO:0004834
GO:0005829
GO:0006568

Feature Viewer

pLDDT pTM Quality
90.74 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map