F430864

General Info

Members Datasets Scaffolds Average Seq Length
387 204 774 211

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10474344|Ga0307513_104743441
Length 233
Sequence MGAAQHAFSLAVVPAGRMASEMFRRQVRWFAALWCGCAVSWSAVAAPDFVGERASDDVRYAASWVLDGADNQGKPFVIVDKRNARVYVFDAAGRLAGASAALLGLAPGDDAIPDIARRAPSSLRPAERTTPAGRFDSQPGHNDKGEDIVWVDYDASLAIHRLRPAPLAERRPERLASALVDDKRISFGCIIVPVAFYEGIVSATLGRQHGVVYVLPEVRAANELFGDMRLGSR

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
180 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
181 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
182 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
185 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
186 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
187 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
188 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
189 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
190 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
194 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
195 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
200 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
201 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
202 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
203 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
204 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 1.55
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.32
Nodule 0
Rhizoplane 0.78
Rhizosphere 63.82
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10474344 3300031456 Bacteria 972
2 JGI25150J39212_1017167 3300002774 Bacteria 1173
3 JGI25153J46596_10001431 3300003215 Bacteria 14278
4 rootH1_10012335 3300003316 Bacteria 3316
5 rootL2_10005479 3300003322 Bacteria 4204
6 rootH1_10081759 3300003323 Bacteria 3799
7 Ga0055526_1031030 3300003771 Bacteria 1543
8 Ga0065165_1001629 3300005262 Bacteria 22844
9 Ga0070676_10010733 3300005328 Bacteria 4971
10 Ga0070690_100015924 3300005330 Bacteria 4493
11 Ga0070670_100015970 3300005331 Bacteria 6442
12 Ga0070670_100097840 3300005331 Bacteria 2525
13 Ga0070670_100136123 3300005331 Unclassified 2123
14 Ga0070670_100160871 3300005331 Bacteria 1946
15 Ga0070677_10167880 3300005333 Unclassified 1035
16 Ga0068869_100001957 3300005334 Bacteria 12337
17 Ga0068869_100041765 3300005334 Bacteria 3285
18 Ga0068869_100347394 3300005334 Bacteria 1208
19 Ga0068868_100029651 3300005338 Bacteria 4191
20 Ga0068868_100035763 3300005338 Bacteria 3841
21 Ga0068868_100054992 3300005338 Bacteria 3139
22 Ga0068868_100293201 3300005338 Bacteria 1380
23 Ga0070660_100158790 3300005339 Bacteria 1821
24 Ga0070661_100077627 3300005344 Bacteria 2449
25 Ga0070668_100027356 3300005347 Bacteria 4330
26 Ga0070668_100340943 3300005347 Bacteria 1266
27 Ga0070669_100009364 3300005353 Bacteria 6977
28 Ga0070669_100248083 3300005353 Bacteria 1417
29 Ga0070675_100022210 3300005354 Bacteria 5068
30 Ga0070675_100141081 3300005354 Bacteria 2060
31 Ga0070675_100778303 3300005354 Bacteria 874
32 Ga0070674_100058227 3300005356 Bacteria 2685
33 Ga0070674_100099697 3300005356 Bacteria 2114
34 Ga0070674_100184472 3300005356 Bacteria 1600
35 Ga0070673_100018156 3300005364 Bacteria 5021
36 Ga0070673_100033551 3300005364 Bacteria 3878
37 Ga0070673_100056225 3300005364 Bacteria 3104
38 Ga0070673_100933320 3300005364 Bacteria 806
39 Ga0070688_100150067 3300005365 Bacteria 1592
40 Ga0070659_100373418 3300005366 Bacteria 1200
41 Ga0070659_100517776 3300005366 Bacteria 1018
42 Ga0070659_100610603 3300005366 Bacteria 938
43 Ga0070667_100000975 3300005367 Bacteria 26309
44 Ga0070667_100040558 3300005367 Bacteria 3904
45 Ga0070667_100108284 3300005367 Bacteria 2407
46 Ga0070667_100446450 3300005367 Bacteria 1181
47 Ga0070663_100178894 3300005455 Bacteria 1644
48 Ga0070663_100366218 3300005455 Bacteria 1170
49 Ga0070663_100649913 3300005455 Bacteria 892
50 Ga0070678_100011861 3300005456 Bacteria 5392
51 Ga0070662_100002116 3300005457 Bacteria 12176
52 Ga0070662_100037830 3300005457 Bacteria 3424
53 Ga0070662_100260432 3300005457 Bacteria 1397
54 Ga0068867_100001098 3300005459 Bacteria 18476
55 Ga0070706_100001239 3300005467 Bacteria 27289
56 Ga0070707_100048557 3300005468 Bacteria 4065
57 Ga0070672_100098323 3300005543 Bacteria 2370
58 Ga0070672_100339774 3300005543 Bacteria 1278
59 Ga0070686_100101891 3300005544 Bacteria 1941
60 Ga0070665_100003420 3300005548 Bacteria 16958
61 Ga0070665_100053787 3300005548 Bacteria 4038
62 Ga0070665_100330707 3300005548 Unclassified 1528
63 Ga0070665_100610147 3300005548 Bacteria 1104
64 Ga0070664_100098699 3300005564 Bacteria 2537
65 Ga0068857_100014101 3300005577 Bacteria 6958
66 Ga0068852_100023231 3300005616 Bacteria 4988
67 Ga0068852_100208214 3300005616 Bacteria 1854
68 Ga0068859_100112508 3300005617 Bacteria 2786
69 Ga0068859_100510693 3300005617 Bacteria 1297
70 Ga0068859_100658558 3300005617 Bacteria 1139
71 Ga0068864_100004564 3300005618 Bacteria 11370
72 Ga0068864_100159176 3300005618 Bacteria 2052
73 Ga0068861_100002467 3300005719 Bacteria 12062
74 Ga0068861_100006700 3300005719 Bacteria 7871
75 Ga0068851_10075983 3300005834 Bacteria 1746
76 Ga0068863_100007420 3300005841 Bacteria 10731
77 Ga0068863_100016507 3300005841 Bacteria 7082
78 Ga0068863_100154294 3300005841 Bacteria 2198
79 Ga0068858_100027193 3300005842 Bacteria 5315
80 Ga0068858_100041134 3300005842 Bacteria 4287
81 Ga0068860_100003409 3300005843 Bacteria 16341
82 Ga0068860_100187395 3300005843 Unclassified 2001
83 Ga0068860_100468558 3300005843 Bacteria 1254
84 Ga0068860_100580866 3300005843 Bacteria 1125
85 Ga0068862_100008823 3300005844 Bacteria 8348
86 Ga0068862_100076088 3300005844 Bacteria 2904
87 Ga0068862_100188539 3300005844 Bacteria 1854
88 Ga0075365_10021077 3300006038 Bacteria 4058
89 Ga0075368_10001719 3300006042 Bacteria 7048
90 Ga0075368_10004738 3300006042 Bacteria 4629
91 Ga0075368_10045396 3300006042 Bacteria 1736
92 Ga0075363_100029491 3300006048 Bacteria 2833
93 Ga0075363_100111411 3300006048 Bacteria 1522
94 Ga0075363_100117738 3300006048 Bacteria 1481
95 Ga0075362_10000656 3300006177 Bacteria 10183
96 Ga0075362_10001320 3300006177 Bacteria 7855
97 Ga0075362_10049645 3300006177 Bacteria 1875
98 Ga0075367_10000315 3300006178 Bacteria 17086
99 Ga0075367_10022706 3300006178 Bacteria 3522
100 Ga0075367_10159939 3300006178 Bacteria 1400
101 Ga0075366_10000111 3300006195 Bacteria 33316
102 Ga0075366_10000773 3300006195 Bacteria 15241
103 Ga0075366_10001511 3300006195 Bacteria 11607
104 Ga0075366_10002824 3300006195 Bacteria 8993
105 Ga0075366_10021313 3300006195 Bacteria 3767
106 Ga0075366_10042656 3300006195 Bacteria 2686
107 Ga0075366_10049917 3300006195 Bacteria 2483
108 Ga0075366_10091861 3300006195 Bacteria 1818
109 Ga0075366_10128021 3300006195 Bacteria 1532
110 Ga0097621_100149062 3300006237 Bacteria 2005
111 Ga0075370_10000184 3300006353 Bacteria 21841
112 Ga0075370_10009871 3300006353 Bacteria 4974
113 Ga0075370_10030535 3300006353 Bacteria 3007
114 Ga0075370_10066384 3300006353 Unclassified 2058
115 Ga0075370_10088269 3300006353 Bacteria 1788
116 Ga0075434_101257100 3300006871 Bacteria 752
117 Ga0068865_100028238 3300006881 Bacteria 3713
118 Ga0068865_100066018 3300006881 Bacteria 2552
119 Ga0097620_100112509 3300006931 Bacteria 2786
120 Ga0097620_100510722 3300006931 Bacteria 1297
121 Ga0097620_100658585 3300006931 Bacteria 1139
122 Ga0105240_10034526 3300009093 Bacteria 6522
123 Ga0105245_10009748 3300009098 Bacteria 8370
124 Ga0114129_10545519 3300009147 Bacteria 1508
125 Ga0105243_10007766 3300009148 Bacteria 8249
126 Ga0105243_10025107 3300009148 Bacteria 4551
127 Ga0105243_10122713 3300009148 Bacteria 2193
128 Ga0105241_10509379 3300009174 Bacteria 1074
129 Ga0105248_10081229 3300009177 Bacteria 3644
130 Ga0105248_10437668 3300009177 Bacteria 1473
131 Ga0105248_10882628 3300009177 Bacteria 1010
132 Ga0105237_10008024 3300009545 Bacteria 11487
133 Ga0105237_10448976 3300009545 Bacteria 1295
134 Ga0105249_10034727 3300009553 Bacteria 4570
135 Ga0105249_10037530 3300009553 Bacteria 4397
136 Ga0105249_11104718 3300009553 Archaea 863
137 Ga0105239_10131485 3300010375 Bacteria 2784
138 Ga0105246_10709385 3300011119 Unclassified 883
139 Ga0157374_10186835 3300013296 Unclassified 2026
140 Ga0157378_10002645 3300013297 Bacteria 15968
141 Ga0163162_10003350 3300013306 Bacteria 15323
142 Ga0163162_10061809 3300013306 Bacteria 3784
143 Ga0163162_10205621 3300013306 Bacteria 2098
144 Ga0157375_10145351 3300013308 Bacteria 2502
145 Ga0157375_10339690 3300013308 Bacteria 1667
146 Ga0163163_10024190 3300014325 Bacteria 5778
147 Ga0163163_10728465 3300014325 Bacteria 1055
148 Ga0157380_10019441 3300014326 Bacteria 5062
149 Ga0157380_10034131 3300014326 Bacteria 3923
150 Ga0157380_10197898 3300014326 Bacteria 1780
151 Ga0157379_10012359 3300014968 Bacteria 7459
152 Ga0157379_10067166 3300014968 Bacteria 3206
153 Ga0157379_10561634 3300014968 Bacteria 1063
154 Ga0157376_10190324 3300014969 Bacteria 1881
155 Ga0157376_10227364 3300014969 Bacteria 1731
156 Ga0157376_10713733 3300014969 Bacteria 1009
157 Ga0163161_10041989 3300017792 Bacteria 3288
158 Ga0163161_10124648 3300017792 Bacteria 1938
159 Ga0163161_10384102 3300017792 Bacteria 1123
160 Ga0207425_1000546 3300025245 Bacteria 22428
161 Ga0209129_1000041 3300025258 Bacteria 307590
162 Ga0209673_1025682 3300025273 Bacteria 1953
163 Ga0209564_1000029 3300025295 Bacteria 505995
164 Ga0209758_1000043 3300025297 Bacteria 402310
165 Ga0209050_1000672 3300025298 Bacteria 51771
166 Ga0209256_1013841 3300025299 Bacteria 2962
167 Ga0209051_1057622 3300025303 Bacteria 1244
168 Ga0209257_1020113 3300025304 Bacteria 2482
169 Ga0207656_10086471 3300025321 Bacteria 1417
170 Ga0207680_10033882 3300025903 Bacteria 2917
171 Ga0207643_10078196 3300025908 Bacteria 1913
172 Ga0207684_10010775 3300025910 Bacteria 8024
173 Ga0207671_10175708 3300025914 Bacteria 1665
174 Ga0207649_10163927 3300025920 Bacteria 1542
175 Ga0207681_10006462 3300025923 Bacteria 7198
176 Ga0207681_10088193 3300025923 Bacteria 2209
177 Ga0207650_10069901 3300025925 Bacteria 2638
178 Ga0207650_10301084 3300025925 Unclassified 1309
179 Ga0207650_10350247 3300025925 Bacteria 1215
180 Ga0207644_10069436 3300025931 Bacteria 2573
181 Ga0207690_10936050 3300025932 Bacteria 719
182 Ga0207706_10013122 3300025933 Bacteria 7537
183 Ga0207706_10085235 3300025933 Bacteria 2778
184 Ga0207706_10296294 3300025933 Bacteria 1410
185 Ga0207709_10028425 3300025935 Bacteria 3233
186 Ga0207669_10077008 3300025937 Bacteria 2119
187 Ga0207669_10725523 3300025937 Bacteria 819
188 Ga0207704_10032046 3300025938 Bacteria 2969
189 Ga0207704_10052238 3300025938 Bacteria 2477
190 Ga0207691_10015905 3300025940 Bacteria 7147
191 Ga0207691_10026107 3300025940 Bacteria 5482
192 Ga0207691_10079532 3300025940 Bacteria 2950
193 Ga0207691_10198414 3300025940 Bacteria 1747
194 Ga0207711_10149375 3300025941 Bacteria 2107
195 Ga0207711_10576209 3300025941 Bacteria 1050
196 Ga0207689_10002506 3300025942 Bacteria 17061
197 Ga0207689_10071794 3300025942 Bacteria 2843
198 Ga0207689_10170461 3300025942 Bacteria 1794
199 Ga0207679_10043140 3300025945 Bacteria 3246
200 Ga0207651_10080858 3300025960 Bacteria 2341
201 Ga0207712_10019143 3300025961 Bacteria 4467
202 Ga0207712_10032695 3300025961 Bacteria 3512
203 Ga0207668_10023581 3300025972 Bacteria 3958
204 Ga0207668_10208825 3300025972 Bacteria 1560
205 Ga0207640_10034459 3300025981 Bacteria 3160
206 Ga0207640_10343654 3300025981 Bacteria 1196
207 Ga0207658_10002242 3300025986 Bacteria 14325
208 Ga0207658_10088282 3300025986 Bacteria 2397
209 Ga0207658_10266344 3300025986 Bacteria 1462
210 Ga0207658_10536314 3300025986 Unclassified 1046
211 Ga0207677_10091145 3300026023 Bacteria 2217
212 Ga0207677_10333249 3300026023 Bacteria 1265
213 Ga0207677_10517531 3300026023 Bacteria 1034
214 Ga0207703_10065799 3300026035 Bacteria 2980
215 Ga0207703_10281613 3300026035 Bacteria 1510
216 Ga0207678_10020461 3300026067 Bacteria 5803
217 Ga0207678_10214045 3300026067 Bacteria 1649
218 Ga0207641_10009069 3300026088 Bacteria 8216
219 Ga0207641_10400006 3300026088 Bacteria 1318
220 Ga0207648_10000847 3300026089 Bacteria 34532
221 Ga0207648_10111270 3300026089 Bacteria 2404
222 Ga0207648_10218030 3300026089 Bacteria 1695
223 Ga0207648_11058976 3300026089 Bacteria 760
224 Ga0207676_10126954 3300026095 Bacteria 2162
225 Ga0207676_10300493 3300026095 Bacteria 1465
226 Ga0207674_10009979 3300026116 Bacteria 10807
227 Ga0207674_10014053 3300026116 Bacteria 8847
228 Ga0207675_100000247 3300026118 Bacteria 51569
229 Ga0207675_100029363 3300026118 Bacteria 5124
230 Ga0207683_10005596 3300026121 Bacteria 10775
231 Ga0207683_10020427 3300026121 Bacteria 5665
232 Ga0207698_10414194 3300026142 Bacteria 1291
233 Ga0209813_10001853 3300027866 Bacteria 4770
234 Ga0209813_10046114 3300027866 Bacteria 1345
235 Ga0268266_10146452 3300028379 Bacteria 2124
236 Ga0268265_10012889 3300028380 Bacteria 5675
237 Ga0268265_10027135 3300028380 Bacteria 4083
238 Ga0268265_10085792 3300028380 Bacteria 2500
239 Ga0268265_10495309 3300028380 Bacteria 1150
240 Ga0268264_10050290 3300028381 Bacteria 3470
241 Ga0268264_10420398 3300028381 Bacteria 1289
242 Ga0268264_10571900 3300028381 Unclassified 1111
243 Ga0307517_10040214 3300028786 Bacteria 5099
244 Ga0307517_10061688 3300028786 Bacteria 3542
245 Ga0307517_10100575 3300028786 Bacteria 2282
246 Ga0307517_10127295 3300028786 Bacteria 1852
247 Ga0307517_10223881 3300028786 Bacteria 1139
248 Ga0307515_10022943 3300028794 Bacteria 10975
249 Ga0307515_10232552 3300028794 Bacteria 1632
250 Ga0307515_10337647 3300028794 Unclassified 1161
251 Ga0307513_10045089 3300031456 Bacteria 4821
252 Ga0307513_10094467 3300031456 Bacteria 3035
253 Ga0307513_10135189 3300031456 Bacteria 2402
254 Ga0307509_10001648 3300031507 Bacteria 37411
255 Ga0307509_10002250 3300031507 Bacteria 31597
256 Ga0307509_10021038 3300031507 Bacteria 7388
257 Ga0307509_10023831 3300031507 Bacteria 6860
258 Ga0307509_10178607 3300031507 Bacteria 1992
259 Ga0307408_100265103 3300031548 Bacteria 1424
260 Ga0307508_10000296 3300031616 Bacteria 60826
261 Ga0307508_10005343 3300031616 Bacteria 12235
262 Ga0307508_10570842 3300031616 Bacteria 730
263 Ga0307514_10082789 3300031649 Bacteria 2368
264 Ga0307514_10195554 3300031649 Bacteria 1280
265 Ga0307516_10065330 3300031730 Bacteria 3514
266 Ga0307516_10099577 3300031730 Bacteria 2723
267 Ga0307516_10237911 3300031730 Unclassified 1521
268 Ga0307412_10222468 3300031911 Bacteria 1448
269 Ga0307507_10027713 3300033179 Bacteria 6062
270 Ga0307507_10190920 3300033179 Bacteria 1440
271 Ga0307510_10000677 3300033180 Bacteria 34775
272 Ga0307510_10009142 3300033180 Bacteria 11796
273 Ga0307510_10018561 3300033180 Bacteria 8181
274 Ga0307510_10075879 3300033180 Bacteria 3310
275 Ga0307510_10266229 3300033180 Bacteria 1192
276 Ga0373944_0012405 3300035089 Bacteria 2348
277 Ga0373946_0225123 3300035171 Unclassified 907
278 Ga0373931_0014288 3300035691 Bacteria 3878
279 Ga0373931_0177257 3300035691 Bacteria 1260
280 Ga0373935_0280620 3300035692 Bacteria 1173
281 Ga0373927_0279719 3300035695 Bacteria 1097
282 Ga0373937_0284808 3300036401 Unclassified 1561
283 Ga0373925_0011256 3300037068 Bacteria 6489
284 Ga0373925_0221155 3300037068 Bacteria 1511
285 Ga0451793_1144917 3300041452 Bacteria 1264
286 Ga0495592_0000202 3300046454 Bacteria 50799
287 Ga0495629_0324225 3300046459 Bacteria 1053
288 Ga0495629_0545872 3300046459 Bacteria 778
289 Ga0495638_0045633 3300046460 Bacteria 2756
290 Ga0495638_0359698 3300046460 Unclassified 766
291 Ga0495650_0137659 3300046471 Bacteria 886
292 Ga0495583_0181548 3300046506 Bacteria 861
293 Ga0495606_0286330 3300046507 Bacteria 899
294 Ga0495610_0013033 3300046512 Bacteria 4964
295 Ga0495620_0090966 3300046515 Bacteria 1224
296 Ga0495632_0011011 3300046519 Bacteria 5302
297 Ga0495632_0039915 3300046519 Bacteria 2366
298 Ga0495648_0127438 3300046524 Bacteria 1358
299 Ga0495598_0025219 3300046537 Bacteria 1620
300 Ga0495597_0018349 3300046542 Bacteria 3283
301 Ga0495597_0061462 3300046542 Bacteria 1636
302 Ga0495622_0036319 3300046557 Bacteria 2298
303 Ga0495625_0032741 3300046660 Bacteria 3851
304 Ga0495625_0189497 3300046660 Bacteria 1363
305 Ga0495658_0024574 3300046683 Bacteria 3211
306 Ga0495658_0027836 3300046683 Bacteria 3045
307 Ga0495658_0215664 3300046683 Bacteria 1200
308 Ga0495649_0013295 3300046694 Bacteria 4753
309 Ga0495660_0038787 3300046810 Bacteria 2647
310 Ga0495676_0034139 3300047321 Bacteria 4272
311 Ga0495687_000292 3300047443 Bacteria 65859
312 Ga0495687_009918 3300047443 Bacteria 5269
313 Ga0495687_009919 3300047443 Bacteria 5269
314 Ga0495686_0000906 3300047472 Bacteria 37300
315 Ga0496104_0072508 3300048907 Bacteria 3275
316 Ga0496105_0040596 3300048908 Bacteria 3837
317 Ga0501308_001858 3300049128 Bacteria 1769
318 Ga0501309_030161 3300049129 Unclassified 797
319 Ga0501310_012089 3300049130 Unclassified 985
320 Ga0501304_000578 3300049160 Bacteria 1982
321 Ga0501305_011994 3300049161 Unclassified 1179
322 Ga0495678_091694 3300049459 Bacteria 1069
323 Ga0501312_010534 3300049528 Bacteria 1240
324 Ga0501067_0074114 3300049583 Bacteria 1886
325 Ga0501257_047404 3300049686 Unclassified 1066
326 nmdc:mga03683_46574_c1 3300050489 Unclassified 1798
327 nmdc:mga03683_55883_c1 3300050489 Bacteria 1659
328 nmdc:mga03683_78576_c1 3300050489 Bacteria 1421
329 nmdc:mga03683_9538_c2 3300050489 Bacteria 800
330 nmdc:mga03n38_2869_c1 3300050490 Bacteria 5427
331 nmdc:mga00v17_35633_c1 3300050491 Bacteria 2963
332 nmdc:mga00v17_43885_c1 3300050491 Bacteria 2694
333 nmdc:mga0yw44_9673_c1 3300050492 Bacteria 4892
334 nmdc:mga0k408_112894_c1 3300050493 Bacteria 1607
335 nmdc:mga0k408_1252_c1 3300050493 Bacteria 13868
336 nmdc:mga0k408_140621_c1 3300050493 Bacteria 1436
337 nmdc:mga0k408_145661_c1 3300050493 Bacteria 1410
338 nmdc:mga0k408_210_c1 3300050493 Bacteria 31303
339 nmdc:mga0k408_340_c2 3300050493 Bacteria 13289
340 nmdc:mga0k408_3515_c1 3300050493 Bacteria 8283
341 nmdc:mga0k408_47480_c1 3300050493 Bacteria 2482
342 nmdc:mga0k408_6462_c1 3300050493 Bacteria 6248
343 nmdc:mga0k408_98430_c1 3300050493 Bacteria 1723
344 nmdc:mga06z11_129583_c1 3300050494 Bacteria 1415
345 nmdc:mga06z11_14368_c1 3300050494 Bacteria 3506
346 nmdc:mga06z11_19050_c1 3300050494 Bacteria 3147
347 nmdc:mga06z11_214823_c1 3300050494 Bacteria 1122
348 nmdc:mga04h51_76145_c1 3300050495 Bacteria 1182
349 nmdc:mga04h51_894_c1 3300050495 Bacteria 6855
350 nmdc:mga07m45_10952_c1 3300050496 Bacteria 4752
351 nmdc:mga07m45_1543_c1 3300050496 Bacteria 10592
352 nmdc:mga07m45_20376_c1 3300050496 Bacteria 3602
353 nmdc:mga07m45_246362_c1 3300050496 Unclassified 1040
354 nmdc:mga07m45_26471_c1 3300050496 Bacteria 3189
355 nmdc:mga07m45_7519_c1 3300050496 Bacteria 5570
356 nmdc:mga0sz30_89866_c1 3300050516 Bacteria 1335
357 Ga0500578_0000049 3300053086 Bacteria 124281
358 Ga0500578_0117800 3300053086 Bacteria 1671
359 Ga0500644_0000987 3300053088 Bacteria 8871
360 Ga0500646_0008709 3300053090 Bacteria 2599
361 Ga0500583_0021408 3300053092 Bacteria 2689
362 Ga0500583_0050980 3300053092 Bacteria 1921
363 Ga0500651_0002142 3300053093 Bacteria 10294
364 Ga0500651_0044437 3300053093 Bacteria 2797
365 Ga0500650_0003881 3300053098 Bacteria 5298
366 Ga0500562_026355 3300053108 Bacteria 1523
367 Ga0500592_017968 3300053116 Bacteria 1135
368 Ga0500628_001534 3300053129 Bacteria 3934
369 Ga0500642_0003878 3300053130 Bacteria 4598
370 Ga0500652_000820 3300053131 Bacteria 10362
371 Ga0500655_001408 3300053133 Bacteria 4561
372 Ga0500658_0076318 3300053134 Bacteria 1424
373 Ga0500559_0000021 3300053136 Bacteria 129980
374 Ga0500559_0178532 3300053136 Bacteria 1000
375 Ga0500561_0068766 3300053137 Bacteria 1009
376 Ga0500577_0013076 3300053142 Bacteria 2525
377 Ga0500604_0017148 3300053151 Bacteria 2000
378 Ga0500622_0000797 3300053156 Bacteria 27224
379 Ga0500622_0112790 3300053156 Bacteria 1326
380 Ga0500636_0127382 3300053177 Bacteria 1422
381 Ga0500645_011911 3300053730 Bacteria 2825
382 2587729828 2585428057 Bacteria 6737412
383 2588291526 2588253510 Bacteria 6901809
384 2643970657 2643221592 Bacteria 6608788
385 2644139061 2643221625 Bacteria 6512927
386 2644274671 2643221648 Bacteria 6521465
387 2644303450 2643221654 Bacteria 5273570
388 Ga0307513_10474344
389 JGI25150J39212_1017167
390 JGI25153J46596_10001431
391 rootH1_10012335
392 rootL2_10005479
393 rootH1_10081759
394 Ga0055526_1031030
395 Ga0065165_1001629
396 Ga0070676_10010733
397 Ga0070690_100015924
398 Ga0070670_100015970
399 Ga0070670_100097840
400 Ga0070670_100136123
401 Ga0070670_100160871
402 Ga0070677_10167880
403 Ga0068869_100001957
404 Ga0068869_100041765
405 Ga0068869_100347394
406 Ga0068868_100029651
407 Ga0068868_100035763
408 Ga0068868_100054992
409 Ga0068868_100293201
410 Ga0070660_100158790
411 Ga0070661_100077627
412 Ga0070668_100027356
413 Ga0070668_100340943
414 Ga0070669_100009364
415 Ga0070669_100248083
416 Ga0070675_100022210
417 Ga0070675_100141081
418 Ga0070675_100778303
419 Ga0070674_100058227
420 Ga0070674_100099697
421 Ga0070674_100184472
422 Ga0070673_100018156
423 Ga0070673_100033551
424 Ga0070673_100056225
425 Ga0070673_100933320
426 Ga0070688_100150067
427 Ga0070659_100373418
428 Ga0070659_100517776
429 Ga0070659_100610603
430 Ga0070667_100000975
431 Ga0070667_100040558
432 Ga0070667_100108284
433 Ga0070667_100446450
434 Ga0070663_100178894
435 Ga0070663_100366218
436 Ga0070663_100649913
437 Ga0070678_100011861
438 Ga0070662_100002116
439 Ga0070662_100037830
440 Ga0070662_100260432
441 Ga0068867_100001098
442 Ga0070706_100001239
443 Ga0070707_100048557
444 Ga0070672_100098323
445 Ga0070672_100339774
446 Ga0070686_100101891
447 Ga0070665_100003420
448 Ga0070665_100053787
449 Ga0070665_100330707
450 Ga0070665_100610147
451 Ga0070664_100098699
452 Ga0068857_100014101
453 Ga0068852_100023231
454 Ga0068852_100208214
455 Ga0068859_100112508
456 Ga0068859_100510693
457 Ga0068859_100658558
458 Ga0068864_100004564
459 Ga0068864_100159176
460 Ga0068861_100002467
461 Ga0068861_100006700
462 Ga0068851_10075983
463 Ga0068863_100007420
464 Ga0068863_100016507
465 Ga0068863_100154294
466 Ga0068858_100027193
467 Ga0068858_100041134
468 Ga0068860_100003409
469 Ga0068860_100187395
470 Ga0068860_100468558
471 Ga0068860_100580866
472 Ga0068862_100008823
473 Ga0068862_100076088
474 Ga0068862_100188539
475 Ga0075365_10021077
476 Ga0075368_10001719
477 Ga0075368_10004738
478 Ga0075368_10045396
479 Ga0075363_100029491
480 Ga0075363_100111411
481 Ga0075363_100117738
482 Ga0075362_10000656
483 Ga0075362_10001320
484 Ga0075362_10049645
485 Ga0075367_10000315
486 Ga0075367_10022706
487 Ga0075367_10159939
488 Ga0075366_10000111
489 Ga0075366_10000773
490 Ga0075366_10001511
491 Ga0075366_10002824
492 Ga0075366_10021313
493 Ga0075366_10042656
494 Ga0075366_10049917
495 Ga0075366_10091861
496 Ga0075366_10128021
497 Ga0097621_100149062
498 Ga0075370_10000184
499 Ga0075370_10009871
500 Ga0075370_10030535
501 Ga0075370_10066384
502 Ga0075370_10088269
503 Ga0075434_101257100
504 Ga0068865_100028238
505 Ga0068865_100066018
506 Ga0097620_100112509
507 Ga0097620_100510722
508 Ga0097620_100658585
509 Ga0105240_10034526
510 Ga0105245_10009748
511 Ga0114129_10545519
512 Ga0105243_10007766
513 Ga0105243_10025107
514 Ga0105243_10122713
515 Ga0105241_10509379
516 Ga0105248_10081229
517 Ga0105248_10437668
518 Ga0105248_10882628
519 Ga0105237_10008024
520 Ga0105237_10448976
521 Ga0105249_10034727
522 Ga0105249_10037530
523 Ga0105249_11104718
524 Ga0105239_10131485
525 Ga0105246_10709385
526 Ga0157374_10186835
527 Ga0157378_10002645
528 Ga0163162_10003350
529 Ga0163162_10061809
530 Ga0163162_10205621
531 Ga0157375_10145351
532 Ga0157375_10339690
533 Ga0163163_10024190
534 Ga0163163_10728465
535 Ga0157380_10019441
536 Ga0157380_10034131
537 Ga0157380_10197898
538 Ga0157379_10012359
539 Ga0157379_10067166
540 Ga0157379_10561634
541 Ga0157376_10190324
542 Ga0157376_10227364
543 Ga0157376_10713733
544 Ga0163161_10041989
545 Ga0163161_10124648
546 Ga0163161_10384102
547 Ga0207425_1000546
548 Ga0209129_1000041
549 Ga0209673_1025682
550 Ga0209564_1000029
551 Ga0209758_1000043
552 Ga0209050_1000672
553 Ga0209256_1013841
554 Ga0209051_1057622
555 Ga0209257_1020113
556 Ga0207656_10086471
557 Ga0207680_10033882
558 Ga0207643_10078196
559 Ga0207684_10010775
560 Ga0207671_10175708
561 Ga0207649_10163927
562 Ga0207681_10006462
563 Ga0207681_10088193
564 Ga0207650_10069901
565 Ga0207650_10301084
566 Ga0207650_10350247
567 Ga0207644_10069436
568 Ga0207690_10936050
569 Ga0207706_10013122
570 Ga0207706_10085235
571 Ga0207706_10296294
572 Ga0207709_10028425
573 Ga0207669_10077008
574 Ga0207669_10725523
575 Ga0207704_10032046
576 Ga0207704_10052238
577 Ga0207691_10015905
578 Ga0207691_10026107
579 Ga0207691_10079532
580 Ga0207691_10198414
581 Ga0207711_10149375
582 Ga0207711_10576209
583 Ga0207689_10002506
584 Ga0207689_10071794
585 Ga0207689_10170461
586 Ga0207679_10043140
587 Ga0207651_10080858
588 Ga0207712_10019143
589 Ga0207712_10032695
590 Ga0207668_10023581
591 Ga0207668_10208825
592 Ga0207640_10034459
593 Ga0207640_10343654
594 Ga0207658_10002242
595 Ga0207658_10088282
596 Ga0207658_10266344
597 Ga0207658_10536314
598 Ga0207677_10091145
599 Ga0207677_10333249
600 Ga0207677_10517531
601 Ga0207703_10065799
602 Ga0207703_10281613
603 Ga0207678_10020461
604 Ga0207678_10214045
605 Ga0207641_10009069
606 Ga0207641_10400006
607 Ga0207648_10000847
608 Ga0207648_10111270
609 Ga0207648_10218030
610 Ga0207648_11058976
611 Ga0207676_10126954
612 Ga0207676_10300493
613 Ga0207674_10009979
614 Ga0207674_10014053
615 Ga0207675_100000247
616 Ga0207675_100029363
617 Ga0207683_10005596
618 Ga0207683_10020427
619 Ga0207698_10414194
620 Ga0209813_10001853
621 Ga0209813_10046114
622 Ga0268266_10146452
623 Ga0268265_10012889
624 Ga0268265_10027135
625 Ga0268265_10085792
626 Ga0268265_10495309
627 Ga0268264_10050290
628 Ga0268264_10420398
629 Ga0268264_10571900
630 Ga0307517_10040214
631 Ga0307517_10061688
632 Ga0307517_10100575
633 Ga0307517_10127295
634 Ga0307517_10223881
635 Ga0307515_10022943
636 Ga0307515_10232552
637 Ga0307515_10337647
638 Ga0307513_10045089
639 Ga0307513_10094467
640 Ga0307513_10135189
641 Ga0307509_10001648
642 Ga0307509_10002250
643 Ga0307509_10021038
644 Ga0307509_10023831
645 Ga0307509_10178607
646 Ga0307408_100265103
647 Ga0307508_10000296
648 Ga0307508_10005343
649 Ga0307508_10570842
650 Ga0307514_10082789
651 Ga0307514_10195554
652 Ga0307516_10065330
653 Ga0307516_10099577
654 Ga0307516_10237911
655 Ga0307412_10222468
656 Ga0307507_10027713
657 Ga0307507_10190920
658 Ga0307510_10000677
659 Ga0307510_10009142
660 Ga0307510_10018561
661 Ga0307510_10075879
662 Ga0307510_10266229
663 Ga0373944_0012405
664 Ga0373946_0225123
665 Ga0373931_0014288
666 Ga0373931_0177257
667 Ga0373935_0280620
668 Ga0373927_0279719
669 Ga0373937_0284808
670 Ga0373925_0011256
671 Ga0373925_0221155
672 Ga0451793_1144917
673 Ga0495592_0000202
674 Ga0495629_0324225
675 Ga0495629_0545872
676 Ga0495638_0045633
677 Ga0495638_0359698
678 Ga0495650_0137659
679 Ga0495583_0181548
680 Ga0495606_0286330
681 Ga0495610_0013033
682 Ga0495620_0090966
683 Ga0495632_0011011
684 Ga0495632_0039915
685 Ga0495648_0127438
686 Ga0495598_0025219
687 Ga0495597_0018349
688 Ga0495597_0061462
689 Ga0495622_0036319
690 Ga0495625_0032741
691 Ga0495625_0189497
692 Ga0495658_0024574
693 Ga0495658_0027836
694 Ga0495658_0215664
695 Ga0495649_0013295
696 Ga0495660_0038787
697 Ga0495676_0034139
698 Ga0495687_000292
699 Ga0495687_009918
700 Ga0495687_009919
701 Ga0495686_0000906
702 Ga0496104_0072508
703 Ga0496105_0040596
704 Ga0501308_001858
705 Ga0501309_030161
706 Ga0501310_012089
707 Ga0501304_000578
708 Ga0501305_011994
709 Ga0495678_091694
710 Ga0501312_010534
711 Ga0501067_0074114
712 Ga0501257_047404
713 nmdc:mga03683_46574_c1
714 nmdc:mga03683_55883_c1
715 nmdc:mga03683_78576_c1
716 nmdc:mga03683_9538_c2
717 nmdc:mga03n38_2869_c1
718 nmdc:mga00v17_35633_c1
719 nmdc:mga00v17_43885_c1
720 nmdc:mga0yw44_9673_c1
721 nmdc:mga0k408_112894_c1
722 nmdc:mga0k408_1252_c1
723 nmdc:mga0k408_140621_c1
724 nmdc:mga0k408_145661_c1
725 nmdc:mga0k408_210_c1
726 nmdc:mga0k408_340_c2
727 nmdc:mga0k408_3515_c1
728 nmdc:mga0k408_47480_c1
729 nmdc:mga0k408_6462_c1
730 nmdc:mga0k408_98430_c1
731 nmdc:mga06z11_129583_c1
732 nmdc:mga06z11_14368_c1
733 nmdc:mga06z11_19050_c1
734 nmdc:mga06z11_214823_c1
735 nmdc:mga04h51_76145_c1
736 nmdc:mga04h51_894_c1
737 nmdc:mga07m45_10952_c1
738 nmdc:mga07m45_1543_c1
739 nmdc:mga07m45_20376_c1
740 nmdc:mga07m45_246362_c1
741 nmdc:mga07m45_26471_c1
742 nmdc:mga07m45_7519_c1
743 nmdc:mga0sz30_89866_c1
744 Ga0500578_0000049
745 Ga0500578_0117800
746 Ga0500644_0000987
747 Ga0500646_0008709
748 Ga0500583_0021408
749 Ga0500583_0050980
750 Ga0500651_0002142
751 Ga0500651_0044437
752 Ga0500650_0003881
753 Ga0500562_026355
754 Ga0500592_017968
755 Ga0500628_001534
756 Ga0500642_0003878
757 Ga0500652_000820
758 Ga0500655_001408
759 Ga0500658_0076318
760 Ga0500559_0000021
761 Ga0500559_0178532
762 Ga0500561_0068766
763 Ga0500577_0013076
764 Ga0500604_0017148
765 Ga0500622_0000797
766 Ga0500622_0112790
767 Ga0500636_0127382
768 Ga0500645_011911
769 2587729828
770 2588291526
771 2643970657
772 2644139061
773 2644274671
774 2644303450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8okv-assembly4.cif.gz_D lipoprotein bt2095 from bacteroides thetaiotamicron bound to cyanocobalamin cncbl 0.9458 75 88
3fw0-assembly1.cif.gz_A structure of peptidyl-alpha-hydroxyglycine alpha-amidating lyase (pal) bound to alpha-hydroxyhippuric acid (non-peptidic substrate) 0.8507 73 89
2mhd-assembly1.cif.gz_A nmr structure of the protein bacuni_03114 from bacteroides uniformis atcc 8492 0.8382 67 92
6r5x-assembly1.cif.gz_A 8-bladed beta-propeller formed by four 2-bladed fragments 0.8358 74 90
6xg7-assembly1.cif.gz_A 1.3 a resolution structure of the of the nhl repeat region of d. melanogaster thin 0.8254 72 89
ID Description Score Start End Superfamily
3dsmA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 1.02 75 88 2.130.10.10
af_E9PYP2_2370_2578_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9545 75 88 2.130.10.10
af_Q8RXC4_214_475_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9003 74 90 2.130.10.10
af_O16302_981_1150_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.8951 73 88 2.110.10.10
af_O94698_188_346_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8895 73 88 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A317RET2-F1-model_v4 L,D-transpeptidase-like protein 0.979 44 216
AF-A0A5C6Z9M9-F1-model_v4 L,D-transpeptidase 0.9773 42 207
AF-A0A3D3D0V2-F1-model_v4 deleted 0.9765 39 216
AF-A0A7L8SPZ6-F1-model_v4 L,D-transpeptidase 0.9741 44 216
AF-A0A0Q7SNM5-F1-model_v4 YkuD domain-containing protein 0.9741 44 213

Map