F430880

General Info

Members Datasets Scaffolds Average Seq Length
387 279 378 237

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0059392|Ga0373924_0059392_704_1504
Length 266
Sequence MVVGSCFPIRRYLQRHSIDRSARDHAMIDLYYWTTPNGHKITIFLEEAGVPYNIKPVNIGKGEQFKADFLAVSPNNRIPALVDHAPAGGGKPIAVFESGAMLLYLAEKTGQFLSRDLRARTEATQWLFWQMGNLGPMAGQNNHFNNYAVEKLQYAMDRYRNEVNRLYGVLNRRLADRAFVAGDYSIADIAIYPWIVPYERQGQKLEDFPHLKRWFEAIRARPAVERAYEKAKAVNPNAGGVRTPEERAILFGQTAASVERAAAGAK

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2831426010 Nostoc sp. 106C Isolate Unclassified
3 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
4 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
5 2849660919 Nostoc sp. T09 Isolate Unclassified
6 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
7 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
174 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
279 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 0.78
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 0
Rhizoplane 7.75
Rhizosphere 81.14
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1001668 3300002070 Bacteria 2721
2 JGI24748J21848_1005691 3300002074 Bacteria 1449
3 JGI24738J21930_10039396 3300002075 Bacteria 960
4 JGI24744J21845_10008043 3300002077 Bacteria 2177
5 JGI24033J26618_1008746 3300002155 Bacteria 1170
6 JGI24034J26672_10007958 3300002239 Bacteria 1545
7 JGI24742J22300_10002113 3300002244 Bacteria 3162
8 JGI25159J45721_1011985 3300002987 Bacteria 2093
9 JGI25151J46595_10000560 3300003187 Bacteria 33711
10 JGI25160J50197_1004355 3300003354 Bacteria 6131
11 Ga0055536_1002407 3300003781 Bacteria 10527
12 Ga0070676_10099685 3300005328 Bacteria 1792
13 Ga0070670_100031332 3300005331 Bacteria 4579
14 Ga0068869_100032403 3300005334 Bacteria 3682
15 Ga0068868_100011533 3300005338 Bacteria 6437
16 Ga0070689_100334376 3300005340 Bacteria 1267
17 Ga0070687_100006103 3300005343 Bacteria 4918
18 Ga0070692_10017275 3300005345 Bacteria 3445
19 Ga0070668_100129301 3300005347 Bacteria 2026
20 Ga0070668_100240807 3300005347 Bacteria 1498
21 Ga0070669_100067766 3300005353 Bacteria 2634
22 Ga0070669_100150077 3300005353 Bacteria 1804
23 Ga0070675_100057100 3300005354 Bacteria 3217
24 Ga0070671_100015813 3300005355 Bacteria 6095
25 Ga0070674_100019783 3300005356 Bacteria 4284
26 Ga0070673_100104219 3300005364 Bacteria 2341
27 Ga0070659_100266691 3300005366 Bacteria 1422
28 Ga0070667_100029245 3300005367 Bacteria 4590
29 Ga0070709_10365030 3300005434 Bacteria 1070
30 Ga0070714_100001439 3300005435 Bacteria 17326
31 Ga0070713_100144583 3300005436 Bacteria 2110
32 Ga0070713_100144604 3300005436 Bacteria 2109
33 Ga0070713_100151947 3300005436 Bacteria 2060
34 Ga0070713_100203574 3300005436 Bacteria 1789
35 Ga0070710_10103118 3300005437 Bacteria 1702
36 Ga0070701_10082848 3300005438 Bacteria 1740
37 Ga0070711_100169671 3300005439 Bacteria 1662
38 Ga0070711_100874906 3300005439 Bacteria 766
39 Ga0070700_100018962 3300005441 Bacteria 3964
40 Ga0070678_100026087 3300005456 Bacteria 3945
41 Ga0068867_100023389 3300005459 Bacteria 4423
42 Ga0070685_10026484 3300005466 Bacteria 3196
43 Ga0068853_100032751 3300005539 Bacteria 4404
44 Ga0068853_100117692 3300005539 Bacteria 2367
45 Ga0070672_100021128 3300005543 Bacteria 4759
46 Ga0070686_100021206 3300005544 Bacteria 3858
47 Ga0070665_100119679 3300005548 Bacteria 2635
48 Ga0068857_100903410 3300005577 Bacteria 847
49 Ga0068852_100006182 3300005616 Bacteria 8634
50 Ga0068852_100320749 3300005616 Bacteria 1504
51 Ga0068859_100079200 3300005617 Bacteria 3325
52 Ga0068864_100004578 3300005618 Bacteria 11352
53 Ga0068870_10004900 3300005840 Bacteria 5793
54 Ga0068870_10097559 3300005840 Bacteria 1654
55 Ga0068870_10309443 3300005840 Bacteria 1000
56 Ga0068863_100025968 3300005841 Bacteria 5589
57 Ga0068858_100029477 3300005842 Bacteria 5096
58 Ga0068860_100044560 3300005843 Bacteria 4228
59 Ga0068862_100018457 3300005844 Bacteria 5809
60 Ga0081455_10030982 3300005937 Bacteria 4848
61 Ga0081538_10007430 3300005981 Bacteria 9485
62 Ga0081538_10067526 3300005981 Bacteria 1996
63 Ga0081540_1017035 3300005983 Bacteria 4516
64 Ga0070717_10012678 3300006028 Bacteria 6434
65 Ga0075365_10141896 3300006038 Bacteria 1668
66 Ga0075368_10044911 3300006042 Bacteria 1744
67 Ga0075364_10028066 3300006051 Bacteria 3600
68 Ga0075364_10183465 3300006051 Bacteria 1416
69 Ga0075364_10307792 3300006051 Bacteria 1079
70 Ga0070716_100122602 3300006173 Bacteria 1630
71 Ga0070712_100001671 3300006175 Bacteria 13570
72 Ga0075362_10106568 3300006177 Bacteria 1316
73 Ga0075362_10154894 3300006177 Bacteria 1101
74 Ga0075367_10072194 3300006178 Bacteria 2077
75 Ga0068871_100091434 3300006358 Bacteria 2536
76 Ga0075428_100024178 3300006844 Bacteria 6721
77 Ga0075428_100503334 3300006844 Bacteria 1296
78 Ga0075430_100029382 3300006846 Bacteria 4665
79 Ga0075430_100046100 3300006846 Bacteria 3681
80 Ga0075434_100017002 3300006871 Bacteria 6999
81 Ga0068865_100122596 3300006881 Bacteria 1935
82 Ga0097620_100079198 3300006931 Bacteria 3325
83 Ga0099794_10010724 3300007265 Bacteria 3899
84 Ga0099795_10000598 3300007788 Bacteria 6898
85 Ga0105251_10086146 3300009011 Bacteria 1447
86 Ga0111539_10132119 3300009094 Bacteria 2923
87 Ga0111539_10204014 3300009094 Bacteria 2305
88 Ga0111539_10357611 3300009094 Bacteria 1699
89 Ga0105247_10375938 3300009101 Bacteria 1006
90 Ga0114129_10083649 3300009147 Bacteria 4432
91 Ga0114129_10136167 3300009147 Bacteria 3370
92 Ga0105237_10279078 3300009545 Bacteria 1673
93 Ga0099796_10020614 3300010159 Bacteria 2017
94 Ga0105239_10098595 3300010375 Bacteria 3230
95 Ga0105239_10308324 3300010375 Bacteria 1784
96 Ga0157374_10008248 3300013296 Bacteria 8898
97 Ga0157372_10998985 3300013307 Bacteria 969
98 Ga0157375_10085006 3300013308 Bacteria 3214
99 Ga0157380_10023039 3300014326 Bacteria 4696
100 Ga0157377_10107138 3300014745 Bacteria 1675
101 Ga0209130_1001606 3300025284 Bacteria 14069
102 Ga0209676_1000089 3300025292 Bacteria 260196
103 Ga0209025_1000270 3300025294 Bacteria 120921
104 Ga0209758_1003183 3300025297 Bacteria 15346
105 Ga0209050_1004444 3300025298 Bacteria 9475
106 Ga0207426_1000548 3300025302 Bacteria 52429
107 Ga0207656_10192717 3300025321 Bacteria 982
108 Ga0207692_10040161 3300025898 Bacteria 2308
109 Ga0207710_10004332 3300025900 Bacteria 6209
110 Ga0207688_10001105 3300025901 Bacteria 13845
111 Ga0207647_10014078 3300025904 Bacteria 5528
112 Ga0207685_10035071 3300025905 Bacteria 1828
113 Ga0207699_10068920 3300025906 Bacteria 2155
114 Ga0207699_10356281 3300025906 Bacteria 1034
115 Ga0207645_10046288 3300025907 Bacteria 2779
116 Ga0207643_10000387 3300025908 Bacteria 29359
117 Ga0207693_10001675 3300025915 Bacteria 19535
118 Ga0207693_10139562 3300025915 Bacteria 1906
119 Ga0207663_10142790 3300025916 Bacteria 1670
120 Ga0207663_10187621 3300025916 Bacteria 1482
121 Ga0207662_10010233 3300025918 Bacteria 5173
122 Ga0207681_10208852 3300025923 Bacteria 1504
123 Ga0207650_10002475 3300025925 Bacteria 12841
124 Ga0207650_10176581 3300025925 Bacteria 1700
125 Ga0207659_10080865 3300025926 Bacteria 2401
126 Ga0207687_10038702 3300025927 Bacteria 3261
127 Ga0207700_10178214 3300025928 Bacteria 1778
128 Ga0207664_10023679 3300025929 Bacteria 4604
129 Ga0207664_10052490 3300025929 Bacteria 3224
130 Ga0207644_10024807 3300025931 Bacteria 4119
131 Ga0207690_10227659 3300025932 Bacteria 1430
132 Ga0207706_10003621 3300025933 Bacteria 14767
133 Ga0207669_10128053 3300025937 Bacteria 1738
134 Ga0207665_10238470 3300025939 Bacteria 1339
135 Ga0207691_10009096 3300025940 Bacteria 9533
136 Ga0207691_10122138 3300025940 Bacteria 2307
137 Ga0207711_10019334 3300025941 Bacteria 5672
138 Ga0207689_10002173 3300025942 Bacteria 18432
139 Ga0207661_10271300 3300025944 Bacteria 1514
140 Ga0207661_10314667 3300025944 Bacteria 1406
141 Ga0207679_10023712 3300025945 Bacteria 4200
142 Ga0207651_10013062 3300025960 Bacteria 4733
143 Ga0207651_10042910 3300025960 Bacteria 3015
144 Ga0207712_10015028 3300025961 Bacteria 4988
145 Ga0207640_10107456 3300025981 Bacteria 1970
146 Ga0207658_10104651 3300025986 Bacteria 2224
147 Ga0207677_10002480 3300026023 Bacteria 9685
148 Ga0207639_10039012 3300026041 Bacteria 3537
149 Ga0207708_10001620 3300026075 Bacteria 16770
150 Ga0207641_10042162 3300026088 Bacteria 3827
151 Ga0207641_10354243 3300026088 Bacteria 1400
152 Ga0207648_10006315 3300026089 Bacteria 11787
153 Ga0207676_10028355 3300026095 Bacteria 4181
154 Ga0207676_10265775 3300026095 Bacteria 1551
155 Ga0207674_10120373 3300026116 Bacteria 2593
156 Ga0207675_100029584 3300026118 Bacteria 5102
157 Ga0207675_100431712 3300026118 Bacteria 1303
158 Ga0207683_10024882 3300026121 Bacteria 5160
159 Ga0207683_10481456 3300026121 Unclassified 1145
160 Ga0207683_10487857 3300026121 Bacteria 1137
161 Ga0207698_10006712 3300026142 Bacteria 7191
162 Ga0209179_1012028 3300027512 Bacteria 1547
163 Ga0268266_10576014 3300028379 Bacteria 1080
164 Ga0268264_10031171 3300028381 Bacteria 4371
165 Ga0265334_10045187 3300028573 Bacteria 1706
166 Ga0265338_10019327 3300028800 Bacteria 7234
167 Ga0265763_1000741 3300030763 Bacteria 2126
168 Ga0265773_1002521 3300031018 Bacteria 1118
169 Ga0265760_10030359 3300031090 Bacteria 1591
170 Ga0265328_10001052 3300031239 Bacteria 12714
171 Ga0265331_10124064 3300031250 Bacteria 1180
172 Ga0307513_10188798 3300031456 Bacteria 1915
173 Ga0265313_10015985 3300031595 Bacteria 4339
174 Ga0373958_0027510 3300034819 Bacteria 1096
175 Ga0373926_0030341 3300035083 Bacteria 1904
176 Ga0373934_0040029 3300035086 Bacteria 1848
177 Ga0373944_0099357 3300035089 Bacteria 982
178 Ga0373923_0011691 3300035111 Bacteria 3229
179 Ga0373923_0017686 3300035111 Bacteria 2730
180 Ga0373923_0233811 3300035111 Bacteria 857
181 Ga0373936_0000247 3300035113 Bacteria 17940
182 Ga0373936_0101651 3300035113 Bacteria 1213
183 Ga0373936_0242551 3300035113 Bacteria 803
184 Ga0373945_0017234 3300035116 Bacteria 2444
185 Ga0373954_0000594 3300035118 Bacteria 13743
186 Ga0373957_0018364 3300035120 Bacteria 2449
187 Ga0373943_0000224 3300035170 Bacteria 23111
188 Ga0373943_0016877 3300035170 Bacteria 3336
189 Ga0373943_0045336 3300035170 Bacteria 2142
190 Ga0373946_0152012 3300035171 Bacteria 1080
191 Ga0373955_0000790 3300035172 Bacteria 13580
192 Ga0316574_0001263 3300035398 Bacteria 11806
193 Ga0373924_0001230 3300035410 Bacteria 8206
194 Ga0373924_0059392 3300035410 Bacteria 1597
195 Ga0373935_0000142 3300035692 Bacteria 32758
196 Ga0373935_0143862 3300035692 Bacteria 1612
197 Ga0373927_0000540 3300035695 Bacteria 28716
198 Ga0373927_0116466 3300035695 Bacteria 1742
199 Ga0373933_0001809 3300035724 Bacteria 12395
200 Ga0373947_0000618 3300035725 Bacteria 20970
201 Ga0373947_0001891 3300035725 Bacteria 12788
202 Ga0373937_0000228 3300036401 Bacteria 54652
203 Ga0373937_0656900 3300036401 Bacteria 994
204 Ga0373925_0000152 3300037068 Bacteria 74035
205 Ga0373925_0002045 3300037068 Bacteria 16626
206 Ga0373925_0233590 3300037068 Bacteria 1471
207 Ga0373925_0458323 3300037068 Bacteria 1045
208 Ga0436364_0131934 3300037853 Bacteria 968
209 Ga0436364_0501962 3300037853 Bacteria 1247
210 Ga0436364_0647057 3300037853 Bacteria 2317
211 Ga0436365_0338859 3300039437 Bacteria 1094
212 Ga0436365_0618909 3300039437 Bacteria 19642
213 Ga0436360_0613689 3300039438 Bacteria 915
214 Ga0436361_0078505 3300039447 Bacteria 9456
215 Ga0436361_0759335 3300039447 Bacteria 1768
216 Ga0451853_0984363 3300041512 Bacteria 1041
217 Ga0439445_0080872 3300042004 Bacteria 908
218 Ga0450907_021540 3300042146 Bacteria 1084
219 Ga0453683_0030251 3300044673 Bacteria 3423
220 Ga0466963_0038268 3300044694 Bacteria 3136
221 Ga0451576_0134586 3300045051 Bacteria 2577
222 Ga0466958_0106866 3300045836 Bacteria 1745
223 Ga0495592_0000009 3300046454 Bacteria 171624
224 Ga0495629_0065220 3300046459 Bacteria 2542
225 Ga0495629_0142907 3300046459 Bacteria 1665
226 Ga0495629_0345973 3300046459 Bacteria 1015
227 Ga0495651_0001594 3300046462 Bacteria 17547
228 Ga0495653_0009226 3300046463 Bacteria 8071
229 Ga0495580_0061223 3300046472 Bacteria 2643
230 Ga0495582_0153870 3300046473 Bacteria 1306
231 Ga0495605_0127239 3300046474 Bacteria 1151
232 Ga0495662_0000172 3300046476 Bacteria 25587
233 Ga0495662_0163137 3300046476 Bacteria 1098
234 Ga0495664_0000002 3300046477 Bacteria 625183
235 Ga0495594_0073496 3300046499 Bacteria 1903
236 Ga0495607_0056603 3300046501 Bacteria 2251
237 Ga0495608_0000032 3300046511 Bacteria 144093
238 Ga0495608_0314168 3300046511 Bacteria 969
239 Ga0495618_0000114 3300046514 Bacteria 59201
240 Ga0495620_0096692 3300046515 Bacteria 1180
241 Ga0495628_0000002 3300046516 Bacteria 589399
242 Ga0495630_0000927 3300046517 Bacteria 20457
243 Ga0495630_0007612 3300046517 Bacteria 7743
244 Ga0495630_0066042 3300046517 Bacteria 2719
245 Ga0495630_0518372 3300046517 Bacteria 914
246 Ga0495632_0048795 3300046519 Bacteria 2095
247 Ga0495637_0049817 3300046520 Bacteria 1758
248 Ga0495663_0032577 3300046525 Bacteria 1553
249 Ga0495663_0072319 3300046525 Bacteria 1100
250 Ga0495666_0048370 3300046526 Bacteria 2048
251 Ga0495652_0000004 3300046529 Bacteria 588877
252 Ga0495665_0049037 3300046531 Bacteria 2239
253 Ga0495665_0120999 3300046531 Bacteria 1371
254 Ga0495640_0000016 3300046533 Bacteria 144076
255 Ga0495587_0000018 3300046536 Bacteria 166488
256 Ga0495598_0006655 3300046537 Bacteria 2618
257 Ga0495645_0000003 3300046543 Bacteria 570133
258 Ga0495622_0174997 3300046557 Bacteria 964
259 Ga0495622_0217809 3300046557 Bacteria 846
260 Ga0495667_0000043 3300046559 Bacteria 122491
261 Ga0495656_0011510 3300046615 Bacteria 3249
262 Ga0495656_0045636 3300046615 Bacteria 1851
263 Ga0495634_0002858 3300046642 Bacteria 14172
264 Ga0495634_0128532 3300046642 Bacteria 1617
265 Ga0495611_0131656 3300046648 Bacteria 1167
266 Ga0495635_0000025 3300046663 Bacteria 144645
267 Ga0495635_0133755 3300046663 Bacteria 1690
268 Ga0495657_0000702 3300046675 Bacteria 30077
269 Ga0495599_0000067 3300046678 Bacteria 72171
270 Ga0495599_0421696 3300046678 Bacteria 793
271 Ga0495623_0000115 3300046679 Bacteria 48842
272 Ga0495646_0000056 3300046680 Bacteria 57248
273 Ga0495647_0004031 3300046681 Bacteria 4741
274 Ga0495658_0032236 3300046683 Bacteria 2860
275 Ga0495658_0045504 3300046683 Bacteria 2463
276 Ga0495613_0037488 3300046689 Bacteria 3594
277 Ga0495613_0071706 3300046689 Bacteria 2525
278 Ga0495624_0038514 3300046690 Bacteria 3071
279 Ga0495624_0064041 3300046690 Bacteria 2298
280 Ga0495589_0086443 3300046794 Bacteria 1523
281 Ga0495600_0000009 3300046809 Bacteria 143981
282 Ga0495600_0392400 3300046809 Bacteria 865
283 Ga0495581_0014082 3300047315 Bacteria 4635
284 Ga0495581_0034274 3300047315 Bacteria 2937
285 Ga0495581_0088182 3300047315 Bacteria 1799
286 Ga0495604_0000026 3300047317 Bacteria 143987
287 Ga0495604_0200267 3300047317 Bacteria 1386
288 Ga0495636_0002441 3300047318 Bacteria 7127
289 Ga0495636_0015957 3300047318 Bacteria 2995
290 Ga0495674_0000003 3300047319 Bacteria 562126
291 Ga0495674_0168638 3300047319 Bacteria 1828
292 Ga0495674_0191836 3300047319 Bacteria 1698
293 Ga0495672_0227981 3300047320 Bacteria 916
294 Ga0495676_0052656 3300047321 Bacteria 3247
295 Ga0495680_0000499 3300047322 Bacteria 44325
296 Ga0495683_0131736 3300047323 Bacteria 1179
297 Ga0495675_0000179 3300047444 Bacteria 46398
298 Ga0495675_0285298 3300047444 Bacteria 984
299 Ga0495684_0000018 3300047471 Bacteria 156009
300 Ga0495684_0007404 3300047471 Bacteria 8506
301 Ga0495593_0028892 3300047673 Bacteria 3044
302 Ga0495593_0106968 3300047673 Bacteria 1430
303 Ga0495602_0000023 3300048088 Bacteria 154845
304 Ga0495602_0513961 3300048088 Bacteria 835
305 Ga0495614_0225302 3300048089 Bacteria 853
306 Ga0495626_0207530 3300048091 Bacteria 801
307 Ga0496100_0006356 3300048903 Bacteria 6437
308 Ga0496100_0198587 3300048903 Bacteria 1460
309 Ga0496101_0001573 3300048904 Bacteria 13684
310 Ga0496102_0014548 3300048905 Bacteria 6837
311 Ga0496103_0012426 3300048906 Bacteria 5049
312 Ga0496104_0000936 3300048907 Bacteria 25051
313 Ga0496104_0090213 3300048907 Bacteria 2928
314 Ga0496105_0000696 3300048908 Bacteria 22688
315 Ga0496105_0042813 3300048908 Bacteria 3733
316 Ga0496105_0051071 3300048908 Bacteria 3416
317 Ga0496106_0008577 3300048909 Bacteria 7563
318 Ga0496107_0004013 3300048910 Bacteria 9911
319 Ga0496107_0023797 3300048910 Bacteria 4330
320 Ga0496107_0117588 3300048910 Bacteria 1957
321 Ga0496108_0000626 3300048911 Bacteria 27644
322 Ga0496108_0017276 3300048911 Bacteria 5901
323 Ga0496108_0541331 3300048911 Bacteria 1016
324 Ga0496109_0045631 3300048912 Bacteria 3977
325 Ga0496109_0195791 3300048912 Bacteria 1899
326 Ga0496110_0009396 3300048913 Bacteria 7916
327 Ga0496110_0177369 3300048913 Bacteria 1934
328 Ga0496111_0002392 3300048914 Bacteria 11308
329 Ga0496112_0006295 3300048915 Bacteria 10413
330 Ga0496112_0009904 3300048915 Bacteria 8618
331 Ga0496113_0000855 3300048916 Bacteria 15935
332 Ga0496113_0022831 3300048916 Bacteria 4431
333 Ga0496114_0001928 3300048917 Bacteria 15792
334 Ga0496114_0032853 3300048917 Bacteria 4273
335 Ga0496115_0005841 3300048918 Bacteria 8965
336 Ga0496115_0040453 3300048918 Bacteria 3706
337 Ga0496121_0000694 3300048924 Bacteria 62818
338 Ga0496126_0082901 3300048929 Bacteria 2831
339 Ga0496126_0410940 3300048929 Bacteria 1096
340 Ga0501034_0768241 3300049571 Bacteria 858
341 Ga0501036_0105714 3300049572 Bacteria 2381
342 Ga0501043_0244396 3300049579 Bacteria 1384
343 Ga0501046_0163888 3300049580 Bacteria 1671
344 Ga0501067_0104189 3300049583 Bacteria 1576
345 Ga0501076_0132493 3300049592 Bacteria 2022
346 Ga0501076_0174090 3300049592 Bacteria 1754
347 Ga0501076_0328111 3300049592 Bacteria 1255
348 Ga0501079_0203737 3300049741 Bacteria 1546
349 Ga0501080_0316807 3300049742 Bacteria 1413
350 Ga0501080_0349777 3300049742 Bacteria 1335
351 Ga0501045_0071676 3300049824 Bacteria 2550
352 nmdc:mga00v17_94568_c1 3300050491 Bacteria 1880
353 nmdc:mga0yw44_159550_c1 3300050492 Bacteria 1476
354 nmdc:mga0yw44_16455_c1 3300050492 Bacteria 3995
355 nmdc:mga0yw44_63838_c1 3300050492 Bacteria 2265
356 nmdc:mga0yw44_84243_c1 3300050492 Bacteria 1998
357 nmdc:mga0k408_145819_c1 3300050493 Bacteria 1409
358 nmdc:mga06z11_208899_c1 3300050494 Bacteria 1137
359 nmdc:mga05p37_16217_c1 3300050507 Bacteria 8969
360 nmdc:mga05p37_35915_c1 3300050507 Bacteria 6081
361 nmdc:mga05p37_796810_c1 3300050507 Bacteria 1034
362 nmdc:mga09592_196917_c1 3300050508 Bacteria 1744
363 nmdc:mga09592_466361_c1 3300050508 Bacteria 1089
364 nmdc:mga0qj67_40683_c1 3300050509 Bacteria 3653
365 nmdc:mga06r32_114653_c1 3300050510 Bacteria 2653
366 nmdc:mga06r32_241577_c1 3300050510 Bacteria 1793
367 nmdc:mga08y16_146103_c1 3300050511 Bacteria 2458
368 nmdc:mga0n895_13099_c1 3300050512 Bacteria 7462
369 nmdc:mga0n895_54368_c1 3300050512 Bacteria 3938
370 Ga0495601_0000010 3300053077 Bacteria 266222
371 Ga0495601_0119948 3300053077 Bacteria 1707
372 Ga0495612_0000109 3300053078 Bacteria 34803
373 Ga0495595_0000056 3300053084 Bacteria 58198
374 Ga0495619_0000112 3300053085 Bacteria 61241
375 Ga0495619_0087681 3300053085 Bacteria 2104
376 Ga0495619_0133614 3300053085 Bacteria 1706
377 Ga0501082_0411822 3300060353 Bacteria 1180
378 Ga0530510_0073157 3300061734 Bacteria 2488

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100203574 Ga0070713_1002035742 209
2 3300006028 Ga0070717_10012678 Ga0070717_100126782 209
3 3300025916 Ga0207663_10187621 Ga0207663_101876212 209
4 3300025928 Ga0207700_10178214 Ga0207700_101782141 209
5 3300035089 Ga0373944_0099357 Ga0373944_0099357_317_964 215
6 3300049571 Ga0501034_0768241 Ga0501034_0768241_35_688 217
7 3300046678 Ga0495599_0421696 Ga0495599_0421696_107_781 224
8 3300005439 Ga0070711_100874906 Ga0070711_1008749061 226
9 3300044694 Ga0466963_0038268 Ga0466963_0038268_960_1700 226
10 3300045836 Ga0466958_0106866 Ga0466958_0106866_348_1088 226
11 3300003781 Ga0055536_1002407 Ga0055536_10024079 228
12 3300005435 Ga0070714_100001439 Ga0070714_10000143915 228
13 3300005840 Ga0068870_10097559 Ga0068870_100975592 228
14 3300025292 Ga0209676_1000089 Ga0209676_1000089263 228
15 3300025298 Ga0209050_1004444 Ga0209050_10044444 228
16 3300025929 Ga0207664_10023679 Ga0207664_100236792 228
17 iso_pu_bacteria 2617270889 2617916368 228
18 iso_pu_bacteria 2831426010 2831428543 228
19 iso_pu_bacteria 2848694841 2848699518 228
20 iso_pu_bacteria 2849660919 2849666796 228
21 iso_pu_bacteria 2913844669 2913846072 228
22 iso_pu_bacteria 642555144 642605171 228
23 3300005616 Ga0068852_100006182 Ga0068852_1000061826 229
24 3300026142 Ga0207698_10006712 Ga0207698_100067124 229
25 3300048911 Ga0496108_0541331 Ga0496108_0541331_235_924 229
26 iso_pu_bacteria 2894772417 2894775309 229
27 iso_pu_bacteria 8002060224 8002061771 229
28 3300005353 Ga0070669_100067766 Ga0070669_1000677663 230
29 3300005840 Ga0068870_10309443 Ga0068870_103094432 230
30 3300013308 Ga0157375_10085006 Ga0157375_100850062 230
31 3300025923 Ga0207681_10208852 Ga0207681_102088522 230
32 3300025929 Ga0207664_10052490 Ga0207664_100524903 230
33 3300025940 Ga0207691_10122138 Ga0207691_101221383 230
34 3300025960 Ga0207651_10042910 Ga0207651_100429103 230
35 3300026088 Ga0207641_10354243 Ga0207641_103542432 230
36 3300026118 Ga0207675_100431712 Ga0207675_1004317122 230
37 3300028573 Ga0265334_10045187 Ga0265334_100451872 230
38 3300028800 Ga0265338_10019327 Ga0265338_100193273 230
39 3300031595 Ga0265313_10015985 Ga0265313_100159852 230
40 3300036401 Ga0373937_0656900 Ga0373937_0656900_120_812 230
41 3300037068 Ga0373925_0233590 Ga0373925_0233590_548_1240 230
42 3300005436 Ga0070713_100144604 Ga0070713_1001446042 231
43 3300006173 Ga0070716_100122602 Ga0070716_1001226022 231
44 3300006177 Ga0075362_10154894 Ga0075362_101548942 231
45 3300010159 Ga0099796_10020614 Ga0099796_100206142 231
46 3300025906 Ga0207699_10068920 Ga0207699_100689202 231
47 3300025939 Ga0207665_10238470 Ga0207665_102384702 231
48 3300027512 Ga0209179_1012028 Ga0209179_10120282 231
49 3300035086 Ga0373934_0040029 Ga0373934_0040029_422_1117 231
50 3300035111 Ga0373923_0017686 Ga0373923_0017686_1336_2031 231
51 3300035113 Ga0373936_0000247 Ga0373936_0000247_11979_12674 231
52 3300035118 Ga0373954_0000594 Ga0373954_0000594_7584_8279 231
53 3300035120 Ga0373957_0018364 Ga0373957_0018364_1165_1860 231
54 3300035170 Ga0373943_0016877 Ga0373943_0016877_1731_2426 231
55 3300035172 Ga0373955_0000790 Ga0373955_0000790_6346_7041 231
56 3300035410 Ga0373924_0001230 Ga0373924_0001230_2254_2949 231
57 3300035692 Ga0373935_0000142 Ga0373935_0000142_13622_14317 231
58 3300035724 Ga0373933_0001809 Ga0373933_0001809_6324_7019 231
59 3300035725 Ga0373947_0001891 Ga0373947_0001891_1969_2664 231
60 3300036401 Ga0373937_0000228 Ga0373937_0000228_51995_52690 231
61 3300037068 Ga0373925_0000152 Ga0373925_0000152_51981_52676 231
62 3300037853 Ga0436364_0647057 Ga0436364_0647057_1387_2085 231
63 3300046454 Ga0495592_0000009 Ga0495592_0000009_142023_142718 231
64 3300046459 Ga0495629_0065220 Ga0495629_0065220_1718_2413 231
65 3300046462 Ga0495651_0001594 Ga0495651_0001594_2860_3555 231
66 3300046463 Ga0495653_0009226 Ga0495653_0009226_1990_2685 231
67 3300046476 Ga0495662_0000172 Ga0495662_0000172_350_1045 231
68 3300046477 Ga0495664_0000002 Ga0495664_0000002_595060_595755 231
69 3300046511 Ga0495608_0000032 Ga0495608_0000032_28743_29438 231
70 3300046511 Ga0495608_0314168 Ga0495608_0314168_178_873 231
71 3300046514 Ga0495618_0000114 Ga0495618_0000114_29861_30556 231
72 3300046516 Ga0495628_0000002 Ga0495628_0000002_559445_560140 231
73 3300046517 Ga0495630_0000927 Ga0495630_0000927_17539_18234 231
74 3300046525 Ga0495663_0032577 Ga0495663_0032577_402_1100 231
75 3300046529 Ga0495652_0000004 Ga0495652_0000004_28743_29438 231
76 3300046531 Ga0495665_0120999 Ga0495665_0120999_72_767 231
77 3300046533 Ga0495640_0000016 Ga0495640_0000016_28703_29398 231
78 3300046536 Ga0495587_0000018 Ga0495587_0000018_23651_24346 231
79 3300046543 Ga0495645_0000003 Ga0495645_0000003_540696_541391 231
80 3300046559 Ga0495667_0000043 Ga0495667_0000043_121641_122336 231
81 3300046642 Ga0495634_0002858 Ga0495634_0002858_8107_8802 231
82 3300046663 Ga0495635_0000025 Ga0495635_0000025_114754_115449 231
83 3300046675 Ga0495657_0000702 Ga0495657_0000702_5336_6031 231
84 3300046678 Ga0495599_0000067 Ga0495599_0000067_42010_42705 231
85 3300046679 Ga0495623_0000115 Ga0495623_0000115_44544_45239 231
86 3300046680 Ga0495646_0000056 Ga0495646_0000056_32833_33528 231
87 3300046809 Ga0495600_0000009 Ga0495600_0000009_28602_29297 231
88 3300046809 Ga0495600_0392400 Ga0495600_0392400_43_738 231
89 3300047315 Ga0495581_0034274 Ga0495581_0034274_193_888 231
90 3300047317 Ga0495604_0000026 Ga0495604_0000026_28568_29263 231
91 3300047318 Ga0495636_0002441 Ga0495636_0002441_5602_6300 231
92 3300047318 Ga0495636_0015957 Ga0495636_0015957_680_1378 231
93 3300047319 Ga0495674_0000003 Ga0495674_0000003_1985_2680 231
94 3300047319 Ga0495674_0168638 Ga0495674_0168638_279_974 231
95 3300047322 Ga0495680_0000499 Ga0495680_0000499_41686_42381 231
96 3300047444 Ga0495675_0000179 Ga0495675_0000179_21564_22259 231
97 3300047444 Ga0495675_0285298 Ga0495675_0285298_238_933 231
98 3300047471 Ga0495684_0000018 Ga0495684_0000018_125435_126130 231
99 3300047673 Ga0495593_0028892 Ga0495593_0028892_1952_2647 231
100 3300048088 Ga0495602_0000023 Ga0495602_0000023_125454_126149 231
101 3300048088 Ga0495602_0513961 Ga0495602_0513961_129_824 231
102 3300048924 Ga0496121_0000694 Ga0496121_0000694_27466_28161 231
103 3300048929 Ga0496126_0082901 Ga0496126_0082901_238_933 231
104 3300049583 Ga0501067_0104189 Ga0501067_0104189_189_887 231
105 3300049742 Ga0501080_0316807 Ga0501080_0316807_705_1400 231
106 3300053077 Ga0495601_0000010 Ga0495601_0000010_28697_29392 231
107 3300053078 Ga0495612_0000109 Ga0495612_0000109_28739_29434 231
108 3300053084 Ga0495595_0000056 Ga0495595_0000056_29361_30056 231
109 3300053085 Ga0495619_0000112 Ga0495619_0000112_29242_29937 231
110 iso_pu_bacteria 2844533157 2844536955 231
111 3300026121 Ga0207683_10487857 Ga0207683_104878571 232
112 3300028379 Ga0268266_10576014 Ga0268266_105760141 232
113 3300035111 Ga0373923_0011691 Ga0373923_0011691_1555_2253 232
114 3300035398 Ga0316574_0001263 Ga0316574_0001263_6988_7686 232
115 3300037853 Ga0436364_0131934 Ga0436364_0131934_241_942 232
116 3300042004 Ga0439445_0080872 Ga0439445_0080872_138_836 232
117 3300046557 Ga0495622_0174997 Ga0495622_0174997_98_826 232
118 3300048929 Ga0496126_0410940 Ga0496126_0410940_169_867 232
119 3300050510 nmdc:mga06r32_241577_c1 nmdc:mga06r32_241577_c1_602_1300 232
120 3300006051 Ga0075364_10307792 Ga0075364_103077922 233
121 3300006177 Ga0075362_10106568 Ga0075362_101065682 233
122 3300026121 Ga0207683_10481456 Ga0207683_104814562 233
123 3300031090 Ga0265760_10030359 Ga0265760_100303592 233
124 3300039437 Ga0436365_0618909 Ga0436365_0618909_6405_7106 233
125 3300046459 Ga0495629_0345973 Ga0495629_0345973_275_976 233
126 3300047320 Ga0495672_0227981 Ga0495672_0227981_164_901 233
127 3300048907 Ga0496104_0000936 Ga0496104_0000936_965_1666 233
128 3300048908 Ga0496105_0000696 Ga0496105_0000696_4883_5584 233
129 3300048917 Ga0496114_0001928 Ga0496114_0001928_3002_3703 233
130 3300049579 Ga0501043_0244396 Ga0501043_0244396_527_1228 233
131 3300002987 JGI25159J45721_1011985 JGI25159J45721_10119852 234
132 3300003187 JGI25151J46595_10000560 JGI25151J46595_1000056025 234
133 3300003354 JGI25160J50197_1004355 JGI25160J50197_10043556 234
134 3300005434 Ga0070709_10365030 Ga0070709_103650302 234
135 3300005539 Ga0068853_100117692 Ga0068853_1001176922 234
136 3300009094 Ga0111539_10357611 Ga0111539_103576111 234
137 3300009101 Ga0105247_10375938 Ga0105247_103759382 234
138 3300025284 Ga0209130_1001606 Ga0209130_10016067 234
139 3300025294 Ga0209025_1000270 Ga0209025_100027089 234
140 3300025297 Ga0209758_1003183 Ga0209758_10031837 234
141 3300025302 Ga0207426_1000548 Ga0207426_100054828 234
142 3300025944 Ga0207661_10271300 Ga0207661_102713002 234
143 3300031239 Ga0265328_10001052 Ga0265328_100010523 234
144 3300031250 Ga0265331_10124064 Ga0265331_101240642 234
145 3300031456 Ga0307513_10188798 Ga0307513_101887982 234
146 3300039438 Ga0436360_0613689 Ga0436360_0613689_60_812 234
147 3300042146 Ga0450907_021540 Ga0450907_021540_219_926 234
148 3300039437 Ga0436365_0338859 Ga0436365_0338859_37_744 235
149 3300007265 Ga0099794_10010724 Ga0099794_100107244 236
150 3300005981 Ga0081538_10007430 Ga0081538_100074303 237
151 3300006846 Ga0075430_100029382 Ga0075430_1000293824 237
152 3300006871 Ga0075434_100017002 Ga0075434_1000170027 237
153 3300007788 Ga0099795_10000598 Ga0099795_100005984 237
154 3300037853 Ga0436364_0501962 Ga0436364_0501962_151_864 237
155 3300039447 Ga0436361_0759335 Ga0436361_0759335_155_868 237
156 3300041512 Ga0451853_0984363 Ga0451853_0984363_64_777 237
157 3300049592 Ga0501076_0132493 Ga0501076_0132493_131_844 237
158 3300049741 Ga0501079_0203737 Ga0501079_0203737_282_995 237
159 3300050492 nmdc:mga0yw44_63838_c1 nmdc:mga0yw44_63838_c1_434_1147 237
160 3300050507 nmdc:mga05p37_796810_c1 nmdc:mga05p37_796810_c1_135_848 237
161 3300050508 nmdc:mga09592_466361_c1 nmdc:mga09592_466361_c1_291_1004 237
162 3300050509 nmdc:mga0qj67_40683_c1 nmdc:mga0qj67_40683_c1_2091_2804 237
163 3300050510 nmdc:mga06r32_114653_c1 nmdc:mga06r32_114653_c1_1679_2392 237
164 3300050512 nmdc:mga0n895_13099_c1 nmdc:mga0n895_13099_c1_5371_6129 237
165 3300039447 Ga0436361_0078505 Ga0436361_0078505_1559_2275 238
166 3300044673 Ga0453683_0030251 Ga0453683_0030251_1638_2360 238
167 3300045051 Ga0451576_0134586 Ga0451576_0134586_1765_2487 238
168 3300006846 Ga0075430_100046100 Ga0075430_1000461002 239
169 3300009147 Ga0114129_10136167 Ga0114129_101361672 239
170 3300046615 Ga0495656_0045636 Ga0495656_0045636_1066_1791 239
171 3300049572 Ga0501036_0105714 Ga0501036_0105714_1071_1808 239
172 3300049580 Ga0501046_0163888 Ga0501046_0163888_356_1075 239
173 3300049592 Ga0501076_0174090 Ga0501076_0174090_881_1600 239
174 3300049742 Ga0501080_0349777 Ga0501080_0349777_440_1159 239
175 3300050507 nmdc:mga05p37_16217_c1 nmdc:mga05p37_16217_c1_4707_5426 239
176 3300061734 Ga0530510_0073157 Ga0530510_0073157_1458_2177 239
177 3300002070 JGI24750J21931_1001668 JGI24750J21931_10016683 240
178 3300002074 JGI24748J21848_1005691 JGI24748J21848_10056912 240
179 3300002075 JGI24738J21930_10039396 JGI24738J21930_100393961 240
180 3300002077 JGI24744J21845_10008043 JGI24744J21845_100080433 240
181 3300002155 JGI24033J26618_1008746 JGI24033J26618_10087462 240
182 3300002239 JGI24034J26672_10007958 JGI24034J26672_100079582 240
183 3300002244 JGI24742J22300_10002113 JGI24742J22300_100021132 240
184 3300005328 Ga0070676_10099685 Ga0070676_100996851 240
185 3300005331 Ga0070670_100031332 Ga0070670_1000313326 240
186 3300005334 Ga0068869_100032403 Ga0068869_1000324033 240
187 3300005338 Ga0068868_100011533 Ga0068868_1000115334 240
188 3300005340 Ga0070689_100334376 Ga0070689_1003343762 240
189 3300005343 Ga0070687_100006103 Ga0070687_1000061032 240
190 3300005345 Ga0070692_10017275 Ga0070692_100172754 240
191 3300005347 Ga0070668_100129301 Ga0070668_1001293012 240
192 3300005347 Ga0070668_100240807 Ga0070668_1002408071 240
193 3300005353 Ga0070669_100150077 Ga0070669_1001500771 240
194 3300005354 Ga0070675_100057100 Ga0070675_1000571002 240
195 3300005355 Ga0070671_100015813 Ga0070671_1000158134 240
196 3300005356 Ga0070674_100019783 Ga0070674_1000197832 240
197 3300005364 Ga0070673_100104219 Ga0070673_1001042191 240
198 3300005366 Ga0070659_100266691 Ga0070659_1002666912 240
199 3300005367 Ga0070667_100029245 Ga0070667_1000292452 240
200 3300005436 Ga0070713_100144583 Ga0070713_1001445831 240
201 3300005436 Ga0070713_100151947 Ga0070713_1001519472 240
202 3300005437 Ga0070710_10103118 Ga0070710_101031182 240
203 3300005438 Ga0070701_10082848 Ga0070701_100828482 240
204 3300005439 Ga0070711_100169671 Ga0070711_1001696712 240
205 3300005441 Ga0070700_100018962 Ga0070700_1000189624 240
206 3300005456 Ga0070678_100026087 Ga0070678_1000260874 240
207 3300005459 Ga0068867_100023389 Ga0068867_1000233891 240
208 3300005466 Ga0070685_10026484 Ga0070685_100264843 240
209 3300005539 Ga0068853_100032751 Ga0068853_1000327513 240
210 3300005543 Ga0070672_100021128 Ga0070672_1000211282 240
211 3300005544 Ga0070686_100021206 Ga0070686_1000212062 240
212 3300005548 Ga0070665_100119679 Ga0070665_1001196792 240
213 3300005577 Ga0068857_100903410 Ga0068857_1009034101 240
214 3300005616 Ga0068852_100320749 Ga0068852_1003207491 240
215 3300005617 Ga0068859_100079200 Ga0068859_1000792003 240
216 3300005618 Ga0068864_100004578 Ga0068864_1000045789 240
217 3300005840 Ga0068870_10004900 Ga0068870_100049005 240
218 3300005841 Ga0068863_100025968 Ga0068863_1000259686 240
219 3300005842 Ga0068858_100029477 Ga0068858_1000294775 240
220 3300005843 Ga0068860_100044560 Ga0068860_1000445602 240
221 3300005844 Ga0068862_100018457 Ga0068862_1000184572 240
222 3300005937 Ga0081455_10030982 Ga0081455_100309822 240
223 3300005981 Ga0081538_10067526 Ga0081538_100675262 240
224 3300005983 Ga0081540_1017035 Ga0081540_10170355 240
225 3300006038 Ga0075365_10141896 Ga0075365_101418962 240
226 3300006042 Ga0075368_10044911 Ga0075368_100449112 240
227 3300006051 Ga0075364_10028066 Ga0075364_100280663 240
228 3300006051 Ga0075364_10183465 Ga0075364_101834652 240
229 3300006175 Ga0070712_100001671 Ga0070712_1000016717 240
230 3300006178 Ga0075367_10072194 Ga0075367_100721941 240
231 3300006358 Ga0068871_100091434 Ga0068871_1000914342 240
232 3300006844 Ga0075428_100024178 Ga0075428_1000241788 240
233 3300006844 Ga0075428_100503334 Ga0075428_1005033342 240
234 3300006881 Ga0068865_100122596 Ga0068865_1001225962 240
235 3300006931 Ga0097620_100079198 Ga0097620_1000791983 240
236 3300009011 Ga0105251_10086146 Ga0105251_100861462 240
237 3300009094 Ga0111539_10132119 Ga0111539_101321192 240
238 3300009094 Ga0111539_10204014 Ga0111539_102040143 240
239 3300009147 Ga0114129_10083649 Ga0114129_100836492 240
240 3300009545 Ga0105237_10279078 Ga0105237_102790781 240
241 3300010375 Ga0105239_10098595 Ga0105239_100985952 240
242 3300010375 Ga0105239_10308324 Ga0105239_103083242 240
243 3300013296 Ga0157374_10008248 Ga0157374_100082483 240
244 3300013307 Ga0157372_10998985 Ga0157372_109989851 240
245 3300014326 Ga0157380_10023039 Ga0157380_100230392 240
246 3300014745 Ga0157377_10107138 Ga0157377_101071382 240
247 3300025321 Ga0207656_10192717 Ga0207656_101927171 240
248 3300025898 Ga0207692_10040161 Ga0207692_100401612 240
249 3300025900 Ga0207710_10004332 Ga0207710_100043326 240
250 3300025901 Ga0207688_10001105 Ga0207688_100011055 240
251 3300025904 Ga0207647_10014078 Ga0207647_100140783 240
252 3300025905 Ga0207685_10035071 Ga0207685_100350712 240
253 3300025906 Ga0207699_10356281 Ga0207699_103562811 240
254 3300025907 Ga0207645_10046288 Ga0207645_100462882 240
255 3300025908 Ga0207643_10000387 Ga0207643_100003875 240
256 3300025915 Ga0207693_10001675 Ga0207693_1000167511 240
257 3300025915 Ga0207693_10139562 Ga0207693_101395622 240
258 3300025916 Ga0207663_10142790 Ga0207663_101427902 240
259 3300025918 Ga0207662_10010233 Ga0207662_100102332 240
260 3300025925 Ga0207650_10002475 Ga0207650_100024756 240
261 3300025925 Ga0207650_10176581 Ga0207650_101765812 240
262 3300025926 Ga0207659_10080865 Ga0207659_100808653 240
263 3300025927 Ga0207687_10038702 Ga0207687_100387021 240
264 3300025931 Ga0207644_10024807 Ga0207644_100248074 240
265 3300025932 Ga0207690_10227659 Ga0207690_102276592 240
266 3300025933 Ga0207706_10003621 Ga0207706_100036214 240
267 3300025937 Ga0207669_10128053 Ga0207669_101280532 240
268 3300025940 Ga0207691_10009096 Ga0207691_100090969 240
269 3300025941 Ga0207711_10019334 Ga0207711_100193341 240
270 3300025942 Ga0207689_10002173 Ga0207689_100021735 240
271 3300025944 Ga0207661_10314667 Ga0207661_103146672 240
272 3300025945 Ga0207679_10023712 Ga0207679_100237122 240
273 3300025960 Ga0207651_10013062 Ga0207651_100130623 240
274 3300025961 Ga0207712_10015028 Ga0207712_100150284 240
275 3300025981 Ga0207640_10107456 Ga0207640_101074562 240
276 3300025986 Ga0207658_10104651 Ga0207658_101046512 240
277 3300026023 Ga0207677_10002480 Ga0207677_100024807 240
278 3300026041 Ga0207639_10039012 Ga0207639_100390123 240
279 3300026075 Ga0207708_10001620 Ga0207708_100016208 240
280 3300026088 Ga0207641_10042162 Ga0207641_100421623 240
281 3300026089 Ga0207648_10006315 Ga0207648_100063158 240
282 3300026095 Ga0207676_10028355 Ga0207676_100283553 240
283 3300026095 Ga0207676_10265775 Ga0207676_102657751 240
284 3300026116 Ga0207674_10120373 Ga0207674_101203732 240
285 3300026118 Ga0207675_100029584 Ga0207675_1000295843 240
286 3300026121 Ga0207683_10024882 Ga0207683_100248824 240
287 3300028381 Ga0268264_10031171 Ga0268264_100311712 240
288 3300030763 Ga0265763_1000741 Ga0265763_10007412 240
289 3300031018 Ga0265773_1002521 Ga0265773_10025212 240
290 3300034819 Ga0373958_0027510 Ga0373958_0027510_296_1018 240
291 3300035083 Ga0373926_0030341 Ga0373926_0030341_1017_1739 240
292 3300035111 Ga0373923_0233811 Ga0373923_0233811_92_814 240
293 3300035113 Ga0373936_0101651 Ga0373936_0101651_442_1164 240
294 3300035113 Ga0373936_0242551 Ga0373936_0242551_12_734 240
295 3300035116 Ga0373945_0017234 Ga0373945_0017234_541_1263 240
296 3300035170 Ga0373943_0000224 Ga0373943_0000224_21459_22181 240
297 3300035170 Ga0373943_0045336 Ga0373943_0045336_476_1198 240
298 3300035171 Ga0373946_0152012 Ga0373946_0152012_220_942 240
299 3300035410 Ga0373924_0059392 Ga0373924_0059392_704_1504 240
300 3300035692 Ga0373935_0143862 Ga0373935_0143862_670_1392 240
301 3300035695 Ga0373927_0000540 Ga0373927_0000540_7622_8344 240
302 3300035695 Ga0373927_0116466 Ga0373927_0116466_693_1415 240
303 3300035725 Ga0373947_0000618 Ga0373947_0000618_12160_12882 240
304 3300037068 Ga0373925_0002045 Ga0373925_0002045_3745_4467 240
305 3300037068 Ga0373925_0458323 Ga0373925_0458323_32_790 240
306 3300046459 Ga0495629_0142907 Ga0495629_0142907_569_1291 240
307 3300046472 Ga0495580_0061223 Ga0495580_0061223_1800_2522 240
308 3300046473 Ga0495582_0153870 Ga0495582_0153870_139_861 240
309 3300046474 Ga0495605_0127239 Ga0495605_0127239_176_898 240
310 3300046476 Ga0495662_0163137 Ga0495662_0163137_166_888 240
311 3300046499 Ga0495594_0073496 Ga0495594_0073496_1102_1824 240
312 3300046501 Ga0495607_0056603 Ga0495607_0056603_50_772 240
313 3300046515 Ga0495620_0096692 Ga0495620_0096692_214_936 240
314 3300046517 Ga0495630_0007612 Ga0495630_0007612_3797_4519 240
315 3300046517 Ga0495630_0066042 Ga0495630_0066042_892_1692 240
316 3300046517 Ga0495630_0518372 Ga0495630_0518372_80_802 240
317 3300046519 Ga0495632_0048795 Ga0495632_0048795_757_1485 240
318 3300046520 Ga0495637_0049817 Ga0495637_0049817_199_921 240
319 3300046525 Ga0495663_0072319 Ga0495663_0072319_25_747 240
320 3300046526 Ga0495666_0048370 Ga0495666_0048370_312_1112 240
321 3300046531 Ga0495665_0049037 Ga0495665_0049037_351_1073 240
322 3300046537 Ga0495598_0006655 Ga0495598_0006655_1184_1906 240
323 3300046557 Ga0495622_0217809 Ga0495622_0217809_13_735 240
324 3300046615 Ga0495656_0011510 Ga0495656_0011510_1721_2443 240
325 3300046642 Ga0495634_0128532 Ga0495634_0128532_550_1272 240
326 3300046648 Ga0495611_0131656 Ga0495611_0131656_319_1041 240
327 3300046663 Ga0495635_0133755 Ga0495635_0133755_459_1181 240
328 3300046681 Ga0495647_0004031 Ga0495647_0004031_3925_4647 240
329 3300046683 Ga0495658_0032236 Ga0495658_0032236_190_990 240
330 3300046683 Ga0495658_0045504 Ga0495658_0045504_1184_1906 240
331 3300046689 Ga0495613_0037488 Ga0495613_0037488_381_1103 240
332 3300046689 Ga0495613_0071706 Ga0495613_0071706_98_820 240
333 3300046690 Ga0495624_0038514 Ga0495624_0038514_2214_2936 240
334 3300046690 Ga0495624_0064041 Ga0495624_0064041_646_1368 240
335 3300046794 Ga0495589_0086443 Ga0495589_0086443_694_1416 240
336 3300047315 Ga0495581_0014082 Ga0495581_0014082_1881_2603 240
337 3300047315 Ga0495581_0088182 Ga0495581_0088182_940_1662 240
338 3300047317 Ga0495604_0200267 Ga0495604_0200267_24_746 240
339 3300047319 Ga0495674_0191836 Ga0495674_0191836_428_1228 240
340 3300047321 Ga0495676_0052656 Ga0495676_0052656_1067_1789 240
341 3300047323 Ga0495683_0131736 Ga0495683_0131736_74_796 240
342 3300047471 Ga0495684_0007404 Ga0495684_0007404_7654_8376 240
343 3300047673 Ga0495593_0106968 Ga0495593_0106968_575_1297 240
344 3300048089 Ga0495614_0225302 Ga0495614_0225302_35_757 240
345 3300048091 Ga0495626_0207530 Ga0495626_0207530_29_751 240
346 3300048903 Ga0496100_0006356 Ga0496100_0006356_4983_5705 240
347 3300048903 Ga0496100_0198587 Ga0496100_0198587_162_884 240
348 3300048904 Ga0496101_0001573 Ga0496101_0001573_7521_8243 240
349 3300048905 Ga0496102_0014548 Ga0496102_0014548_4929_5651 240
350 3300048906 Ga0496103_0012426 Ga0496103_0012426_1784_2506 240
351 3300048907 Ga0496104_0090213 Ga0496104_0090213_1327_2049 240
352 3300048908 Ga0496105_0042813 Ga0496105_0042813_129_851 240
353 3300048908 Ga0496105_0051071 Ga0496105_0051071_2459_3181 240
354 3300048909 Ga0496106_0008577 Ga0496106_0008577_5580_6302 240
355 3300048910 Ga0496107_0004013 Ga0496107_0004013_5503_6225 240
356 3300048910 Ga0496107_0023797 Ga0496107_0023797_176_898 240
357 3300048910 Ga0496107_0117588 Ga0496107_0117588_408_1130 240
358 3300048911 Ga0496108_0000626 Ga0496108_0000626_14805_15527 240
359 3300048911 Ga0496108_0017276 Ga0496108_0017276_3975_4697 240
360 3300048912 Ga0496109_0045631 Ga0496109_0045631_1631_2353 240
361 3300048912 Ga0496109_0195791 Ga0496109_0195791_675_1397 240
362 3300048913 Ga0496110_0009396 Ga0496110_0009396_1262_1984 240
363 3300048913 Ga0496110_0177369 Ga0496110_0177369_241_963 240
364 3300048914 Ga0496111_0002392 Ga0496111_0002392_10085_10807 240
365 3300048915 Ga0496112_0006295 Ga0496112_0006295_5550_6272 240
366 3300048915 Ga0496112_0009904 Ga0496112_0009904_4548_5270 240
367 3300048916 Ga0496113_0000855 Ga0496113_0000855_2968_3690 240
368 3300048916 Ga0496113_0022831 Ga0496113_0022831_856_1578 240
369 3300048917 Ga0496114_0032853 Ga0496114_0032853_981_1703 240
370 3300048918 Ga0496115_0005841 Ga0496115_0005841_788_1510 240
371 3300048918 Ga0496115_0040453 Ga0496115_0040453_518_1240 240
372 3300049592 Ga0501076_0328111 Ga0501076_0328111_21_743 240
373 3300049824 Ga0501045_0071676 Ga0501045_0071676_536_1258 240
374 3300050491 nmdc:mga00v17_94568_c1 nmdc:mga00v17_94568_c1_662_1384 240
375 3300050492 nmdc:mga0yw44_159550_c1 nmdc:mga0yw44_159550_c1_389_1111 240
376 3300050492 nmdc:mga0yw44_16455_c1 nmdc:mga0yw44_16455_c1_1882_2604 240
377 3300050492 nmdc:mga0yw44_84243_c1 nmdc:mga0yw44_84243_c1_187_909 240
378 3300050493 nmdc:mga0k408_145819_c1 nmdc:mga0k408_145819_c1_645_1367 240
379 3300050494 nmdc:mga06z11_208899_c1 nmdc:mga06z11_208899_c1_259_981 240
380 3300050507 nmdc:mga05p37_35915_c1 nmdc:mga05p37_35915_c1_4037_4759 240
381 3300050508 nmdc:mga09592_196917_c1 nmdc:mga09592_196917_c1_725_1447 240
382 3300050511 nmdc:mga08y16_146103_c1 nmdc:mga08y16_146103_c1_1244_1966 240
383 3300050512 nmdc:mga0n895_54368_c1 nmdc:mga0n895_54368_c1_3059_3781 240
384 3300053077 Ga0495601_0119948 Ga0495601_0119948_512_1234 240
385 3300053085 Ga0495619_0087681 Ga0495619_0087681_345_1067 240
386 3300053085 Ga0495619_0133614 Ga0495619_0133614_454_1176 240
387 3300060353 Ga0501082_0411822 Ga0501082_0411822_22_744 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

153

217

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

26

107

0.9

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

34

108

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

125

222

0.86

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

30

112

0.83

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

140

231

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9915 1 201
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9896 1 202
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9783 1 201
6tah-assembly1.cif.gz_CAA crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione 0.978 1 201
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9756 3 202
ID Description Score Start End Superfamily
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9973 1 84 3.40.30.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9963 3 86 3.40.30.10
af_P77526_93_209_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9874 94 207 1.20.1050.130
af_P77526_87_192_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9856 87 190 1.20.1050.10
4ecjB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9837 87 195 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A0S8AWI8-F1-model_v4 Glutathione S-transferase 1 1 101 GO:0016740
AF-A0A4Q5PD99-F1-model_v4 Thiol:disulfide oxidoreductase 0.9985 76 208
AF-A0A2A2TBE1-F1-model_v4 Thiol:disulfide oxidoreductase 0.9977 1 209
AF-A0A522J4D5-F1-model_v4 Thiol:disulfide oxidoreductase 0.9969 1 84
AF-A0A6G4BI85-F1-model_v4 deleted 0.9965 12 147

Feature Viewer

pLDDT pTM Quality
93.4 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map