F430880
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 387 | 279 | 378 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300035410|Ga0373924_0059392|Ga0373924_0059392_704_1504 |
| Length | 266 |
| Sequence | MVVGSCFPIRRYLQRHSIDRSARDHAMIDLYYWTTPNGHKITIFLEEAGVPYNIKPVNIGKGEQFKADFLAVSPNNRIPALVDHAPAGGGKPIAVFESGAMLLYLAEKTGQFLSRDLRARTEATQWLFWQMGNLGPMAGQNNHFNNYAVEKLQYAMDRYRNEVNRLYGVLNRRLADRAFVAGDYSIADIAIYPWIVPYERQGQKLEDFPHLKRWFEAIRARPAVERAYEKAKAVNPNAGGVRTPEERAILFGQTAASVERAAAGAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 2 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 3 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 4 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 5 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 6 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 7 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 150 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 154 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 157 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 173 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 174 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 175 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 265 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 278 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 279 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.9 |
| Metatranscriptomes | 0.78 |
| Isolates | 2.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.46 |
| Nodule | 0 |
| Rhizoplane | 7.75 |
| Rhizosphere | 81.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1001668 | 3300002070 | Bacteria | 2721 |
| 2 | JGI24748J21848_1005691 | 3300002074 | Bacteria | 1449 |
| 3 | JGI24738J21930_10039396 | 3300002075 | Bacteria | 960 |
| 4 | JGI24744J21845_10008043 | 3300002077 | Bacteria | 2177 |
| 5 | JGI24033J26618_1008746 | 3300002155 | Bacteria | 1170 |
| 6 | JGI24034J26672_10007958 | 3300002239 | Bacteria | 1545 |
| 7 | JGI24742J22300_10002113 | 3300002244 | Bacteria | 3162 |
| 8 | JGI25159J45721_1011985 | 3300002987 | Bacteria | 2093 |
| 9 | JGI25151J46595_10000560 | 3300003187 | Bacteria | 33711 |
| 10 | JGI25160J50197_1004355 | 3300003354 | Bacteria | 6131 |
| 11 | Ga0055536_1002407 | 3300003781 | Bacteria | 10527 |
| 12 | Ga0070676_10099685 | 3300005328 | Bacteria | 1792 |
| 13 | Ga0070670_100031332 | 3300005331 | Bacteria | 4579 |
| 14 | Ga0068869_100032403 | 3300005334 | Bacteria | 3682 |
| 15 | Ga0068868_100011533 | 3300005338 | Bacteria | 6437 |
| 16 | Ga0070689_100334376 | 3300005340 | Bacteria | 1267 |
| 17 | Ga0070687_100006103 | 3300005343 | Bacteria | 4918 |
| 18 | Ga0070692_10017275 | 3300005345 | Bacteria | 3445 |
| 19 | Ga0070668_100129301 | 3300005347 | Bacteria | 2026 |
| 20 | Ga0070668_100240807 | 3300005347 | Bacteria | 1498 |
| 21 | Ga0070669_100067766 | 3300005353 | Bacteria | 2634 |
| 22 | Ga0070669_100150077 | 3300005353 | Bacteria | 1804 |
| 23 | Ga0070675_100057100 | 3300005354 | Bacteria | 3217 |
| 24 | Ga0070671_100015813 | 3300005355 | Bacteria | 6095 |
| 25 | Ga0070674_100019783 | 3300005356 | Bacteria | 4284 |
| 26 | Ga0070673_100104219 | 3300005364 | Bacteria | 2341 |
| 27 | Ga0070659_100266691 | 3300005366 | Bacteria | 1422 |
| 28 | Ga0070667_100029245 | 3300005367 | Bacteria | 4590 |
| 29 | Ga0070709_10365030 | 3300005434 | Bacteria | 1070 |
| 30 | Ga0070714_100001439 | 3300005435 | Bacteria | 17326 |
| 31 | Ga0070713_100144583 | 3300005436 | Bacteria | 2110 |
| 32 | Ga0070713_100144604 | 3300005436 | Bacteria | 2109 |
| 33 | Ga0070713_100151947 | 3300005436 | Bacteria | 2060 |
| 34 | Ga0070713_100203574 | 3300005436 | Bacteria | 1789 |
| 35 | Ga0070710_10103118 | 3300005437 | Bacteria | 1702 |
| 36 | Ga0070701_10082848 | 3300005438 | Bacteria | 1740 |
| 37 | Ga0070711_100169671 | 3300005439 | Bacteria | 1662 |
| 38 | Ga0070711_100874906 | 3300005439 | Bacteria | 766 |
| 39 | Ga0070700_100018962 | 3300005441 | Bacteria | 3964 |
| 40 | Ga0070678_100026087 | 3300005456 | Bacteria | 3945 |
| 41 | Ga0068867_100023389 | 3300005459 | Bacteria | 4423 |
| 42 | Ga0070685_10026484 | 3300005466 | Bacteria | 3196 |
| 43 | Ga0068853_100032751 | 3300005539 | Bacteria | 4404 |
| 44 | Ga0068853_100117692 | 3300005539 | Bacteria | 2367 |
| 45 | Ga0070672_100021128 | 3300005543 | Bacteria | 4759 |
| 46 | Ga0070686_100021206 | 3300005544 | Bacteria | 3858 |
| 47 | Ga0070665_100119679 | 3300005548 | Bacteria | 2635 |
| 48 | Ga0068857_100903410 | 3300005577 | Bacteria | 847 |
| 49 | Ga0068852_100006182 | 3300005616 | Bacteria | 8634 |
| 50 | Ga0068852_100320749 | 3300005616 | Bacteria | 1504 |
| 51 | Ga0068859_100079200 | 3300005617 | Bacteria | 3325 |
| 52 | Ga0068864_100004578 | 3300005618 | Bacteria | 11352 |
| 53 | Ga0068870_10004900 | 3300005840 | Bacteria | 5793 |
| 54 | Ga0068870_10097559 | 3300005840 | Bacteria | 1654 |
| 55 | Ga0068870_10309443 | 3300005840 | Bacteria | 1000 |
| 56 | Ga0068863_100025968 | 3300005841 | Bacteria | 5589 |
| 57 | Ga0068858_100029477 | 3300005842 | Bacteria | 5096 |
| 58 | Ga0068860_100044560 | 3300005843 | Bacteria | 4228 |
| 59 | Ga0068862_100018457 | 3300005844 | Bacteria | 5809 |
| 60 | Ga0081455_10030982 | 3300005937 | Bacteria | 4848 |
| 61 | Ga0081538_10007430 | 3300005981 | Bacteria | 9485 |
| 62 | Ga0081538_10067526 | 3300005981 | Bacteria | 1996 |
| 63 | Ga0081540_1017035 | 3300005983 | Bacteria | 4516 |
| 64 | Ga0070717_10012678 | 3300006028 | Bacteria | 6434 |
| 65 | Ga0075365_10141896 | 3300006038 | Bacteria | 1668 |
| 66 | Ga0075368_10044911 | 3300006042 | Bacteria | 1744 |
| 67 | Ga0075364_10028066 | 3300006051 | Bacteria | 3600 |
| 68 | Ga0075364_10183465 | 3300006051 | Bacteria | 1416 |
| 69 | Ga0075364_10307792 | 3300006051 | Bacteria | 1079 |
| 70 | Ga0070716_100122602 | 3300006173 | Bacteria | 1630 |
| 71 | Ga0070712_100001671 | 3300006175 | Bacteria | 13570 |
| 72 | Ga0075362_10106568 | 3300006177 | Bacteria | 1316 |
| 73 | Ga0075362_10154894 | 3300006177 | Bacteria | 1101 |
| 74 | Ga0075367_10072194 | 3300006178 | Bacteria | 2077 |
| 75 | Ga0068871_100091434 | 3300006358 | Bacteria | 2536 |
| 76 | Ga0075428_100024178 | 3300006844 | Bacteria | 6721 |
| 77 | Ga0075428_100503334 | 3300006844 | Bacteria | 1296 |
| 78 | Ga0075430_100029382 | 3300006846 | Bacteria | 4665 |
| 79 | Ga0075430_100046100 | 3300006846 | Bacteria | 3681 |
| 80 | Ga0075434_100017002 | 3300006871 | Bacteria | 6999 |
| 81 | Ga0068865_100122596 | 3300006881 | Bacteria | 1935 |
| 82 | Ga0097620_100079198 | 3300006931 | Bacteria | 3325 |
| 83 | Ga0099794_10010724 | 3300007265 | Bacteria | 3899 |
| 84 | Ga0099795_10000598 | 3300007788 | Bacteria | 6898 |
| 85 | Ga0105251_10086146 | 3300009011 | Bacteria | 1447 |
| 86 | Ga0111539_10132119 | 3300009094 | Bacteria | 2923 |
| 87 | Ga0111539_10204014 | 3300009094 | Bacteria | 2305 |
| 88 | Ga0111539_10357611 | 3300009094 | Bacteria | 1699 |
| 89 | Ga0105247_10375938 | 3300009101 | Bacteria | 1006 |
| 90 | Ga0114129_10083649 | 3300009147 | Bacteria | 4432 |
| 91 | Ga0114129_10136167 | 3300009147 | Bacteria | 3370 |
| 92 | Ga0105237_10279078 | 3300009545 | Bacteria | 1673 |
| 93 | Ga0099796_10020614 | 3300010159 | Bacteria | 2017 |
| 94 | Ga0105239_10098595 | 3300010375 | Bacteria | 3230 |
| 95 | Ga0105239_10308324 | 3300010375 | Bacteria | 1784 |
| 96 | Ga0157374_10008248 | 3300013296 | Bacteria | 8898 |
| 97 | Ga0157372_10998985 | 3300013307 | Bacteria | 969 |
| 98 | Ga0157375_10085006 | 3300013308 | Bacteria | 3214 |
| 99 | Ga0157380_10023039 | 3300014326 | Bacteria | 4696 |
| 100 | Ga0157377_10107138 | 3300014745 | Bacteria | 1675 |
| 101 | Ga0209130_1001606 | 3300025284 | Bacteria | 14069 |
| 102 | Ga0209676_1000089 | 3300025292 | Bacteria | 260196 |
| 103 | Ga0209025_1000270 | 3300025294 | Bacteria | 120921 |
| 104 | Ga0209758_1003183 | 3300025297 | Bacteria | 15346 |
| 105 | Ga0209050_1004444 | 3300025298 | Bacteria | 9475 |
| 106 | Ga0207426_1000548 | 3300025302 | Bacteria | 52429 |
| 107 | Ga0207656_10192717 | 3300025321 | Bacteria | 982 |
| 108 | Ga0207692_10040161 | 3300025898 | Bacteria | 2308 |
| 109 | Ga0207710_10004332 | 3300025900 | Bacteria | 6209 |
| 110 | Ga0207688_10001105 | 3300025901 | Bacteria | 13845 |
| 111 | Ga0207647_10014078 | 3300025904 | Bacteria | 5528 |
| 112 | Ga0207685_10035071 | 3300025905 | Bacteria | 1828 |
| 113 | Ga0207699_10068920 | 3300025906 | Bacteria | 2155 |
| 114 | Ga0207699_10356281 | 3300025906 | Bacteria | 1034 |
| 115 | Ga0207645_10046288 | 3300025907 | Bacteria | 2779 |
| 116 | Ga0207643_10000387 | 3300025908 | Bacteria | 29359 |
| 117 | Ga0207693_10001675 | 3300025915 | Bacteria | 19535 |
| 118 | Ga0207693_10139562 | 3300025915 | Bacteria | 1906 |
| 119 | Ga0207663_10142790 | 3300025916 | Bacteria | 1670 |
| 120 | Ga0207663_10187621 | 3300025916 | Bacteria | 1482 |
| 121 | Ga0207662_10010233 | 3300025918 | Bacteria | 5173 |
| 122 | Ga0207681_10208852 | 3300025923 | Bacteria | 1504 |
| 123 | Ga0207650_10002475 | 3300025925 | Bacteria | 12841 |
| 124 | Ga0207650_10176581 | 3300025925 | Bacteria | 1700 |
| 125 | Ga0207659_10080865 | 3300025926 | Bacteria | 2401 |
| 126 | Ga0207687_10038702 | 3300025927 | Bacteria | 3261 |
| 127 | Ga0207700_10178214 | 3300025928 | Bacteria | 1778 |
| 128 | Ga0207664_10023679 | 3300025929 | Bacteria | 4604 |
| 129 | Ga0207664_10052490 | 3300025929 | Bacteria | 3224 |
| 130 | Ga0207644_10024807 | 3300025931 | Bacteria | 4119 |
| 131 | Ga0207690_10227659 | 3300025932 | Bacteria | 1430 |
| 132 | Ga0207706_10003621 | 3300025933 | Bacteria | 14767 |
| 133 | Ga0207669_10128053 | 3300025937 | Bacteria | 1738 |
| 134 | Ga0207665_10238470 | 3300025939 | Bacteria | 1339 |
| 135 | Ga0207691_10009096 | 3300025940 | Bacteria | 9533 |
| 136 | Ga0207691_10122138 | 3300025940 | Bacteria | 2307 |
| 137 | Ga0207711_10019334 | 3300025941 | Bacteria | 5672 |
| 138 | Ga0207689_10002173 | 3300025942 | Bacteria | 18432 |
| 139 | Ga0207661_10271300 | 3300025944 | Bacteria | 1514 |
| 140 | Ga0207661_10314667 | 3300025944 | Bacteria | 1406 |
| 141 | Ga0207679_10023712 | 3300025945 | Bacteria | 4200 |
| 142 | Ga0207651_10013062 | 3300025960 | Bacteria | 4733 |
| 143 | Ga0207651_10042910 | 3300025960 | Bacteria | 3015 |
| 144 | Ga0207712_10015028 | 3300025961 | Bacteria | 4988 |
| 145 | Ga0207640_10107456 | 3300025981 | Bacteria | 1970 |
| 146 | Ga0207658_10104651 | 3300025986 | Bacteria | 2224 |
| 147 | Ga0207677_10002480 | 3300026023 | Bacteria | 9685 |
| 148 | Ga0207639_10039012 | 3300026041 | Bacteria | 3537 |
| 149 | Ga0207708_10001620 | 3300026075 | Bacteria | 16770 |
| 150 | Ga0207641_10042162 | 3300026088 | Bacteria | 3827 |
| 151 | Ga0207641_10354243 | 3300026088 | Bacteria | 1400 |
| 152 | Ga0207648_10006315 | 3300026089 | Bacteria | 11787 |
| 153 | Ga0207676_10028355 | 3300026095 | Bacteria | 4181 |
| 154 | Ga0207676_10265775 | 3300026095 | Bacteria | 1551 |
| 155 | Ga0207674_10120373 | 3300026116 | Bacteria | 2593 |
| 156 | Ga0207675_100029584 | 3300026118 | Bacteria | 5102 |
| 157 | Ga0207675_100431712 | 3300026118 | Bacteria | 1303 |
| 158 | Ga0207683_10024882 | 3300026121 | Bacteria | 5160 |
| 159 | Ga0207683_10481456 | 3300026121 | Unclassified | 1145 |
| 160 | Ga0207683_10487857 | 3300026121 | Bacteria | 1137 |
| 161 | Ga0207698_10006712 | 3300026142 | Bacteria | 7191 |
| 162 | Ga0209179_1012028 | 3300027512 | Bacteria | 1547 |
| 163 | Ga0268266_10576014 | 3300028379 | Bacteria | 1080 |
| 164 | Ga0268264_10031171 | 3300028381 | Bacteria | 4371 |
| 165 | Ga0265334_10045187 | 3300028573 | Bacteria | 1706 |
| 166 | Ga0265338_10019327 | 3300028800 | Bacteria | 7234 |
| 167 | Ga0265763_1000741 | 3300030763 | Bacteria | 2126 |
| 168 | Ga0265773_1002521 | 3300031018 | Bacteria | 1118 |
| 169 | Ga0265760_10030359 | 3300031090 | Bacteria | 1591 |
| 170 | Ga0265328_10001052 | 3300031239 | Bacteria | 12714 |
| 171 | Ga0265331_10124064 | 3300031250 | Bacteria | 1180 |
| 172 | Ga0307513_10188798 | 3300031456 | Bacteria | 1915 |
| 173 | Ga0265313_10015985 | 3300031595 | Bacteria | 4339 |
| 174 | Ga0373958_0027510 | 3300034819 | Bacteria | 1096 |
| 175 | Ga0373926_0030341 | 3300035083 | Bacteria | 1904 |
| 176 | Ga0373934_0040029 | 3300035086 | Bacteria | 1848 |
| 177 | Ga0373944_0099357 | 3300035089 | Bacteria | 982 |
| 178 | Ga0373923_0011691 | 3300035111 | Bacteria | 3229 |
| 179 | Ga0373923_0017686 | 3300035111 | Bacteria | 2730 |
| 180 | Ga0373923_0233811 | 3300035111 | Bacteria | 857 |
| 181 | Ga0373936_0000247 | 3300035113 | Bacteria | 17940 |
| 182 | Ga0373936_0101651 | 3300035113 | Bacteria | 1213 |
| 183 | Ga0373936_0242551 | 3300035113 | Bacteria | 803 |
| 184 | Ga0373945_0017234 | 3300035116 | Bacteria | 2444 |
| 185 | Ga0373954_0000594 | 3300035118 | Bacteria | 13743 |
| 186 | Ga0373957_0018364 | 3300035120 | Bacteria | 2449 |
| 187 | Ga0373943_0000224 | 3300035170 | Bacteria | 23111 |
| 188 | Ga0373943_0016877 | 3300035170 | Bacteria | 3336 |
| 189 | Ga0373943_0045336 | 3300035170 | Bacteria | 2142 |
| 190 | Ga0373946_0152012 | 3300035171 | Bacteria | 1080 |
| 191 | Ga0373955_0000790 | 3300035172 | Bacteria | 13580 |
| 192 | Ga0316574_0001263 | 3300035398 | Bacteria | 11806 |
| 193 | Ga0373924_0001230 | 3300035410 | Bacteria | 8206 |
| 194 | Ga0373924_0059392 | 3300035410 | Bacteria | 1597 |
| 195 | Ga0373935_0000142 | 3300035692 | Bacteria | 32758 |
| 196 | Ga0373935_0143862 | 3300035692 | Bacteria | 1612 |
| 197 | Ga0373927_0000540 | 3300035695 | Bacteria | 28716 |
| 198 | Ga0373927_0116466 | 3300035695 | Bacteria | 1742 |
| 199 | Ga0373933_0001809 | 3300035724 | Bacteria | 12395 |
| 200 | Ga0373947_0000618 | 3300035725 | Bacteria | 20970 |
| 201 | Ga0373947_0001891 | 3300035725 | Bacteria | 12788 |
| 202 | Ga0373937_0000228 | 3300036401 | Bacteria | 54652 |
| 203 | Ga0373937_0656900 | 3300036401 | Bacteria | 994 |
| 204 | Ga0373925_0000152 | 3300037068 | Bacteria | 74035 |
| 205 | Ga0373925_0002045 | 3300037068 | Bacteria | 16626 |
| 206 | Ga0373925_0233590 | 3300037068 | Bacteria | 1471 |
| 207 | Ga0373925_0458323 | 3300037068 | Bacteria | 1045 |
| 208 | Ga0436364_0131934 | 3300037853 | Bacteria | 968 |
| 209 | Ga0436364_0501962 | 3300037853 | Bacteria | 1247 |
| 210 | Ga0436364_0647057 | 3300037853 | Bacteria | 2317 |
| 211 | Ga0436365_0338859 | 3300039437 | Bacteria | 1094 |
| 212 | Ga0436365_0618909 | 3300039437 | Bacteria | 19642 |
| 213 | Ga0436360_0613689 | 3300039438 | Bacteria | 915 |
| 214 | Ga0436361_0078505 | 3300039447 | Bacteria | 9456 |
| 215 | Ga0436361_0759335 | 3300039447 | Bacteria | 1768 |
| 216 | Ga0451853_0984363 | 3300041512 | Bacteria | 1041 |
| 217 | Ga0439445_0080872 | 3300042004 | Bacteria | 908 |
| 218 | Ga0450907_021540 | 3300042146 | Bacteria | 1084 |
| 219 | Ga0453683_0030251 | 3300044673 | Bacteria | 3423 |
| 220 | Ga0466963_0038268 | 3300044694 | Bacteria | 3136 |
| 221 | Ga0451576_0134586 | 3300045051 | Bacteria | 2577 |
| 222 | Ga0466958_0106866 | 3300045836 | Bacteria | 1745 |
| 223 | Ga0495592_0000009 | 3300046454 | Bacteria | 171624 |
| 224 | Ga0495629_0065220 | 3300046459 | Bacteria | 2542 |
| 225 | Ga0495629_0142907 | 3300046459 | Bacteria | 1665 |
| 226 | Ga0495629_0345973 | 3300046459 | Bacteria | 1015 |
| 227 | Ga0495651_0001594 | 3300046462 | Bacteria | 17547 |
| 228 | Ga0495653_0009226 | 3300046463 | Bacteria | 8071 |
| 229 | Ga0495580_0061223 | 3300046472 | Bacteria | 2643 |
| 230 | Ga0495582_0153870 | 3300046473 | Bacteria | 1306 |
| 231 | Ga0495605_0127239 | 3300046474 | Bacteria | 1151 |
| 232 | Ga0495662_0000172 | 3300046476 | Bacteria | 25587 |
| 233 | Ga0495662_0163137 | 3300046476 | Bacteria | 1098 |
| 234 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 235 | Ga0495594_0073496 | 3300046499 | Bacteria | 1903 |
| 236 | Ga0495607_0056603 | 3300046501 | Bacteria | 2251 |
| 237 | Ga0495608_0000032 | 3300046511 | Bacteria | 144093 |
| 238 | Ga0495608_0314168 | 3300046511 | Bacteria | 969 |
| 239 | Ga0495618_0000114 | 3300046514 | Bacteria | 59201 |
| 240 | Ga0495620_0096692 | 3300046515 | Bacteria | 1180 |
| 241 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 242 | Ga0495630_0000927 | 3300046517 | Bacteria | 20457 |
| 243 | Ga0495630_0007612 | 3300046517 | Bacteria | 7743 |
| 244 | Ga0495630_0066042 | 3300046517 | Bacteria | 2719 |
| 245 | Ga0495630_0518372 | 3300046517 | Bacteria | 914 |
| 246 | Ga0495632_0048795 | 3300046519 | Bacteria | 2095 |
| 247 | Ga0495637_0049817 | 3300046520 | Bacteria | 1758 |
| 248 | Ga0495663_0032577 | 3300046525 | Bacteria | 1553 |
| 249 | Ga0495663_0072319 | 3300046525 | Bacteria | 1100 |
| 250 | Ga0495666_0048370 | 3300046526 | Bacteria | 2048 |
| 251 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 252 | Ga0495665_0049037 | 3300046531 | Bacteria | 2239 |
| 253 | Ga0495665_0120999 | 3300046531 | Bacteria | 1371 |
| 254 | Ga0495640_0000016 | 3300046533 | Bacteria | 144076 |
| 255 | Ga0495587_0000018 | 3300046536 | Bacteria | 166488 |
| 256 | Ga0495598_0006655 | 3300046537 | Bacteria | 2618 |
| 257 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 258 | Ga0495622_0174997 | 3300046557 | Bacteria | 964 |
| 259 | Ga0495622_0217809 | 3300046557 | Bacteria | 846 |
| 260 | Ga0495667_0000043 | 3300046559 | Bacteria | 122491 |
| 261 | Ga0495656_0011510 | 3300046615 | Bacteria | 3249 |
| 262 | Ga0495656_0045636 | 3300046615 | Bacteria | 1851 |
| 263 | Ga0495634_0002858 | 3300046642 | Bacteria | 14172 |
| 264 | Ga0495634_0128532 | 3300046642 | Bacteria | 1617 |
| 265 | Ga0495611_0131656 | 3300046648 | Bacteria | 1167 |
| 266 | Ga0495635_0000025 | 3300046663 | Bacteria | 144645 |
| 267 | Ga0495635_0133755 | 3300046663 | Bacteria | 1690 |
| 268 | Ga0495657_0000702 | 3300046675 | Bacteria | 30077 |
| 269 | Ga0495599_0000067 | 3300046678 | Bacteria | 72171 |
| 270 | Ga0495599_0421696 | 3300046678 | Bacteria | 793 |
| 271 | Ga0495623_0000115 | 3300046679 | Bacteria | 48842 |
| 272 | Ga0495646_0000056 | 3300046680 | Bacteria | 57248 |
| 273 | Ga0495647_0004031 | 3300046681 | Bacteria | 4741 |
| 274 | Ga0495658_0032236 | 3300046683 | Bacteria | 2860 |
| 275 | Ga0495658_0045504 | 3300046683 | Bacteria | 2463 |
| 276 | Ga0495613_0037488 | 3300046689 | Bacteria | 3594 |
| 277 | Ga0495613_0071706 | 3300046689 | Bacteria | 2525 |
| 278 | Ga0495624_0038514 | 3300046690 | Bacteria | 3071 |
| 279 | Ga0495624_0064041 | 3300046690 | Bacteria | 2298 |
| 280 | Ga0495589_0086443 | 3300046794 | Bacteria | 1523 |
| 281 | Ga0495600_0000009 | 3300046809 | Bacteria | 143981 |
| 282 | Ga0495600_0392400 | 3300046809 | Bacteria | 865 |
| 283 | Ga0495581_0014082 | 3300047315 | Bacteria | 4635 |
| 284 | Ga0495581_0034274 | 3300047315 | Bacteria | 2937 |
| 285 | Ga0495581_0088182 | 3300047315 | Bacteria | 1799 |
| 286 | Ga0495604_0000026 | 3300047317 | Bacteria | 143987 |
| 287 | Ga0495604_0200267 | 3300047317 | Bacteria | 1386 |
| 288 | Ga0495636_0002441 | 3300047318 | Bacteria | 7127 |
| 289 | Ga0495636_0015957 | 3300047318 | Bacteria | 2995 |
| 290 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 291 | Ga0495674_0168638 | 3300047319 | Bacteria | 1828 |
| 292 | Ga0495674_0191836 | 3300047319 | Bacteria | 1698 |
| 293 | Ga0495672_0227981 | 3300047320 | Bacteria | 916 |
| 294 | Ga0495676_0052656 | 3300047321 | Bacteria | 3247 |
| 295 | Ga0495680_0000499 | 3300047322 | Bacteria | 44325 |
| 296 | Ga0495683_0131736 | 3300047323 | Bacteria | 1179 |
| 297 | Ga0495675_0000179 | 3300047444 | Bacteria | 46398 |
| 298 | Ga0495675_0285298 | 3300047444 | Bacteria | 984 |
| 299 | Ga0495684_0000018 | 3300047471 | Bacteria | 156009 |
| 300 | Ga0495684_0007404 | 3300047471 | Bacteria | 8506 |
| 301 | Ga0495593_0028892 | 3300047673 | Bacteria | 3044 |
| 302 | Ga0495593_0106968 | 3300047673 | Bacteria | 1430 |
| 303 | Ga0495602_0000023 | 3300048088 | Bacteria | 154845 |
| 304 | Ga0495602_0513961 | 3300048088 | Bacteria | 835 |
| 305 | Ga0495614_0225302 | 3300048089 | Bacteria | 853 |
| 306 | Ga0495626_0207530 | 3300048091 | Bacteria | 801 |
| 307 | Ga0496100_0006356 | 3300048903 | Bacteria | 6437 |
| 308 | Ga0496100_0198587 | 3300048903 | Bacteria | 1460 |
| 309 | Ga0496101_0001573 | 3300048904 | Bacteria | 13684 |
| 310 | Ga0496102_0014548 | 3300048905 | Bacteria | 6837 |
| 311 | Ga0496103_0012426 | 3300048906 | Bacteria | 5049 |
| 312 | Ga0496104_0000936 | 3300048907 | Bacteria | 25051 |
| 313 | Ga0496104_0090213 | 3300048907 | Bacteria | 2928 |
| 314 | Ga0496105_0000696 | 3300048908 | Bacteria | 22688 |
| 315 | Ga0496105_0042813 | 3300048908 | Bacteria | 3733 |
| 316 | Ga0496105_0051071 | 3300048908 | Bacteria | 3416 |
| 317 | Ga0496106_0008577 | 3300048909 | Bacteria | 7563 |
| 318 | Ga0496107_0004013 | 3300048910 | Bacteria | 9911 |
| 319 | Ga0496107_0023797 | 3300048910 | Bacteria | 4330 |
| 320 | Ga0496107_0117588 | 3300048910 | Bacteria | 1957 |
| 321 | Ga0496108_0000626 | 3300048911 | Bacteria | 27644 |
| 322 | Ga0496108_0017276 | 3300048911 | Bacteria | 5901 |
| 323 | Ga0496108_0541331 | 3300048911 | Bacteria | 1016 |
| 324 | Ga0496109_0045631 | 3300048912 | Bacteria | 3977 |
| 325 | Ga0496109_0195791 | 3300048912 | Bacteria | 1899 |
| 326 | Ga0496110_0009396 | 3300048913 | Bacteria | 7916 |
| 327 | Ga0496110_0177369 | 3300048913 | Bacteria | 1934 |
| 328 | Ga0496111_0002392 | 3300048914 | Bacteria | 11308 |
| 329 | Ga0496112_0006295 | 3300048915 | Bacteria | 10413 |
| 330 | Ga0496112_0009904 | 3300048915 | Bacteria | 8618 |
| 331 | Ga0496113_0000855 | 3300048916 | Bacteria | 15935 |
| 332 | Ga0496113_0022831 | 3300048916 | Bacteria | 4431 |
| 333 | Ga0496114_0001928 | 3300048917 | Bacteria | 15792 |
| 334 | Ga0496114_0032853 | 3300048917 | Bacteria | 4273 |
| 335 | Ga0496115_0005841 | 3300048918 | Bacteria | 8965 |
| 336 | Ga0496115_0040453 | 3300048918 | Bacteria | 3706 |
| 337 | Ga0496121_0000694 | 3300048924 | Bacteria | 62818 |
| 338 | Ga0496126_0082901 | 3300048929 | Bacteria | 2831 |
| 339 | Ga0496126_0410940 | 3300048929 | Bacteria | 1096 |
| 340 | Ga0501034_0768241 | 3300049571 | Bacteria | 858 |
| 341 | Ga0501036_0105714 | 3300049572 | Bacteria | 2381 |
| 342 | Ga0501043_0244396 | 3300049579 | Bacteria | 1384 |
| 343 | Ga0501046_0163888 | 3300049580 | Bacteria | 1671 |
| 344 | Ga0501067_0104189 | 3300049583 | Bacteria | 1576 |
| 345 | Ga0501076_0132493 | 3300049592 | Bacteria | 2022 |
| 346 | Ga0501076_0174090 | 3300049592 | Bacteria | 1754 |
| 347 | Ga0501076_0328111 | 3300049592 | Bacteria | 1255 |
| 348 | Ga0501079_0203737 | 3300049741 | Bacteria | 1546 |
| 349 | Ga0501080_0316807 | 3300049742 | Bacteria | 1413 |
| 350 | Ga0501080_0349777 | 3300049742 | Bacteria | 1335 |
| 351 | Ga0501045_0071676 | 3300049824 | Bacteria | 2550 |
| 352 | nmdc:mga00v17_94568_c1 | 3300050491 | Bacteria | 1880 |
| 353 | nmdc:mga0yw44_159550_c1 | 3300050492 | Bacteria | 1476 |
| 354 | nmdc:mga0yw44_16455_c1 | 3300050492 | Bacteria | 3995 |
| 355 | nmdc:mga0yw44_63838_c1 | 3300050492 | Bacteria | 2265 |
| 356 | nmdc:mga0yw44_84243_c1 | 3300050492 | Bacteria | 1998 |
| 357 | nmdc:mga0k408_145819_c1 | 3300050493 | Bacteria | 1409 |
| 358 | nmdc:mga06z11_208899_c1 | 3300050494 | Bacteria | 1137 |
| 359 | nmdc:mga05p37_16217_c1 | 3300050507 | Bacteria | 8969 |
| 360 | nmdc:mga05p37_35915_c1 | 3300050507 | Bacteria | 6081 |
| 361 | nmdc:mga05p37_796810_c1 | 3300050507 | Bacteria | 1034 |
| 362 | nmdc:mga09592_196917_c1 | 3300050508 | Bacteria | 1744 |
| 363 | nmdc:mga09592_466361_c1 | 3300050508 | Bacteria | 1089 |
| 364 | nmdc:mga0qj67_40683_c1 | 3300050509 | Bacteria | 3653 |
| 365 | nmdc:mga06r32_114653_c1 | 3300050510 | Bacteria | 2653 |
| 366 | nmdc:mga06r32_241577_c1 | 3300050510 | Bacteria | 1793 |
| 367 | nmdc:mga08y16_146103_c1 | 3300050511 | Bacteria | 2458 |
| 368 | nmdc:mga0n895_13099_c1 | 3300050512 | Bacteria | 7462 |
| 369 | nmdc:mga0n895_54368_c1 | 3300050512 | Bacteria | 3938 |
| 370 | Ga0495601_0000010 | 3300053077 | Bacteria | 266222 |
| 371 | Ga0495601_0119948 | 3300053077 | Bacteria | 1707 |
| 372 | Ga0495612_0000109 | 3300053078 | Bacteria | 34803 |
| 373 | Ga0495595_0000056 | 3300053084 | Bacteria | 58198 |
| 374 | Ga0495619_0000112 | 3300053085 | Bacteria | 61241 |
| 375 | Ga0495619_0087681 | 3300053085 | Bacteria | 2104 |
| 376 | Ga0495619_0133614 | 3300053085 | Bacteria | 1706 |
| 377 | Ga0501082_0411822 | 3300060353 | Bacteria | 1180 |
| 378 | Ga0530510_0073157 | 3300061734 | Bacteria | 2488 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100203574 | Ga0070713_1002035742 | 209 |
| 2 | 3300006028 | Ga0070717_10012678 | Ga0070717_100126782 | 209 |
| 3 | 3300025916 | Ga0207663_10187621 | Ga0207663_101876212 | 209 |
| 4 | 3300025928 | Ga0207700_10178214 | Ga0207700_101782141 | 209 |
| 5 | 3300035089 | Ga0373944_0099357 | Ga0373944_0099357_317_964 | 215 |
| 6 | 3300049571 | Ga0501034_0768241 | Ga0501034_0768241_35_688 | 217 |
| 7 | 3300046678 | Ga0495599_0421696 | Ga0495599_0421696_107_781 | 224 |
| 8 | 3300005439 | Ga0070711_100874906 | Ga0070711_1008749061 | 226 |
| 9 | 3300044694 | Ga0466963_0038268 | Ga0466963_0038268_960_1700 | 226 |
| 10 | 3300045836 | Ga0466958_0106866 | Ga0466958_0106866_348_1088 | 226 |
| 11 | 3300003781 | Ga0055536_1002407 | Ga0055536_10024079 | 228 |
| 12 | 3300005435 | Ga0070714_100001439 | Ga0070714_10000143915 | 228 |
| 13 | 3300005840 | Ga0068870_10097559 | Ga0068870_100975592 | 228 |
| 14 | 3300025292 | Ga0209676_1000089 | Ga0209676_1000089263 | 228 |
| 15 | 3300025298 | Ga0209050_1004444 | Ga0209050_10044444 | 228 |
| 16 | 3300025929 | Ga0207664_10023679 | Ga0207664_100236792 | 228 |
| 17 | iso_pu_bacteria | 2617270889 | 2617916368 | 228 |
| 18 | iso_pu_bacteria | 2831426010 | 2831428543 | 228 |
| 19 | iso_pu_bacteria | 2848694841 | 2848699518 | 228 |
| 20 | iso_pu_bacteria | 2849660919 | 2849666796 | 228 |
| 21 | iso_pu_bacteria | 2913844669 | 2913846072 | 228 |
| 22 | iso_pu_bacteria | 642555144 | 642605171 | 228 |
| 23 | 3300005616 | Ga0068852_100006182 | Ga0068852_1000061826 | 229 |
| 24 | 3300026142 | Ga0207698_10006712 | Ga0207698_100067124 | 229 |
| 25 | 3300048911 | Ga0496108_0541331 | Ga0496108_0541331_235_924 | 229 |
| 26 | iso_pu_bacteria | 2894772417 | 2894775309 | 229 |
| 27 | iso_pu_bacteria | 8002060224 | 8002061771 | 229 |
| 28 | 3300005353 | Ga0070669_100067766 | Ga0070669_1000677663 | 230 |
| 29 | 3300005840 | Ga0068870_10309443 | Ga0068870_103094432 | 230 |
| 30 | 3300013308 | Ga0157375_10085006 | Ga0157375_100850062 | 230 |
| 31 | 3300025923 | Ga0207681_10208852 | Ga0207681_102088522 | 230 |
| 32 | 3300025929 | Ga0207664_10052490 | Ga0207664_100524903 | 230 |
| 33 | 3300025940 | Ga0207691_10122138 | Ga0207691_101221383 | 230 |
| 34 | 3300025960 | Ga0207651_10042910 | Ga0207651_100429103 | 230 |
| 35 | 3300026088 | Ga0207641_10354243 | Ga0207641_103542432 | 230 |
| 36 | 3300026118 | Ga0207675_100431712 | Ga0207675_1004317122 | 230 |
| 37 | 3300028573 | Ga0265334_10045187 | Ga0265334_100451872 | 230 |
| 38 | 3300028800 | Ga0265338_10019327 | Ga0265338_100193273 | 230 |
| 39 | 3300031595 | Ga0265313_10015985 | Ga0265313_100159852 | 230 |
| 40 | 3300036401 | Ga0373937_0656900 | Ga0373937_0656900_120_812 | 230 |
| 41 | 3300037068 | Ga0373925_0233590 | Ga0373925_0233590_548_1240 | 230 |
| 42 | 3300005436 | Ga0070713_100144604 | Ga0070713_1001446042 | 231 |
| 43 | 3300006173 | Ga0070716_100122602 | Ga0070716_1001226022 | 231 |
| 44 | 3300006177 | Ga0075362_10154894 | Ga0075362_101548942 | 231 |
| 45 | 3300010159 | Ga0099796_10020614 | Ga0099796_100206142 | 231 |
| 46 | 3300025906 | Ga0207699_10068920 | Ga0207699_100689202 | 231 |
| 47 | 3300025939 | Ga0207665_10238470 | Ga0207665_102384702 | 231 |
| 48 | 3300027512 | Ga0209179_1012028 | Ga0209179_10120282 | 231 |
| 49 | 3300035086 | Ga0373934_0040029 | Ga0373934_0040029_422_1117 | 231 |
| 50 | 3300035111 | Ga0373923_0017686 | Ga0373923_0017686_1336_2031 | 231 |
| 51 | 3300035113 | Ga0373936_0000247 | Ga0373936_0000247_11979_12674 | 231 |
| 52 | 3300035118 | Ga0373954_0000594 | Ga0373954_0000594_7584_8279 | 231 |
| 53 | 3300035120 | Ga0373957_0018364 | Ga0373957_0018364_1165_1860 | 231 |
| 54 | 3300035170 | Ga0373943_0016877 | Ga0373943_0016877_1731_2426 | 231 |
| 55 | 3300035172 | Ga0373955_0000790 | Ga0373955_0000790_6346_7041 | 231 |
| 56 | 3300035410 | Ga0373924_0001230 | Ga0373924_0001230_2254_2949 | 231 |
| 57 | 3300035692 | Ga0373935_0000142 | Ga0373935_0000142_13622_14317 | 231 |
| 58 | 3300035724 | Ga0373933_0001809 | Ga0373933_0001809_6324_7019 | 231 |
| 59 | 3300035725 | Ga0373947_0001891 | Ga0373947_0001891_1969_2664 | 231 |
| 60 | 3300036401 | Ga0373937_0000228 | Ga0373937_0000228_51995_52690 | 231 |
| 61 | 3300037068 | Ga0373925_0000152 | Ga0373925_0000152_51981_52676 | 231 |
| 62 | 3300037853 | Ga0436364_0647057 | Ga0436364_0647057_1387_2085 | 231 |
| 63 | 3300046454 | Ga0495592_0000009 | Ga0495592_0000009_142023_142718 | 231 |
| 64 | 3300046459 | Ga0495629_0065220 | Ga0495629_0065220_1718_2413 | 231 |
| 65 | 3300046462 | Ga0495651_0001594 | Ga0495651_0001594_2860_3555 | 231 |
| 66 | 3300046463 | Ga0495653_0009226 | Ga0495653_0009226_1990_2685 | 231 |
| 67 | 3300046476 | Ga0495662_0000172 | Ga0495662_0000172_350_1045 | 231 |
| 68 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_595060_595755 | 231 |
| 69 | 3300046511 | Ga0495608_0000032 | Ga0495608_0000032_28743_29438 | 231 |
| 70 | 3300046511 | Ga0495608_0314168 | Ga0495608_0314168_178_873 | 231 |
| 71 | 3300046514 | Ga0495618_0000114 | Ga0495618_0000114_29861_30556 | 231 |
| 72 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_559445_560140 | 231 |
| 73 | 3300046517 | Ga0495630_0000927 | Ga0495630_0000927_17539_18234 | 231 |
| 74 | 3300046525 | Ga0495663_0032577 | Ga0495663_0032577_402_1100 | 231 |
| 75 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_28743_29438 | 231 |
| 76 | 3300046531 | Ga0495665_0120999 | Ga0495665_0120999_72_767 | 231 |
| 77 | 3300046533 | Ga0495640_0000016 | Ga0495640_0000016_28703_29398 | 231 |
| 78 | 3300046536 | Ga0495587_0000018 | Ga0495587_0000018_23651_24346 | 231 |
| 79 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_540696_541391 | 231 |
| 80 | 3300046559 | Ga0495667_0000043 | Ga0495667_0000043_121641_122336 | 231 |
| 81 | 3300046642 | Ga0495634_0002858 | Ga0495634_0002858_8107_8802 | 231 |
| 82 | 3300046663 | Ga0495635_0000025 | Ga0495635_0000025_114754_115449 | 231 |
| 83 | 3300046675 | Ga0495657_0000702 | Ga0495657_0000702_5336_6031 | 231 |
| 84 | 3300046678 | Ga0495599_0000067 | Ga0495599_0000067_42010_42705 | 231 |
| 85 | 3300046679 | Ga0495623_0000115 | Ga0495623_0000115_44544_45239 | 231 |
| 86 | 3300046680 | Ga0495646_0000056 | Ga0495646_0000056_32833_33528 | 231 |
| 87 | 3300046809 | Ga0495600_0000009 | Ga0495600_0000009_28602_29297 | 231 |
| 88 | 3300046809 | Ga0495600_0392400 | Ga0495600_0392400_43_738 | 231 |
| 89 | 3300047315 | Ga0495581_0034274 | Ga0495581_0034274_193_888 | 231 |
| 90 | 3300047317 | Ga0495604_0000026 | Ga0495604_0000026_28568_29263 | 231 |
| 91 | 3300047318 | Ga0495636_0002441 | Ga0495636_0002441_5602_6300 | 231 |
| 92 | 3300047318 | Ga0495636_0015957 | Ga0495636_0015957_680_1378 | 231 |
| 93 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_1985_2680 | 231 |
| 94 | 3300047319 | Ga0495674_0168638 | Ga0495674_0168638_279_974 | 231 |
| 95 | 3300047322 | Ga0495680_0000499 | Ga0495680_0000499_41686_42381 | 231 |
| 96 | 3300047444 | Ga0495675_0000179 | Ga0495675_0000179_21564_22259 | 231 |
| 97 | 3300047444 | Ga0495675_0285298 | Ga0495675_0285298_238_933 | 231 |
| 98 | 3300047471 | Ga0495684_0000018 | Ga0495684_0000018_125435_126130 | 231 |
| 99 | 3300047673 | Ga0495593_0028892 | Ga0495593_0028892_1952_2647 | 231 |
| 100 | 3300048088 | Ga0495602_0000023 | Ga0495602_0000023_125454_126149 | 231 |
| 101 | 3300048088 | Ga0495602_0513961 | Ga0495602_0513961_129_824 | 231 |
| 102 | 3300048924 | Ga0496121_0000694 | Ga0496121_0000694_27466_28161 | 231 |
| 103 | 3300048929 | Ga0496126_0082901 | Ga0496126_0082901_238_933 | 231 |
| 104 | 3300049583 | Ga0501067_0104189 | Ga0501067_0104189_189_887 | 231 |
| 105 | 3300049742 | Ga0501080_0316807 | Ga0501080_0316807_705_1400 | 231 |
| 106 | 3300053077 | Ga0495601_0000010 | Ga0495601_0000010_28697_29392 | 231 |
| 107 | 3300053078 | Ga0495612_0000109 | Ga0495612_0000109_28739_29434 | 231 |
| 108 | 3300053084 | Ga0495595_0000056 | Ga0495595_0000056_29361_30056 | 231 |
| 109 | 3300053085 | Ga0495619_0000112 | Ga0495619_0000112_29242_29937 | 231 |
| 110 | iso_pu_bacteria | 2844533157 | 2844536955 | 231 |
| 111 | 3300026121 | Ga0207683_10487857 | Ga0207683_104878571 | 232 |
| 112 | 3300028379 | Ga0268266_10576014 | Ga0268266_105760141 | 232 |
| 113 | 3300035111 | Ga0373923_0011691 | Ga0373923_0011691_1555_2253 | 232 |
| 114 | 3300035398 | Ga0316574_0001263 | Ga0316574_0001263_6988_7686 | 232 |
| 115 | 3300037853 | Ga0436364_0131934 | Ga0436364_0131934_241_942 | 232 |
| 116 | 3300042004 | Ga0439445_0080872 | Ga0439445_0080872_138_836 | 232 |
| 117 | 3300046557 | Ga0495622_0174997 | Ga0495622_0174997_98_826 | 232 |
| 118 | 3300048929 | Ga0496126_0410940 | Ga0496126_0410940_169_867 | 232 |
| 119 | 3300050510 | nmdc:mga06r32_241577_c1 | nmdc:mga06r32_241577_c1_602_1300 | 232 |
| 120 | 3300006051 | Ga0075364_10307792 | Ga0075364_103077922 | 233 |
| 121 | 3300006177 | Ga0075362_10106568 | Ga0075362_101065682 | 233 |
| 122 | 3300026121 | Ga0207683_10481456 | Ga0207683_104814562 | 233 |
| 123 | 3300031090 | Ga0265760_10030359 | Ga0265760_100303592 | 233 |
| 124 | 3300039437 | Ga0436365_0618909 | Ga0436365_0618909_6405_7106 | 233 |
| 125 | 3300046459 | Ga0495629_0345973 | Ga0495629_0345973_275_976 | 233 |
| 126 | 3300047320 | Ga0495672_0227981 | Ga0495672_0227981_164_901 | 233 |
| 127 | 3300048907 | Ga0496104_0000936 | Ga0496104_0000936_965_1666 | 233 |
| 128 | 3300048908 | Ga0496105_0000696 | Ga0496105_0000696_4883_5584 | 233 |
| 129 | 3300048917 | Ga0496114_0001928 | Ga0496114_0001928_3002_3703 | 233 |
| 130 | 3300049579 | Ga0501043_0244396 | Ga0501043_0244396_527_1228 | 233 |
| 131 | 3300002987 | JGI25159J45721_1011985 | JGI25159J45721_10119852 | 234 |
| 132 | 3300003187 | JGI25151J46595_10000560 | JGI25151J46595_1000056025 | 234 |
| 133 | 3300003354 | JGI25160J50197_1004355 | JGI25160J50197_10043556 | 234 |
| 134 | 3300005434 | Ga0070709_10365030 | Ga0070709_103650302 | 234 |
| 135 | 3300005539 | Ga0068853_100117692 | Ga0068853_1001176922 | 234 |
| 136 | 3300009094 | Ga0111539_10357611 | Ga0111539_103576111 | 234 |
| 137 | 3300009101 | Ga0105247_10375938 | Ga0105247_103759382 | 234 |
| 138 | 3300025284 | Ga0209130_1001606 | Ga0209130_10016067 | 234 |
| 139 | 3300025294 | Ga0209025_1000270 | Ga0209025_100027089 | 234 |
| 140 | 3300025297 | Ga0209758_1003183 | Ga0209758_10031837 | 234 |
| 141 | 3300025302 | Ga0207426_1000548 | Ga0207426_100054828 | 234 |
| 142 | 3300025944 | Ga0207661_10271300 | Ga0207661_102713002 | 234 |
| 143 | 3300031239 | Ga0265328_10001052 | Ga0265328_100010523 | 234 |
| 144 | 3300031250 | Ga0265331_10124064 | Ga0265331_101240642 | 234 |
| 145 | 3300031456 | Ga0307513_10188798 | Ga0307513_101887982 | 234 |
| 146 | 3300039438 | Ga0436360_0613689 | Ga0436360_0613689_60_812 | 234 |
| 147 | 3300042146 | Ga0450907_021540 | Ga0450907_021540_219_926 | 234 |
| 148 | 3300039437 | Ga0436365_0338859 | Ga0436365_0338859_37_744 | 235 |
| 149 | 3300007265 | Ga0099794_10010724 | Ga0099794_100107244 | 236 |
| 150 | 3300005981 | Ga0081538_10007430 | Ga0081538_100074303 | 237 |
| 151 | 3300006846 | Ga0075430_100029382 | Ga0075430_1000293824 | 237 |
| 152 | 3300006871 | Ga0075434_100017002 | Ga0075434_1000170027 | 237 |
| 153 | 3300007788 | Ga0099795_10000598 | Ga0099795_100005984 | 237 |
| 154 | 3300037853 | Ga0436364_0501962 | Ga0436364_0501962_151_864 | 237 |
| 155 | 3300039447 | Ga0436361_0759335 | Ga0436361_0759335_155_868 | 237 |
| 156 | 3300041512 | Ga0451853_0984363 | Ga0451853_0984363_64_777 | 237 |
| 157 | 3300049592 | Ga0501076_0132493 | Ga0501076_0132493_131_844 | 237 |
| 158 | 3300049741 | Ga0501079_0203737 | Ga0501079_0203737_282_995 | 237 |
| 159 | 3300050492 | nmdc:mga0yw44_63838_c1 | nmdc:mga0yw44_63838_c1_434_1147 | 237 |
| 160 | 3300050507 | nmdc:mga05p37_796810_c1 | nmdc:mga05p37_796810_c1_135_848 | 237 |
| 161 | 3300050508 | nmdc:mga09592_466361_c1 | nmdc:mga09592_466361_c1_291_1004 | 237 |
| 162 | 3300050509 | nmdc:mga0qj67_40683_c1 | nmdc:mga0qj67_40683_c1_2091_2804 | 237 |
| 163 | 3300050510 | nmdc:mga06r32_114653_c1 | nmdc:mga06r32_114653_c1_1679_2392 | 237 |
| 164 | 3300050512 | nmdc:mga0n895_13099_c1 | nmdc:mga0n895_13099_c1_5371_6129 | 237 |
| 165 | 3300039447 | Ga0436361_0078505 | Ga0436361_0078505_1559_2275 | 238 |
| 166 | 3300044673 | Ga0453683_0030251 | Ga0453683_0030251_1638_2360 | 238 |
| 167 | 3300045051 | Ga0451576_0134586 | Ga0451576_0134586_1765_2487 | 238 |
| 168 | 3300006846 | Ga0075430_100046100 | Ga0075430_1000461002 | 239 |
| 169 | 3300009147 | Ga0114129_10136167 | Ga0114129_101361672 | 239 |
| 170 | 3300046615 | Ga0495656_0045636 | Ga0495656_0045636_1066_1791 | 239 |
| 171 | 3300049572 | Ga0501036_0105714 | Ga0501036_0105714_1071_1808 | 239 |
| 172 | 3300049580 | Ga0501046_0163888 | Ga0501046_0163888_356_1075 | 239 |
| 173 | 3300049592 | Ga0501076_0174090 | Ga0501076_0174090_881_1600 | 239 |
| 174 | 3300049742 | Ga0501080_0349777 | Ga0501080_0349777_440_1159 | 239 |
| 175 | 3300050507 | nmdc:mga05p37_16217_c1 | nmdc:mga05p37_16217_c1_4707_5426 | 239 |
| 176 | 3300061734 | Ga0530510_0073157 | Ga0530510_0073157_1458_2177 | 239 |
| 177 | 3300002070 | JGI24750J21931_1001668 | JGI24750J21931_10016683 | 240 |
| 178 | 3300002074 | JGI24748J21848_1005691 | JGI24748J21848_10056912 | 240 |
| 179 | 3300002075 | JGI24738J21930_10039396 | JGI24738J21930_100393961 | 240 |
| 180 | 3300002077 | JGI24744J21845_10008043 | JGI24744J21845_100080433 | 240 |
| 181 | 3300002155 | JGI24033J26618_1008746 | JGI24033J26618_10087462 | 240 |
| 182 | 3300002239 | JGI24034J26672_10007958 | JGI24034J26672_100079582 | 240 |
| 183 | 3300002244 | JGI24742J22300_10002113 | JGI24742J22300_100021132 | 240 |
| 184 | 3300005328 | Ga0070676_10099685 | Ga0070676_100996851 | 240 |
| 185 | 3300005331 | Ga0070670_100031332 | Ga0070670_1000313326 | 240 |
| 186 | 3300005334 | Ga0068869_100032403 | Ga0068869_1000324033 | 240 |
| 187 | 3300005338 | Ga0068868_100011533 | Ga0068868_1000115334 | 240 |
| 188 | 3300005340 | Ga0070689_100334376 | Ga0070689_1003343762 | 240 |
| 189 | 3300005343 | Ga0070687_100006103 | Ga0070687_1000061032 | 240 |
| 190 | 3300005345 | Ga0070692_10017275 | Ga0070692_100172754 | 240 |
| 191 | 3300005347 | Ga0070668_100129301 | Ga0070668_1001293012 | 240 |
| 192 | 3300005347 | Ga0070668_100240807 | Ga0070668_1002408071 | 240 |
| 193 | 3300005353 | Ga0070669_100150077 | Ga0070669_1001500771 | 240 |
| 194 | 3300005354 | Ga0070675_100057100 | Ga0070675_1000571002 | 240 |
| 195 | 3300005355 | Ga0070671_100015813 | Ga0070671_1000158134 | 240 |
| 196 | 3300005356 | Ga0070674_100019783 | Ga0070674_1000197832 | 240 |
| 197 | 3300005364 | Ga0070673_100104219 | Ga0070673_1001042191 | 240 |
| 198 | 3300005366 | Ga0070659_100266691 | Ga0070659_1002666912 | 240 |
| 199 | 3300005367 | Ga0070667_100029245 | Ga0070667_1000292452 | 240 |
| 200 | 3300005436 | Ga0070713_100144583 | Ga0070713_1001445831 | 240 |
| 201 | 3300005436 | Ga0070713_100151947 | Ga0070713_1001519472 | 240 |
| 202 | 3300005437 | Ga0070710_10103118 | Ga0070710_101031182 | 240 |
| 203 | 3300005438 | Ga0070701_10082848 | Ga0070701_100828482 | 240 |
| 204 | 3300005439 | Ga0070711_100169671 | Ga0070711_1001696712 | 240 |
| 205 | 3300005441 | Ga0070700_100018962 | Ga0070700_1000189624 | 240 |
| 206 | 3300005456 | Ga0070678_100026087 | Ga0070678_1000260874 | 240 |
| 207 | 3300005459 | Ga0068867_100023389 | Ga0068867_1000233891 | 240 |
| 208 | 3300005466 | Ga0070685_10026484 | Ga0070685_100264843 | 240 |
| 209 | 3300005539 | Ga0068853_100032751 | Ga0068853_1000327513 | 240 |
| 210 | 3300005543 | Ga0070672_100021128 | Ga0070672_1000211282 | 240 |
| 211 | 3300005544 | Ga0070686_100021206 | Ga0070686_1000212062 | 240 |
| 212 | 3300005548 | Ga0070665_100119679 | Ga0070665_1001196792 | 240 |
| 213 | 3300005577 | Ga0068857_100903410 | Ga0068857_1009034101 | 240 |
| 214 | 3300005616 | Ga0068852_100320749 | Ga0068852_1003207491 | 240 |
| 215 | 3300005617 | Ga0068859_100079200 | Ga0068859_1000792003 | 240 |
| 216 | 3300005618 | Ga0068864_100004578 | Ga0068864_1000045789 | 240 |
| 217 | 3300005840 | Ga0068870_10004900 | Ga0068870_100049005 | 240 |
| 218 | 3300005841 | Ga0068863_100025968 | Ga0068863_1000259686 | 240 |
| 219 | 3300005842 | Ga0068858_100029477 | Ga0068858_1000294775 | 240 |
| 220 | 3300005843 | Ga0068860_100044560 | Ga0068860_1000445602 | 240 |
| 221 | 3300005844 | Ga0068862_100018457 | Ga0068862_1000184572 | 240 |
| 222 | 3300005937 | Ga0081455_10030982 | Ga0081455_100309822 | 240 |
| 223 | 3300005981 | Ga0081538_10067526 | Ga0081538_100675262 | 240 |
| 224 | 3300005983 | Ga0081540_1017035 | Ga0081540_10170355 | 240 |
| 225 | 3300006038 | Ga0075365_10141896 | Ga0075365_101418962 | 240 |
| 226 | 3300006042 | Ga0075368_10044911 | Ga0075368_100449112 | 240 |
| 227 | 3300006051 | Ga0075364_10028066 | Ga0075364_100280663 | 240 |
| 228 | 3300006051 | Ga0075364_10183465 | Ga0075364_101834652 | 240 |
| 229 | 3300006175 | Ga0070712_100001671 | Ga0070712_1000016717 | 240 |
| 230 | 3300006178 | Ga0075367_10072194 | Ga0075367_100721941 | 240 |
| 231 | 3300006358 | Ga0068871_100091434 | Ga0068871_1000914342 | 240 |
| 232 | 3300006844 | Ga0075428_100024178 | Ga0075428_1000241788 | 240 |
| 233 | 3300006844 | Ga0075428_100503334 | Ga0075428_1005033342 | 240 |
| 234 | 3300006881 | Ga0068865_100122596 | Ga0068865_1001225962 | 240 |
| 235 | 3300006931 | Ga0097620_100079198 | Ga0097620_1000791983 | 240 |
| 236 | 3300009011 | Ga0105251_10086146 | Ga0105251_100861462 | 240 |
| 237 | 3300009094 | Ga0111539_10132119 | Ga0111539_101321192 | 240 |
| 238 | 3300009094 | Ga0111539_10204014 | Ga0111539_102040143 | 240 |
| 239 | 3300009147 | Ga0114129_10083649 | Ga0114129_100836492 | 240 |
| 240 | 3300009545 | Ga0105237_10279078 | Ga0105237_102790781 | 240 |
| 241 | 3300010375 | Ga0105239_10098595 | Ga0105239_100985952 | 240 |
| 242 | 3300010375 | Ga0105239_10308324 | Ga0105239_103083242 | 240 |
| 243 | 3300013296 | Ga0157374_10008248 | Ga0157374_100082483 | 240 |
| 244 | 3300013307 | Ga0157372_10998985 | Ga0157372_109989851 | 240 |
| 245 | 3300014326 | Ga0157380_10023039 | Ga0157380_100230392 | 240 |
| 246 | 3300014745 | Ga0157377_10107138 | Ga0157377_101071382 | 240 |
| 247 | 3300025321 | Ga0207656_10192717 | Ga0207656_101927171 | 240 |
| 248 | 3300025898 | Ga0207692_10040161 | Ga0207692_100401612 | 240 |
| 249 | 3300025900 | Ga0207710_10004332 | Ga0207710_100043326 | 240 |
| 250 | 3300025901 | Ga0207688_10001105 | Ga0207688_100011055 | 240 |
| 251 | 3300025904 | Ga0207647_10014078 | Ga0207647_100140783 | 240 |
| 252 | 3300025905 | Ga0207685_10035071 | Ga0207685_100350712 | 240 |
| 253 | 3300025906 | Ga0207699_10356281 | Ga0207699_103562811 | 240 |
| 254 | 3300025907 | Ga0207645_10046288 | Ga0207645_100462882 | 240 |
| 255 | 3300025908 | Ga0207643_10000387 | Ga0207643_100003875 | 240 |
| 256 | 3300025915 | Ga0207693_10001675 | Ga0207693_1000167511 | 240 |
| 257 | 3300025915 | Ga0207693_10139562 | Ga0207693_101395622 | 240 |
| 258 | 3300025916 | Ga0207663_10142790 | Ga0207663_101427902 | 240 |
| 259 | 3300025918 | Ga0207662_10010233 | Ga0207662_100102332 | 240 |
| 260 | 3300025925 | Ga0207650_10002475 | Ga0207650_100024756 | 240 |
| 261 | 3300025925 | Ga0207650_10176581 | Ga0207650_101765812 | 240 |
| 262 | 3300025926 | Ga0207659_10080865 | Ga0207659_100808653 | 240 |
| 263 | 3300025927 | Ga0207687_10038702 | Ga0207687_100387021 | 240 |
| 264 | 3300025931 | Ga0207644_10024807 | Ga0207644_100248074 | 240 |
| 265 | 3300025932 | Ga0207690_10227659 | Ga0207690_102276592 | 240 |
| 266 | 3300025933 | Ga0207706_10003621 | Ga0207706_100036214 | 240 |
| 267 | 3300025937 | Ga0207669_10128053 | Ga0207669_101280532 | 240 |
| 268 | 3300025940 | Ga0207691_10009096 | Ga0207691_100090969 | 240 |
| 269 | 3300025941 | Ga0207711_10019334 | Ga0207711_100193341 | 240 |
| 270 | 3300025942 | Ga0207689_10002173 | Ga0207689_100021735 | 240 |
| 271 | 3300025944 | Ga0207661_10314667 | Ga0207661_103146672 | 240 |
| 272 | 3300025945 | Ga0207679_10023712 | Ga0207679_100237122 | 240 |
| 273 | 3300025960 | Ga0207651_10013062 | Ga0207651_100130623 | 240 |
| 274 | 3300025961 | Ga0207712_10015028 | Ga0207712_100150284 | 240 |
| 275 | 3300025981 | Ga0207640_10107456 | Ga0207640_101074562 | 240 |
| 276 | 3300025986 | Ga0207658_10104651 | Ga0207658_101046512 | 240 |
| 277 | 3300026023 | Ga0207677_10002480 | Ga0207677_100024807 | 240 |
| 278 | 3300026041 | Ga0207639_10039012 | Ga0207639_100390123 | 240 |
| 279 | 3300026075 | Ga0207708_10001620 | Ga0207708_100016208 | 240 |
| 280 | 3300026088 | Ga0207641_10042162 | Ga0207641_100421623 | 240 |
| 281 | 3300026089 | Ga0207648_10006315 | Ga0207648_100063158 | 240 |
| 282 | 3300026095 | Ga0207676_10028355 | Ga0207676_100283553 | 240 |
| 283 | 3300026095 | Ga0207676_10265775 | Ga0207676_102657751 | 240 |
| 284 | 3300026116 | Ga0207674_10120373 | Ga0207674_101203732 | 240 |
| 285 | 3300026118 | Ga0207675_100029584 | Ga0207675_1000295843 | 240 |
| 286 | 3300026121 | Ga0207683_10024882 | Ga0207683_100248824 | 240 |
| 287 | 3300028381 | Ga0268264_10031171 | Ga0268264_100311712 | 240 |
| 288 | 3300030763 | Ga0265763_1000741 | Ga0265763_10007412 | 240 |
| 289 | 3300031018 | Ga0265773_1002521 | Ga0265773_10025212 | 240 |
| 290 | 3300034819 | Ga0373958_0027510 | Ga0373958_0027510_296_1018 | 240 |
| 291 | 3300035083 | Ga0373926_0030341 | Ga0373926_0030341_1017_1739 | 240 |
| 292 | 3300035111 | Ga0373923_0233811 | Ga0373923_0233811_92_814 | 240 |
| 293 | 3300035113 | Ga0373936_0101651 | Ga0373936_0101651_442_1164 | 240 |
| 294 | 3300035113 | Ga0373936_0242551 | Ga0373936_0242551_12_734 | 240 |
| 295 | 3300035116 | Ga0373945_0017234 | Ga0373945_0017234_541_1263 | 240 |
| 296 | 3300035170 | Ga0373943_0000224 | Ga0373943_0000224_21459_22181 | 240 |
| 297 | 3300035170 | Ga0373943_0045336 | Ga0373943_0045336_476_1198 | 240 |
| 298 | 3300035171 | Ga0373946_0152012 | Ga0373946_0152012_220_942 | 240 |
| 299 | 3300035410 | Ga0373924_0059392 | Ga0373924_0059392_704_1504 | 240 |
| 300 | 3300035692 | Ga0373935_0143862 | Ga0373935_0143862_670_1392 | 240 |
| 301 | 3300035695 | Ga0373927_0000540 | Ga0373927_0000540_7622_8344 | 240 |
| 302 | 3300035695 | Ga0373927_0116466 | Ga0373927_0116466_693_1415 | 240 |
| 303 | 3300035725 | Ga0373947_0000618 | Ga0373947_0000618_12160_12882 | 240 |
| 304 | 3300037068 | Ga0373925_0002045 | Ga0373925_0002045_3745_4467 | 240 |
| 305 | 3300037068 | Ga0373925_0458323 | Ga0373925_0458323_32_790 | 240 |
| 306 | 3300046459 | Ga0495629_0142907 | Ga0495629_0142907_569_1291 | 240 |
| 307 | 3300046472 | Ga0495580_0061223 | Ga0495580_0061223_1800_2522 | 240 |
| 308 | 3300046473 | Ga0495582_0153870 | Ga0495582_0153870_139_861 | 240 |
| 309 | 3300046474 | Ga0495605_0127239 | Ga0495605_0127239_176_898 | 240 |
| 310 | 3300046476 | Ga0495662_0163137 | Ga0495662_0163137_166_888 | 240 |
| 311 | 3300046499 | Ga0495594_0073496 | Ga0495594_0073496_1102_1824 | 240 |
| 312 | 3300046501 | Ga0495607_0056603 | Ga0495607_0056603_50_772 | 240 |
| 313 | 3300046515 | Ga0495620_0096692 | Ga0495620_0096692_214_936 | 240 |
| 314 | 3300046517 | Ga0495630_0007612 | Ga0495630_0007612_3797_4519 | 240 |
| 315 | 3300046517 | Ga0495630_0066042 | Ga0495630_0066042_892_1692 | 240 |
| 316 | 3300046517 | Ga0495630_0518372 | Ga0495630_0518372_80_802 | 240 |
| 317 | 3300046519 | Ga0495632_0048795 | Ga0495632_0048795_757_1485 | 240 |
| 318 | 3300046520 | Ga0495637_0049817 | Ga0495637_0049817_199_921 | 240 |
| 319 | 3300046525 | Ga0495663_0072319 | Ga0495663_0072319_25_747 | 240 |
| 320 | 3300046526 | Ga0495666_0048370 | Ga0495666_0048370_312_1112 | 240 |
| 321 | 3300046531 | Ga0495665_0049037 | Ga0495665_0049037_351_1073 | 240 |
| 322 | 3300046537 | Ga0495598_0006655 | Ga0495598_0006655_1184_1906 | 240 |
| 323 | 3300046557 | Ga0495622_0217809 | Ga0495622_0217809_13_735 | 240 |
| 324 | 3300046615 | Ga0495656_0011510 | Ga0495656_0011510_1721_2443 | 240 |
| 325 | 3300046642 | Ga0495634_0128532 | Ga0495634_0128532_550_1272 | 240 |
| 326 | 3300046648 | Ga0495611_0131656 | Ga0495611_0131656_319_1041 | 240 |
| 327 | 3300046663 | Ga0495635_0133755 | Ga0495635_0133755_459_1181 | 240 |
| 328 | 3300046681 | Ga0495647_0004031 | Ga0495647_0004031_3925_4647 | 240 |
| 329 | 3300046683 | Ga0495658_0032236 | Ga0495658_0032236_190_990 | 240 |
| 330 | 3300046683 | Ga0495658_0045504 | Ga0495658_0045504_1184_1906 | 240 |
| 331 | 3300046689 | Ga0495613_0037488 | Ga0495613_0037488_381_1103 | 240 |
| 332 | 3300046689 | Ga0495613_0071706 | Ga0495613_0071706_98_820 | 240 |
| 333 | 3300046690 | Ga0495624_0038514 | Ga0495624_0038514_2214_2936 | 240 |
| 334 | 3300046690 | Ga0495624_0064041 | Ga0495624_0064041_646_1368 | 240 |
| 335 | 3300046794 | Ga0495589_0086443 | Ga0495589_0086443_694_1416 | 240 |
| 336 | 3300047315 | Ga0495581_0014082 | Ga0495581_0014082_1881_2603 | 240 |
| 337 | 3300047315 | Ga0495581_0088182 | Ga0495581_0088182_940_1662 | 240 |
| 338 | 3300047317 | Ga0495604_0200267 | Ga0495604_0200267_24_746 | 240 |
| 339 | 3300047319 | Ga0495674_0191836 | Ga0495674_0191836_428_1228 | 240 |
| 340 | 3300047321 | Ga0495676_0052656 | Ga0495676_0052656_1067_1789 | 240 |
| 341 | 3300047323 | Ga0495683_0131736 | Ga0495683_0131736_74_796 | 240 |
| 342 | 3300047471 | Ga0495684_0007404 | Ga0495684_0007404_7654_8376 | 240 |
| 343 | 3300047673 | Ga0495593_0106968 | Ga0495593_0106968_575_1297 | 240 |
| 344 | 3300048089 | Ga0495614_0225302 | Ga0495614_0225302_35_757 | 240 |
| 345 | 3300048091 | Ga0495626_0207530 | Ga0495626_0207530_29_751 | 240 |
| 346 | 3300048903 | Ga0496100_0006356 | Ga0496100_0006356_4983_5705 | 240 |
| 347 | 3300048903 | Ga0496100_0198587 | Ga0496100_0198587_162_884 | 240 |
| 348 | 3300048904 | Ga0496101_0001573 | Ga0496101_0001573_7521_8243 | 240 |
| 349 | 3300048905 | Ga0496102_0014548 | Ga0496102_0014548_4929_5651 | 240 |
| 350 | 3300048906 | Ga0496103_0012426 | Ga0496103_0012426_1784_2506 | 240 |
| 351 | 3300048907 | Ga0496104_0090213 | Ga0496104_0090213_1327_2049 | 240 |
| 352 | 3300048908 | Ga0496105_0042813 | Ga0496105_0042813_129_851 | 240 |
| 353 | 3300048908 | Ga0496105_0051071 | Ga0496105_0051071_2459_3181 | 240 |
| 354 | 3300048909 | Ga0496106_0008577 | Ga0496106_0008577_5580_6302 | 240 |
| 355 | 3300048910 | Ga0496107_0004013 | Ga0496107_0004013_5503_6225 | 240 |
| 356 | 3300048910 | Ga0496107_0023797 | Ga0496107_0023797_176_898 | 240 |
| 357 | 3300048910 | Ga0496107_0117588 | Ga0496107_0117588_408_1130 | 240 |
| 358 | 3300048911 | Ga0496108_0000626 | Ga0496108_0000626_14805_15527 | 240 |
| 359 | 3300048911 | Ga0496108_0017276 | Ga0496108_0017276_3975_4697 | 240 |
| 360 | 3300048912 | Ga0496109_0045631 | Ga0496109_0045631_1631_2353 | 240 |
| 361 | 3300048912 | Ga0496109_0195791 | Ga0496109_0195791_675_1397 | 240 |
| 362 | 3300048913 | Ga0496110_0009396 | Ga0496110_0009396_1262_1984 | 240 |
| 363 | 3300048913 | Ga0496110_0177369 | Ga0496110_0177369_241_963 | 240 |
| 364 | 3300048914 | Ga0496111_0002392 | Ga0496111_0002392_10085_10807 | 240 |
| 365 | 3300048915 | Ga0496112_0006295 | Ga0496112_0006295_5550_6272 | 240 |
| 366 | 3300048915 | Ga0496112_0009904 | Ga0496112_0009904_4548_5270 | 240 |
| 367 | 3300048916 | Ga0496113_0000855 | Ga0496113_0000855_2968_3690 | 240 |
| 368 | 3300048916 | Ga0496113_0022831 | Ga0496113_0022831_856_1578 | 240 |
| 369 | 3300048917 | Ga0496114_0032853 | Ga0496114_0032853_981_1703 | 240 |
| 370 | 3300048918 | Ga0496115_0005841 | Ga0496115_0005841_788_1510 | 240 |
| 371 | 3300048918 | Ga0496115_0040453 | Ga0496115_0040453_518_1240 | 240 |
| 372 | 3300049592 | Ga0501076_0328111 | Ga0501076_0328111_21_743 | 240 |
| 373 | 3300049824 | Ga0501045_0071676 | Ga0501045_0071676_536_1258 | 240 |
| 374 | 3300050491 | nmdc:mga00v17_94568_c1 | nmdc:mga00v17_94568_c1_662_1384 | 240 |
| 375 | 3300050492 | nmdc:mga0yw44_159550_c1 | nmdc:mga0yw44_159550_c1_389_1111 | 240 |
| 376 | 3300050492 | nmdc:mga0yw44_16455_c1 | nmdc:mga0yw44_16455_c1_1882_2604 | 240 |
| 377 | 3300050492 | nmdc:mga0yw44_84243_c1 | nmdc:mga0yw44_84243_c1_187_909 | 240 |
| 378 | 3300050493 | nmdc:mga0k408_145819_c1 | nmdc:mga0k408_145819_c1_645_1367 | 240 |
| 379 | 3300050494 | nmdc:mga06z11_208899_c1 | nmdc:mga06z11_208899_c1_259_981 | 240 |
| 380 | 3300050507 | nmdc:mga05p37_35915_c1 | nmdc:mga05p37_35915_c1_4037_4759 | 240 |
| 381 | 3300050508 | nmdc:mga09592_196917_c1 | nmdc:mga09592_196917_c1_725_1447 | 240 |
| 382 | 3300050511 | nmdc:mga08y16_146103_c1 | nmdc:mga08y16_146103_c1_1244_1966 | 240 |
| 383 | 3300050512 | nmdc:mga0n895_54368_c1 | nmdc:mga0n895_54368_c1_3059_3781 | 240 |
| 384 | 3300053077 | Ga0495601_0119948 | Ga0495601_0119948_512_1234 | 240 |
| 385 | 3300053085 | Ga0495619_0087681 | Ga0495619_0087681_345_1067 | 240 |
| 386 | 3300053085 | Ga0495619_0133614 | Ga0495619_0133614_454_1176 | 240 |
| 387 | 3300060353 | Ga0501082_0411822 | Ga0501082_0411822_22_744 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hfk-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione | 0.9915 | 1 | 201 |
| 3gx0-assembly1.cif.gz_A-2 | crystal structure of gsh-dependent disulfide bond oxidoreductase | 0.9896 | 1 | 202 |
| 4ecj-assembly1.cif.gz_B | crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione | 0.9783 | 1 | 201 |
| 6tah-assembly1.cif.gz_CAA | crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione | 0.978 | 1 | 201 |
| 4l8e-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit | 0.9756 | 3 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9973 | 1 | 84 | 3.40.30.10 |
| 4l8eA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9963 | 3 | 86 | 3.40.30.10 |
| af_P77526_93_209_1.20.1050.130 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9874 | 94 | 207 | 1.20.1050.130 |
| af_P77526_87_192_1.20.1050.10 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9856 | 87 | 190 | 1.20.1050.10 |
| 4ecjB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9837 | 87 | 195 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S8AWI8-F1-model_v4 | Glutathione S-transferase | 1 | 1 | 101 |
GO:0016740
|
| AF-A0A4Q5PD99-F1-model_v4 | Thiol:disulfide oxidoreductase | 0.9985 | 76 | 208 |
|
| AF-A0A2A2TBE1-F1-model_v4 | Thiol:disulfide oxidoreductase | 0.9977 | 1 | 209 |
|
| AF-A0A522J4D5-F1-model_v4 | Thiol:disulfide oxidoreductase | 0.9969 | 1 | 84 |
|
| AF-A0A6G4BI85-F1-model_v4 | deleted | 0.9965 | 12 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar