F430898
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 387 | 306 | 226 | 386 |
Family's Representative Sequence
| Representative Sequence | 3300044666|Ga0466977_0000010|Ga0466977_0000010_7658_8965 |
| Length | 435 |
| Sequence | MIFLCAVYFINVRASIFRSSVGRCDLDGVTVPNTRQEFSVPIALYALTAGAFGIGVTEFVIMGLLLNVGADFGVSIAAAGLLISGYALGVVVGAPLMTTATARWPRKTVLLVLMAIFTVGNAACALAPNYAALMAARVLTSFAHGTFFGVGSVVATGLVSRERRASAIAVMFTGLTVANILGVPFGTWLGQHFGWRASFWAVTLIGALALLVIAGFVPKIAAPKDAGDWRADLRALARRPVLLGLLTTVLGWVGVFGVFTYIAPLLIEVTGFPEGAVSPILLIFGGGLVVGNLLGGRLADRRVVPTVLGSLFVLSVVLGLMTFTLHSRWPAIVSVALLGAAAFATVAPLQLWVMEKASGAGESLASSFNIAAFNLGNAIGAWLGGFVIEHGPGLTAVPWVAALVPLAGVGVAVLSLRLDRRDVRSLTPVCENPAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 3 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 4 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 5 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 6 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 7 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 8 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 9 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 10 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 11 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 12 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 13 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 14 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 15 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 16 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 17 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 18 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 19 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 20 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 21 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 22 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 23 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 24 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 25 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 26 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 27 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 28 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 29 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 30 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 31 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 32 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 33 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 34 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 35 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 36 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 37 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 38 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 39 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 40 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 41 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 42 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 43 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 44 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 45 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 46 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 47 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 48 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 49 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 50 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 51 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 52 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 53 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 54 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 55 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 56 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 57 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 58 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 59 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 60 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 61 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 62 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 63 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 64 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 65 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 66 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 67 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 68 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 69 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 70 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 71 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 72 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 73 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 74 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 75 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 76 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 77 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 78 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 79 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 80 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 81 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 82 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 83 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 84 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 85 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 86 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 87 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 88 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 89 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 90 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 91 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 92 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 93 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 94 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 95 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 96 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 97 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 98 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 99 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 100 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 101 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 102 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 103 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 104 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 105 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 106 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 107 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 108 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 109 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 110 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 111 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 112 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 113 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 114 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 115 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 116 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 117 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 118 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 119 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 120 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 121 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 122 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 123 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 124 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 125 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 126 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 127 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 128 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 129 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 130 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 131 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 132 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 133 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 134 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 135 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 136 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 137 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 138 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 139 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 140 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 141 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 142 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 143 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 144 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 145 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 146 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 147 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 148 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 149 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 150 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 151 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 152 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 153 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 154 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 155 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 156 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 157 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 158 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 159 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 160 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 161 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 162 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 163 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 164 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 165 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 166 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 167 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 168 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 169 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 170 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 172 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 173 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 174 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 175 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 179 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 257 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 258 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 259 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 260 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 261 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 265 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 268 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 269 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 270 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 272 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 273 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 274 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 275 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 276 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 277 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 278 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 280 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 281 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 283 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 287 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 289 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 294 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 295 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 296 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 297 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 298 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 299 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 300 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 301 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 302 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 303 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 304 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 305 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 306 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 57.88 |
| Metatranscriptomes | 0.52 |
| Isolates | 41.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.87 |
| Nodule | 27.65 |
| Rhizoplane | 2.58 |
| Rhizosphere | 26.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1005421 | 3300002741 | Bacteria | 2083 |
| 2 | JGI25152J39213_1000787 | 3300002773 | Bacteria | 15889 |
| 3 | JGI25406J46586_10000173 | 3300003203 | Bacteria | 28945 |
| 4 | JGI25153J46596_10002668 | 3300003215 | Bacteria | 10190 |
| 5 | JGI25153J46596_10003324 | 3300003215 | Bacteria | 9040 |
| 6 | rootL2_10000693 | 3300003322 | Bacteria | 4503 |
| 7 | Ga0006562J51391_1127659 | 3300003578 | Bacteria | 2701 |
| 8 | Ga0006562J51391_1127661 | 3300003578 | Bacteria | 1890 |
| 9 | Ga0055539_1000458 | 3300003752 | Bacteria | 13740 |
| 10 | Ga0055533_1000006 | 3300003756 | Bacteria | 635559 |
| 11 | Ga0055525_1000618 | 3300003759 | Bacteria | 14724 |
| 12 | Ga0055529_1000158 | 3300003763 | Bacteria | 93023 |
| 13 | Ga0055526_1002727 | 3300003771 | Bacteria | 11738 |
| 14 | Ga0055526_1017690 | 3300003771 | Bacteria | 2708 |
| 15 | Ga0055536_1001570 | 3300003781 | Bacteria | 13668 |
| 16 | Ga0055528_1005844 | 3300003790 | Bacteria | 5650 |
| 17 | Ga0055530_10002027 | 3300003791 | Bacteria | 13694 |
| 18 | Ga0055540_1027285 | 3300003792 | Bacteria | 1368 |
| 19 | Ga0055531_10013810 | 3300003794 | Bacteria | 3696 |
| 20 | Ga0065165_1000279 | 3300005262 | Bacteria | 87186 |
| 21 | Ga0065165_1007661 | 3300005262 | Bacteria | 5243 |
| 22 | Ga0065707_10081730 | 3300005295 | Bacteria | 59162 |
| 23 | Ga0070671_100034839 | 3300005355 | Bacteria | 4169 |
| 24 | Ga0068861_100008801 | 3300005719 | Bacteria | 6953 |
| 25 | Ga0081539_10000101 | 3300005985 | Bacteria | 198612 |
| 26 | Ga0075365_10011207 | 3300006038 | Bacteria | 5264 |
| 27 | Ga0075369_10004557 | 3300006186 | Bacteria | 5132 |
| 28 | Ga0075369_10009349 | 3300006186 | Bacteria | 3806 |
| 29 | Ga0075369_10062781 | 3300006186 | Bacteria | 1624 |
| 30 | Ga0105240_10072322 | 3300009093 | Bacteria | 4262 |
| 31 | Ga0105247_10183824 | 3300009101 | Bacteria | 1396 |
| 32 | Ga0105248_10260792 | 3300009177 | Bacteria | 1951 |
| 33 | Ga0171462_1007 | 3300013250 | Bacteria | 417698 |
| 34 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 35 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 36 | Ga0207427_100373 | 3300025231 | Bacteria | 27297 |
| 37 | Ga0209258_100110 | 3300025242 | Bacteria | 201322 |
| 38 | Ga0207425_1000463 | 3300025245 | Bacteria | 25992 |
| 39 | Ga0209026_1000032 | 3300025250 | Bacteria | 322378 |
| 40 | Ga0209677_100142 | 3300025253 | Bacteria | 66505 |
| 41 | Ga0209759_1000500 | 3300025256 | Bacteria | 43016 |
| 42 | Ga0209759_1001395 | 3300025256 | Bacteria | 13836 |
| 43 | Ga0209129_1000122 | 3300025258 | Bacteria | 135306 |
| 44 | Ga0209565_1000183 | 3300025263 | Bacteria | 76983 |
| 45 | Ga0209455_1000104 | 3300025272 | Bacteria | 201321 |
| 46 | Ga0209673_1000848 | 3300025273 | Bacteria | 39892 |
| 47 | Ga0209676_1000253 | 3300025292 | Bacteria | 113412 |
| 48 | Ga0209564_1000446 | 3300025295 | Bacteria | 70931 |
| 49 | Ga0209564_1002119 | 3300025295 | Bacteria | 16835 |
| 50 | Ga0209758_1000091 | 3300025297 | Bacteria | 242583 |
| 51 | Ga0209758_1000350 | 3300025297 | Bacteria | 84141 |
| 52 | Ga0209758_1000846 | 3300025297 | Bacteria | 42613 |
| 53 | Ga0209758_1002223 | 3300025297 | Bacteria | 20148 |
| 54 | Ga0209050_1000507 | 3300025298 | Bacteria | 66169 |
| 55 | Ga0209050_1000649 | 3300025298 | Bacteria | 53856 |
| 56 | Ga0209256_1000694 | 3300025299 | Bacteria | 44757 |
| 57 | Ga0209256_1011322 | 3300025299 | Bacteria | 3584 |
| 58 | Ga0209256_1016998 | 3300025299 | Bacteria | 2443 |
| 59 | Ga0209051_1001019 | 3300025303 | Bacteria | 26792 |
| 60 | Ga0209051_1002693 | 3300025303 | Bacteria | 12365 |
| 61 | Ga0209257_1000036 | 3300025304 | Bacteria | 616006 |
| 62 | Ga0209257_1001428 | 3300025304 | Bacteria | 28367 |
| 63 | Ga0209257_1007938 | 3300025304 | Bacteria | 6224 |
| 64 | Ga0207695_10109934 | 3300025913 | Bacteria | 2737 |
| 65 | Ga0207671_10137438 | 3300025914 | Bacteria | 1880 |
| 66 | Ga0207709_10189592 | 3300025935 | Bacteria | 1459 |
| 67 | Ga0207678_10042813 | 3300026067 | Bacteria | 3921 |
| 68 | Ga0207675_100000691 | 3300026118 | Bacteria | 33312 |
| 69 | Ga0207698_10156473 | 3300026142 | Bacteria | 1986 |
| 70 | Ga0307515_10047989 | 3300028794 | Bacteria | 6470 |
| 71 | Ga0307513_10057011 | 3300031456 | Bacteria | 4166 |
| 72 | Ga0307408_100077926 | 3300031548 | Bacteria | 2469 |
| 73 | Ga0307406_10138684 | 3300031901 | Bacteria | 1718 |
| 74 | Ga0307412_10049631 | 3300031911 | Bacteria | 2766 |
| 75 | Ga0307415_100041395 | 3300032126 | Bacteria | 3059 |
| 76 | Ga0307415_100165972 | 3300032126 | Bacteria | 1717 |
| 77 | Ga0373927_0164947 | 3300035695 | Bacteria | 1452 |
| 78 | Ga0466977_0000010 | 3300044666 | Bacteria | 28877 |
| 79 | Ga0466961_0024345 | 3300044693 | Bacteria | 3895 |
| 80 | Ga0495627_000233 | 3300046453 | Bacteria | 58913 |
| 81 | Ga0495590_0002832 | 3300046457 | Bacteria | 7154 |
| 82 | Ga0495638_0003351 | 3300046460 | Bacteria | 12642 |
| 83 | Ga0495638_0007623 | 3300046460 | Bacteria | 7736 |
| 84 | Ga0495638_0014321 | 3300046460 | Bacteria | 5367 |
| 85 | Ga0495638_0028270 | 3300046460 | Bacteria | 3622 |
| 86 | Ga0495638_0038610 | 3300046460 | Bacteria | 3033 |
| 87 | Ga0495650_0000207 | 3300046471 | Bacteria | 127568 |
| 88 | Ga0495650_0052026 | 3300046471 | Bacteria | 1683 |
| 89 | Ga0495607_0041191 | 3300046501 | Bacteria | 2745 |
| 90 | Ga0495607_0088235 | 3300046501 | Bacteria | 1686 |
| 91 | Ga0495583_0000025 | 3300046506 | Bacteria | 263775 |
| 92 | Ga0495583_0000623 | 3300046506 | Bacteria | 47532 |
| 93 | Ga0495606_0011040 | 3300046507 | Bacteria | 7411 |
| 94 | Ga0495610_0000140 | 3300046512 | Bacteria | 80219 |
| 95 | Ga0495610_0004119 | 3300046512 | Bacteria | 10879 |
| 96 | Ga0495610_0005029 | 3300046512 | Bacteria | 9558 |
| 97 | Ga0495610_0044249 | 3300046512 | Bacteria | 2211 |
| 98 | Ga0495616_0000061 | 3300046513 | Bacteria | 97964 |
| 99 | Ga0495620_0020509 | 3300046515 | Bacteria | 3227 |
| 100 | Ga0495631_0004112 | 3300046518 | Bacteria | 7811 |
| 101 | Ga0495632_0000979 | 3300046519 | Bacteria | 24960 |
| 102 | Ga0495632_0001285 | 3300046519 | Bacteria | 21243 |
| 103 | Ga0495632_0049874 | 3300046519 | Bacteria | 2067 |
| 104 | Ga0495637_0003345 | 3300046520 | Bacteria | 8528 |
| 105 | Ga0495637_0011508 | 3300046520 | Bacteria | 4248 |
| 106 | Ga0495648_0000634 | 3300046524 | Bacteria | 37553 |
| 107 | Ga0495648_0028049 | 3300046524 | Bacteria | 3756 |
| 108 | Ga0495654_0000016 | 3300046530 | Bacteria | 306416 |
| 109 | Ga0495654_0046260 | 3300046530 | Bacteria | 2144 |
| 110 | Ga0495597_0019126 | 3300046542 | Bacteria | 3208 |
| 111 | Ga0495668_0000040 | 3300046616 | Bacteria | 230681 |
| 112 | Ga0495668_0006769 | 3300046616 | Bacteria | 7451 |
| 113 | Ga0495668_0011175 | 3300046616 | Bacteria | 5388 |
| 114 | Ga0495668_0012532 | 3300046616 | Bacteria | 5028 |
| 115 | Ga0495668_0017285 | 3300046616 | Bacteria | 4185 |
| 116 | Ga0495668_0042029 | 3300046616 | Bacteria | 2545 |
| 117 | Ga0495625_0001102 | 3300046660 | Bacteria | 35052 |
| 118 | Ga0495625_0015585 | 3300046660 | Bacteria | 6013 |
| 119 | Ga0495625_0016488 | 3300046660 | Bacteria | 5812 |
| 120 | Ga0495625_0047125 | 3300046660 | Bacteria | 3108 |
| 121 | Ga0495625_0079986 | 3300046660 | Bacteria | 2277 |
| 122 | Ga0495661_0027915 | 3300046665 | Bacteria | 3619 |
| 123 | Ga0495661_0124750 | 3300046665 | Bacteria | 1418 |
| 124 | Ga0495669_0009253 | 3300046684 | Bacteria | 4152 |
| 125 | Ga0495670_0022960 | 3300046691 | Bacteria | 3080 |
| 126 | Ga0495671_0034973 | 3300046692 | Bacteria | 2553 |
| 127 | Ga0495649_0002377 | 3300046694 | Bacteria | 13309 |
| 128 | Ga0495589_0098671 | 3300046794 | Bacteria | 1414 |
| 129 | Ga0495660_0036548 | 3300046810 | Bacteria | 2739 |
| 130 | Ga0495672_0000782 | 3300047320 | Bacteria | 34487 |
| 131 | Ga0495672_0050732 | 3300047320 | Bacteria | 2447 |
| 132 | Ga0495679_003316 | 3300047446 | Bacteria | 7786 |
| 133 | Ga0495673_0000277 | 3300047469 | Bacteria | 69419 |
| 134 | Ga0495673_0000691 | 3300047469 | Bacteria | 32984 |
| 135 | Ga0495681_0053468 | 3300047470 | Bacteria | 1890 |
| 136 | Ga0495686_0004586 | 3300047472 | Bacteria | 11280 |
| 137 | Ga0495686_0007276 | 3300047472 | Bacteria | 8322 |
| 138 | Ga0495686_0018556 | 3300047472 | Bacteria | 4665 |
| 139 | Ga0495686_0021390 | 3300047472 | Bacteria | 4296 |
| 140 | Ga0495686_0037910 | 3300047472 | Bacteria | 3086 |
| 141 | Ga0496101_0133318 | 3300048904 | Bacteria | 1888 |
| 142 | Ga0496104_0243014 | 3300048907 | Bacteria | 1712 |
| 143 | Ga0496106_0019459 | 3300048909 | Bacteria | 5036 |
| 144 | Ga0496107_0001440 | 3300048910 | Bacteria | 14715 |
| 145 | Ga0496108_0013144 | 3300048911 | Bacteria | 6748 |
| 146 | Ga0496112_0057645 | 3300048915 | Bacteria | 3824 |
| 147 | Ga0496112_0100792 | 3300048915 | Bacteria | 2857 |
| 148 | Ga0496113_0127180 | 3300048916 | Bacteria | 1996 |
| 149 | Ga0496114_0086611 | 3300048917 | Bacteria | 2655 |
| 150 | Ga0496115_0007246 | 3300048918 | Bacteria | 8150 |
| 151 | Ga0496117_0110051 | 3300048920 | Bacteria | 1718 |
| 152 | Ga0496118_0070377 | 3300048921 | Bacteria | 2526 |
| 153 | Ga0496120_0026976 | 3300048923 | Bacteria | 3540 |
| 154 | Ga0496121_0001742 | 3300048924 | Bacteria | 35564 |
| 155 | Ga0496121_0003089 | 3300048924 | Bacteria | 24095 |
| 156 | Ga0496121_0005248 | 3300048924 | Bacteria | 16759 |
| 157 | Ga0496121_0011144 | 3300048924 | Bacteria | 10026 |
| 158 | Ga0496122_0020864 | 3300048925 | Bacteria | 5892 |
| 159 | Ga0496122_0027150 | 3300048925 | Bacteria | 4904 |
| 160 | Ga0496123_0032300 | 3300048926 | Bacteria | 3793 |
| 161 | Ga0496124_0037080 | 3300048927 | Bacteria | 4244 |
| 162 | Ga0496125_0040548 | 3300048928 | Bacteria | 3993 |
| 163 | Ga0496126_0010364 | 3300048929 | Bacteria | 9784 |
| 164 | Ga0496126_0098241 | 3300048929 | Bacteria | 2565 |
| 165 | Ga0496126_0198593 | 3300048929 | Bacteria | 1695 |
| 166 | Ga0495678_000699 | 3300049459 | Bacteria | 30520 |
| 167 | Ga0501037_0033466 | 3300049573 | Bacteria | 3796 |
| 168 | Ga0501048_0002122 | 3300049582 | Bacteria | 15118 |
| 169 | Ga0501238_002860 | 3300049671 | Bacteria | 2096 |
| 170 | nmdc:mga0yw44_16757_c1 | 3300050492 | Bacteria | 3968 |
| 171 | nmdc:mga0yw44_175473_c1 | 3300050492 | Bacteria | 1409 |
| 172 | nmdc:mga0sz30_37340_c1 | 3300050516 | Bacteria | 2033 |
| 173 | Ga0500635_0000153 | 3300053080 | Bacteria | 38580 |
| 174 | Ga0500578_0000013 | 3300053086 | Bacteria | 185921 |
| 175 | Ga0500578_0000166 | 3300053086 | Bacteria | 78688 |
| 176 | Ga0500643_033016 | 3300053087 | Bacteria | 1567 |
| 177 | Ga0500644_0000269 | 3300053088 | Bacteria | 29380 |
| 178 | Ga0500644_0013048 | 3300053088 | Bacteria | 2312 |
| 179 | Ga0500644_0030613 | 3300053088 | Bacteria | 1704 |
| 180 | Ga0500644_0034883 | 3300053088 | Bacteria | 1626 |
| 181 | Ga0500581_025224 | 3300053089 | Bacteria | 3022 |
| 182 | Ga0500651_0171997 | 3300053093 | Bacteria | 1291 |
| 183 | Ga0500566_0000157 | 3300053094 | Bacteria | 34534 |
| 184 | Ga0500641_0006452 | 3300053096 | Bacteria | 4162 |
| 185 | Ga0500641_0019038 | 3300053096 | Bacteria | 2591 |
| 186 | Ga0500650_0001493 | 3300053098 | Bacteria | 7107 |
| 187 | Ga0500556_0000413 | 3300053104 | Bacteria | 31142 |
| 188 | Ga0500556_0001013 | 3300053104 | Bacteria | 14773 |
| 189 | Ga0500594_0000312 | 3300053118 | Bacteria | 10863 |
| 190 | Ga0500594_0016870 | 3300053118 | Bacteria | 1780 |
| 191 | Ga0500594_0035763 | 3300053118 | Bacteria | 1334 |
| 192 | Ga0500595_003935 | 3300053119 | Bacteria | 6804 |
| 193 | Ga0500607_121097 | 3300053121 | Bacteria | 1265 |
| 194 | Ga0500608_000348 | 3300053122 | Bacteria | 17856 |
| 195 | Ga0500608_000629 | 3300053122 | Bacteria | 12952 |
| 196 | Ga0500608_040932 | 3300053122 | Bacteria | 2221 |
| 197 | Ga0500618_000022 | 3300053125 | Bacteria | 157907 |
| 198 | Ga0500618_016639 | 3300053125 | Bacteria | 1838 |
| 199 | Ga0500652_000291 | 3300053131 | Bacteria | 18359 |
| 200 | Ga0500652_000531 | 3300053131 | Bacteria | 13423 |
| 201 | Ga0500658_0004847 | 3300053134 | Bacteria | 5018 |
| 202 | Ga0500559_0000927 | 3300053136 | Bacteria | 18564 |
| 203 | Ga0500559_0002089 | 3300053136 | Bacteria | 10664 |
| 204 | Ga0500559_0010808 | 3300053136 | Bacteria | 3914 |
| 205 | Ga0500564_000357 | 3300053138 | Bacteria | 12863 |
| 206 | Ga0500568_0002109 | 3300053139 | Bacteria | 12007 |
| 207 | Ga0500568_0004073 | 3300053139 | Bacteria | 7914 |
| 208 | Ga0500568_0053490 | 3300053139 | Bacteria | 1582 |
| 209 | Ga0500577_0001207 | 3300053142 | Bacteria | 6607 |
| 210 | Ga0500590_064980 | 3300053148 | Bacteria | 1826 |
| 211 | Ga0500604_0012442 | 3300053151 | Bacteria | 2297 |
| 212 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 213 | Ga0500616_0004549 | 3300053153 | Bacteria | 9820 |
| 214 | Ga0500616_0057812 | 3300053153 | Bacteria | 2020 |
| 215 | Ga0500622_0000469 | 3300053156 | Bacteria | 38108 |
| 216 | Ga0500622_0000525 | 3300053156 | Bacteria | 35545 |
| 217 | Ga0500622_0002946 | 3300053156 | Bacteria | 11813 |
| 218 | Ga0500622_0003749 | 3300053156 | Bacteria | 9930 |
| 219 | Ga0500622_0013310 | 3300053156 | Bacteria | 4438 |
| 220 | Ga0500622_0048392 | 3300053156 | Bacteria | 2193 |
| 221 | Ga0500622_0073566 | 3300053156 | Bacteria | 1723 |
| 222 | Ga0500627_0049186 | 3300053158 | Bacteria | 1833 |
| 223 | Ga0500634_0071692 | 3300053161 | Bacteria | 1811 |
| 224 | Ga0500637_0059397 | 3300053178 | Bacteria | 2189 |
| 225 | Ga0500567_076561 | 3300053723 | Bacteria | 1455 |
| 226 | Ga0500609_001466 | 3300053731 | Bacteria | 3446 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025935 | Ga0207709_10189592 | Ga0207709_101895921 | 323 |
| 2 | 3300046512 | Ga0495610_0004119 | Ga0495610_0004119_590_1750 | 325 |
| 3 | 3300046660 | Ga0495625_0079986 | Ga0495625_0079986_516_1703 | 325 |
| 4 | 3300049459 | Ga0495678_000699 | Ga0495678_000699_1842_3002 | 325 |
| 5 | 3300053118 | Ga0500594_0000312 | Ga0500594_0000312_466_1626 | 325 |
| 6 | 3300053087 | Ga0500643_033016 | Ga0500643_033016_60_1220 | 326 |
| 7 | 3300053088 | Ga0500644_0000269 | Ga0500644_0000269_6414_7574 | 326 |
| 8 | 3300053138 | Ga0500564_000357 | Ga0500564_000357_6732_7892 | 326 |
| 9 | 3300028794 | Ga0307515_10047989 | Ga0307515_100479896 | 327 |
| 10 | 3300053086 | Ga0500578_0000166 | Ga0500578_0000166_3757_4917 | 327 |
| 11 | 3300053121 | Ga0500607_121097 | Ga0500607_121097_12_1184 | 330 |
| 12 | 3300003792 | Ga0055540_1027285 | Ga0055540_10272851 | 331 |
| 13 | 3300025303 | Ga0209051_1001019 | Ga0209051_10010192 | 331 |
| 14 | 3300046453 | Ga0495627_000233 | Ga0495627_000233_25728_26891 | 331 |
| 15 | 3300047472 | Ga0495686_0007276 | Ga0495686_0007276_5077_6246 | 331 |
| 16 | 3300053118 | Ga0500594_0035763 | Ga0500594_0035763_48_1229 | 336 |
| 17 | 3300046519 | Ga0495632_0000979 | Ga0495632_0000979_16896_18080 | 337 |
| 18 | 3300053131 | Ga0500652_000291 | Ga0500652_000291_1639_2823 | 337 |
| 19 | 3300053139 | Ga0500568_0004073 | Ga0500568_0004073_3388_4572 | 337 |
| 20 | 3300053151 | Ga0500604_0012442 | Ga0500604_0012442_134_1318 | 337 |
| 21 | 3300053156 | Ga0500622_0000525 | Ga0500622_0000525_3997_5181 | 337 |
| 22 | 3300031456 | Ga0307513_10057011 | Ga0307513_100570114 | 338 |
| 23 | 3300031901 | Ga0307406_10138684 | Ga0307406_101386842 | 339 |
| 24 | 3300032126 | Ga0307415_100041395 | Ga0307415_1000413954 | 339 |
| 25 | 3300048924 | Ga0496121_0005248 | Ga0496121_0005248_4316_5506 | 340 |
| 26 | 3300025299 | Ga0209256_1016998 | Ga0209256_10169982 | 341 |
| 27 | 3300046501 | Ga0495607_0041191 | Ga0495607_0041191_284_1441 | 341 |
| 28 | 3300006038 | Ga0075365_10011207 | Ga0075365_100112075 | 342 |
| 29 | 3300006186 | Ga0075369_10009349 | Ga0075369_100093492 | 342 |
| 30 | 3300050492 | nmdc:mga0yw44_175473_c1 | nmdc:mga0yw44_175473_c1_180_1361 | 342 |
| 31 | 3300050516 | nmdc:mga0sz30_37340_c1 | nmdc:mga0sz30_37340_c1_171_1352 | 342 |
| 32 | 3300053086 | Ga0500578_0000013 | Ga0500578_0000013_76149_77333 | 342 |
| 33 | 3300025231 | Ga0207427_100373 | Ga0207427_10037318 | 343 |
| 34 | 3300025913 | Ga0207695_10109934 | Ga0207695_101099342 | 343 |
| 35 | 3300031548 | Ga0307408_100077926 | Ga0307408_1000779262 | 343 |
| 36 | 3300031911 | Ga0307412_10049631 | Ga0307412_100496312 | 343 |
| 37 | iso_pu_bacteria | 8045864390 | 8045869078 | 343 |
| 38 | 3300003771 | Ga0055526_1017690 | Ga0055526_10176903 | 345 |
| 39 | 3300005262 | Ga0065165_1000279 | Ga0065165_10002799 | 345 |
| 40 | 3300025295 | Ga0209564_1000446 | Ga0209564_100044629 | 345 |
| 41 | 3300046506 | Ga0495583_0000025 | Ga0495583_0000025_209132_210295 | 345 |
| 42 | 3300049671 | Ga0501238_002860 | Ga0501238_002860_462_1631 | 346 |
| 43 | 3300053122 | Ga0500608_000629 | Ga0500608_000629_10728_11900 | 346 |
| 44 | iso_pu_bacteria | 2961127735 | 2961133522 | 346 |
| 45 | 3300025297 | Ga0209758_1000846 | Ga0209758_100084621 | 347 |
| 46 | 3300046457 | Ga0495590_0002832 | Ga0495590_0002832_2446_3606 | 347 |
| 47 | 3300046460 | Ga0495638_0038610 | Ga0495638_0038610_396_1559 | 347 |
| 48 | 3300046507 | Ga0495606_0011040 | Ga0495606_0011040_447_1616 | 347 |
| 49 | 3300046512 | Ga0495610_0005029 | Ga0495610_0005029_2921_4084 | 347 |
| 50 | 3300046518 | Ga0495631_0004112 | Ga0495631_0004112_77_1237 | 347 |
| 51 | 3300046520 | Ga0495637_0011508 | Ga0495637_0011508_2977_4137 | 347 |
| 52 | 3300046524 | Ga0495648_0000634 | Ga0495648_0000634_36240_37400 | 347 |
| 53 | 3300046524 | Ga0495648_0028049 | Ga0495648_0028049_1549_2718 | 347 |
| 54 | 3300046530 | Ga0495654_0000016 | Ga0495654_0000016_261729_262898 | 347 |
| 55 | 3300046616 | Ga0495668_0006769 | Ga0495668_0006769_4720_5880 | 347 |
| 56 | 3300047469 | Ga0495673_0000277 | Ga0495673_0000277_38065_39228 | 347 |
| 57 | 3300047472 | Ga0495686_0004586 | Ga0495686_0004586_3314_4477 | 347 |
| 58 | 3300047472 | Ga0495686_0018556 | Ga0495686_0018556_2404_3564 | 347 |
| 59 | 3300048909 | Ga0496106_0019459 | Ga0496106_0019459_2788_3957 | 347 |
| 60 | 3300048910 | Ga0496107_0001440 | Ga0496107_0001440_12336_13505 | 347 |
| 61 | 3300048920 | Ga0496117_0110051 | Ga0496117_0110051_439_1611 | 347 |
| 62 | 3300048921 | Ga0496118_0070377 | Ga0496118_0070377_1130_2302 | 347 |
| 63 | 3300048924 | Ga0496121_0011144 | Ga0496121_0011144_7688_8857 | 347 |
| 64 | 3300053104 | Ga0500556_0001013 | Ga0500556_0001013_1143_2312 | 347 |
| 65 | 3300053142 | Ga0500577_0001207 | Ga0500577_0001207_883_2046 | 347 |
| 66 | 3300053156 | Ga0500622_0002946 | Ga0500622_0002946_2216_3376 | 347 |
| 67 | iso_pu_bacteria | 2582581279 | 2585148181 | 347 |
| 68 | iso_pu_bacteria | 2643221583 | 2643926898 | 347 |
| 69 | iso_pu_bacteria | 2818991435 | 2819537655 | 347 |
| 70 | iso_pu_bacteria | 2818991454 | 2819647432 | 347 |
| 71 | 3300003790 | Ga0055528_1005844 | Ga0055528_10058443 | 348 |
| 72 | 3300005262 | Ga0065165_1007661 | Ga0065165_10076615 | 348 |
| 73 | 3300025263 | Ga0209565_1000183 | Ga0209565_100018355 | 348 |
| 74 | 3300025273 | Ga0209673_1000848 | Ga0209673_100084811 | 348 |
| 75 | 3300025297 | Ga0209758_1002223 | Ga0209758_10022235 | 348 |
| 76 | 3300025298 | Ga0209050_1000507 | Ga0209050_100050744 | 348 |
| 77 | 3300025299 | Ga0209256_1011322 | Ga0209256_10113221 | 348 |
| 78 | 3300046460 | Ga0495638_0003351 | Ga0495638_0003351_9720_10889 | 348 |
| 79 | 3300046501 | Ga0495607_0088235 | Ga0495607_0088235_63_1232 | 348 |
| 80 | 3300046513 | Ga0495616_0000061 | Ga0495616_0000061_29189_30358 | 348 |
| 81 | 3300046519 | Ga0495632_0001285 | Ga0495632_0001285_18524_19693 | 348 |
| 82 | 3300046519 | Ga0495632_0049874 | Ga0495632_0049874_167_1336 | 348 |
| 83 | 3300046616 | Ga0495668_0011175 | Ga0495668_0011175_980_2149 | 348 |
| 84 | 3300046660 | Ga0495625_0001102 | Ga0495625_0001102_25985_27148 | 348 |
| 85 | 3300053723 | Ga0500567_076561 | Ga0500567_076561_237_1409 | 348 |
| 86 | 3300053731 | Ga0500609_001466 | Ga0500609_001466_1089_2258 | 348 |
| 87 | iso_pu_bacteria | 2510917020 | 2511123856 | 348 |
| 88 | iso_pu_bacteria | 2643221598 | 2644001813 | 348 |
| 89 | iso_pu_bacteria | 2643221629 | 2644167146 | 348 |
| 90 | iso_pu_bacteria | 2857504554 | 2857506103 | 348 |
| 91 | 3300047469 | Ga0495673_0000691 | Ga0495673_0000691_21044_22213 | 349 |
| 92 | 3300047470 | Ga0495681_0053468 | Ga0495681_0053468_115_1284 | 349 |
| 93 | iso_pu_bacteria | 2523231067 | 2523466494 | 349 |
| 94 | iso_pu_bacteria | 2582581280 | 2585154585 | 349 |
| 95 | iso_pu_bacteria | 2582581293 | 2585198523 | 349 |
| 96 | iso_pu_bacteria | 2585428106 | 2587917087 | 349 |
| 97 | iso_pu_bacteria | 2643221545 | 2643750439 | 349 |
| 98 | iso_pu_bacteria | 2643221584 | 2643929659 | 349 |
| 99 | iso_pu_bacteria | 2643221640 | 2644223708 | 349 |
| 100 | iso_pu_bacteria | 2643221642 | 2644236204 | 349 |
| 101 | iso_pu_bacteria | 2643221662 | 2644349662 | 349 |
| 102 | iso_pu_bacteria | 2643221691 | 2644507329 | 349 |
| 103 | iso_pu_bacteria | 2738543031 | 2739351370 | 349 |
| 104 | iso_pu_bacteria | 2791355048 | 2792461750 | 349 |
| 105 | iso_pu_bacteria | 2818991467 | 2819720467 | 349 |
| 106 | iso_pu_bacteria | 2842775625 | 2842779126 | 349 |
| 107 | iso_pu_bacteria | 2843744320 | 2843745888 | 349 |
| 108 | iso_pu_bacteria | 2849560528 | 2849562200 | 349 |
| 109 | iso_pu_bacteria | 2849573788 | 2849574565 | 349 |
| 110 | iso_pu_bacteria | 2851153111 | 2851156939 | 349 |
| 111 | iso_pu_bacteria | 2857524615 | 2857529965 | 349 |
| 112 | iso_pu_bacteria | 2884960567 | 2884963480 | 349 |
| 113 | iso_pu_bacteria | 2893066018 | 2893069392 | 349 |
| 114 | iso_pu_bacteria | 2898329390 | 2898330302 | 349 |
| 115 | iso_pu_bacteria | 2919073203 | 2919077182 | 349 |
| 116 | iso_pu_bacteria | 2928531327 | 2928534597 | 349 |
| 117 | 3300025304 | Ga0209257_1000036 | Ga0209257_100003657 | 350 |
| 118 | 3300046616 | Ga0495668_0012532 | Ga0495668_0012532_2792_3961 | 350 |
| 119 | 3300048915 | Ga0496112_0100792 | Ga0496112_0100792_1641_2819 | 350 |
| 120 | 3300048924 | Ga0496121_0003089 | Ga0496121_0003089_15581_16822 | 350 |
| 121 | 3300053094 | Ga0500566_0000157 | Ga0500566_0000157_5155_6327 | 350 |
| 122 | 3300053119 | Ga0500595_003935 | Ga0500595_003935_1001_2242 | 350 |
| 123 | 3300053122 | Ga0500608_000348 | Ga0500608_000348_10323_11486 | 350 |
| 124 | 3300053122 | Ga0500608_040932 | Ga0500608_040932_422_1594 | 350 |
| 125 | 3300053125 | Ga0500618_016639 | Ga0500618_016639_283_1455 | 350 |
| 126 | 3300053136 | Ga0500559_0002089 | Ga0500559_0002089_7554_8726 | 350 |
| 127 | 3300053139 | Ga0500568_0053490 | Ga0500568_0053490_275_1516 | 350 |
| 128 | 3300053156 | Ga0500622_0003749 | Ga0500622_0003749_1202_2419 | 350 |
| 129 | 3300053178 | Ga0500637_0059397 | Ga0500637_0059397_1005_2177 | 350 |
| 130 | iso_pu_bacteria | 2513237087 | 2513591233 | 350 |
| 131 | iso_pu_bacteria | 2739367756 | 2739790523 | 350 |
| 132 | iso_pu_bacteria | 2773857925 | 2774869294 | 350 |
| 133 | iso_pu_bacteria | 2841911363 | 2841916444 | 350 |
| 134 | iso_pu_bacteria | 2841917233 | 2841922341 | 350 |
| 135 | 3300025299 | Ga0209256_1000694 | Ga0209256_100069430 | 351 |
| 136 | 3300046471 | Ga0495650_0000207 | Ga0495650_0000207_43153_44322 | 351 |
| 137 | 3300046506 | Ga0495583_0000623 | Ga0495583_0000623_11693_12883 | 351 |
| 138 | 3300046512 | Ga0495610_0000140 | Ga0495610_0000140_5751_6920 | 351 |
| 139 | 3300046520 | Ga0495637_0003345 | Ga0495637_0003345_1414_2583 | 351 |
| 140 | 3300046542 | Ga0495597_0019126 | Ga0495597_0019126_1317_2486 | 351 |
| 141 | 3300046660 | Ga0495625_0047125 | Ga0495625_0047125_1637_2806 | 351 |
| 142 | 3300048927 | Ga0496124_0037080 | Ga0496124_0037080_542_1708 | 351 |
| 143 | 3300049573 | Ga0501037_0033466 | Ga0501037_0033466_2107_3276 | 351 |
| 144 | iso_pu_bacteria | 2508501127 | 2509144259 | 351 |
| 145 | iso_pu_bacteria | 2597489875 | 2597811746 | 351 |
| 146 | iso_pu_bacteria | 2643221734 | 2644736399 | 351 |
| 147 | iso_pu_bacteria | 2869162929 | 2869165927 | 351 |
| 148 | iso_pu_bacteria | 2874123672 | 2874130221 | 351 |
| 149 | iso_pu_bacteria | 2888343758 | 2888344872 | 351 |
| 150 | iso_pu_bacteria | 2917699015 | 2917702423 | 351 |
| 151 | iso_pu_bacteria | 2924754689 | 2924761612 | 351 |
| 152 | iso_pu_bacteria | 2970540015 | 2970545691 | 351 |
| 153 | 3300003322 | rootL2_10000693 | rootL2_100006932 | 352 |
| 154 | 3300003781 | Ga0055536_1001570 | Ga0055536_10015703 | 352 |
| 155 | 3300003791 | Ga0055530_10002027 | Ga0055530_100020273 | 352 |
| 156 | 3300025292 | Ga0209676_1000253 | Ga0209676_100025314 | 352 |
| 157 | 3300025298 | Ga0209050_1000649 | Ga0209050_100064919 | 352 |
| 158 | 3300025303 | Ga0209051_1002693 | Ga0209051_10026932 | 352 |
| 159 | 3300025304 | Ga0209257_1007938 | Ga0209257_10079383 | 352 |
| 160 | 3300046660 | Ga0495625_0015585 | Ga0495625_0015585_3656_4825 | 352 |
| 161 | 3300047320 | Ga0495672_0000782 | Ga0495672_0000782_19287_20456 | 352 |
| 162 | 3300053153 | Ga0500616_0004549 | Ga0500616_0004549_6633_7805 | 352 |
| 163 | iso_pu_bacteria | 2510065059 | 2510318167 | 352 |
| 164 | iso_pu_bacteria | 2512875024 | 2512961521 | 352 |
| 165 | iso_pu_bacteria | 2513237164 | 2514036806 | 352 |
| 166 | iso_pu_bacteria | 2643221595 | 2643988349 | 352 |
| 167 | iso_pu_bacteria | 2643221627 | 2644154734 | 352 |
| 168 | iso_pu_bacteria | 2687453392 | 2688596484 | 352 |
| 169 | iso_pu_bacteria | 2756170246 | 2756673870 | 352 |
| 170 | iso_pu_bacteria | 2841734538 | 2841736904 | 352 |
| 171 | iso_pu_bacteria | 2844002411 | 2844002951 | 352 |
| 172 | iso_pu_bacteria | 2844009547 | 2844011309 | 352 |
| 173 | iso_pu_bacteria | 2856334872 | 2856337746 | 352 |
| 174 | iso_pu_bacteria | 2856342000 | 2856345303 | 352 |
| 175 | iso_pu_bacteria | 2856349417 | 2856355558 | 352 |
| 176 | iso_pu_bacteria | 2857367948 | 2857375192 | 352 |
| 177 | iso_pu_bacteria | 2869169390 | 2869176332 | 352 |
| 178 | iso_pu_bacteria | 2869242130 | 2869244578 | 352 |
| 179 | iso_pu_bacteria | 2869249662 | 2869254034 | 352 |
| 180 | iso_pu_bacteria | 2869256925 | 2869257216 | 352 |
| 181 | iso_pu_bacteria | 2869264136 | 2869266375 | 352 |
| 182 | iso_pu_bacteria | 2871435913 | 2871438133 | 352 |
| 183 | iso_pu_bacteria | 2871451962 | 2871457275 | 352 |
| 184 | iso_pu_bacteria | 2871459585 | 2871461040 | 352 |
| 185 | iso_pu_bacteria | 2871466892 | 2871471183 | 352 |
| 186 | iso_pu_bacteria | 2871474448 | 2871477100 | 352 |
| 187 | iso_pu_bacteria | 2871481445 | 2871484257 | 352 |
| 188 | iso_pu_bacteria | 2871488783 | 2871494774 | 352 |
| 189 | iso_pu_bacteria | 2874116593 | 2874121406 | 352 |
| 190 | iso_pu_bacteria | 2874168670 | 2874176677 | 352 |
| 191 | iso_pu_bacteria | 2876386047 | 2876390139 | 352 |
| 192 | iso_pu_bacteria | 2876420981 | 2876422025 | 352 |
| 193 | iso_pu_bacteria | 2878753008 | 2878759908 | 352 |
| 194 | iso_pu_bacteria | 2878788777 | 2878788900 | 352 |
| 195 | iso_pu_bacteria | 2881155292 | 2881159765 | 352 |
| 196 | iso_pu_bacteria | 2885312484 | 2885313637 | 352 |
| 197 | iso_pu_bacteria | 2885342637 | 2885348544 | 352 |
| 198 | iso_pu_bacteria | 2885350715 | 2885352524 | 352 |
| 199 | iso_pu_bacteria | 2889914905 | 2889917321 | 352 |
| 200 | iso_pu_bacteria | 2903492973 | 2903494132 | 352 |
| 201 | iso_pu_bacteria | 2906363423 | 2906367543 | 352 |
| 202 | iso_pu_bacteria | 2906370794 | 2906377744 | 352 |
| 203 | iso_pu_bacteria | 2906378014 | 2906379109 | 352 |
| 204 | iso_pu_bacteria | 2906393657 | 2906395374 | 352 |
| 205 | iso_pu_bacteria | 2906401398 | 2906404726 | 352 |
| 206 | iso_pu_bacteria | 2906427513 | 2906433069 | 352 |
| 207 | iso_pu_bacteria | 2924733363 | 2924734446 | 352 |
| 208 | iso_pu_bacteria | 2924741084 | 2924746031 | 352 |
| 209 | iso_pu_bacteria | 2937861824 | 2937866269 | 352 |
| 210 | iso_pu_bacteria | 2937980651 | 2937982939 | 352 |
| 211 | iso_pu_bacteria | 2958071322 | 2958073180 | 352 |
| 212 | iso_pu_bacteria | 2958108152 | 2958112862 | 352 |
| 213 | iso_pu_bacteria | 2958122699 | 2958124392 | 352 |
| 214 | iso_pu_bacteria | 2961183825 | 2961189293 | 352 |
| 215 | iso_pu_bacteria | 2965032056 | 2965039253 | 352 |
| 216 | iso_pu_bacteria | 2965040258 | 2965044727 | 352 |
| 217 | iso_pu_bacteria | 2965089291 | 2965090759 | 352 |
| 218 | iso_pu_bacteria | 2968138860 | 2968144328 | 352 |
| 219 | iso_pu_bacteria | 2970510686 | 2970512206 | 352 |
| 220 | iso_pu_bacteria | 2970524798 | 2970526596 | 352 |
| 221 | iso_pu_bacteria | 2970532167 | 2970534585 | 352 |
| 222 | iso_pu_bacteria | 2970619444 | 2970622272 | 352 |
| 223 | iso_pu_bacteria | 2970627176 | 2970628528 | 352 |
| 224 | iso_pu_bacteria | 2977851361 | 2977852248 | 352 |
| 225 | iso_pu_bacteria | 2977864932 | 2977871457 | 352 |
| 226 | iso_pu_bacteria | 2977872689 | 2977873925 | 352 |
| 227 | iso_pu_bacteria | 2977907340 | 2977912165 | 352 |
| 228 | iso_pu_bacteria | 2977915119 | 2977922676 | 352 |
| 229 | iso_pu_bacteria | 2977950692 | 2977957321 | 352 |
| 230 | iso_pu_bacteria | 2977957713 | 2977962347 | 352 |
| 231 | iso_pu_bacteria | 2979764755 | 2979766272 | 352 |
| 232 | iso_pu_bacteria | 2979772303 | 2979774947 | 352 |
| 233 | iso_pu_bacteria | 2996386984 | 2996387737 | 352 |
| 234 | iso_pu_bacteria | 3004195979 | 3004200953 | 352 |
| 235 | iso_pu_bacteria | 3004239961 | 3004243098 | 352 |
| 236 | iso_pu_bacteria | 3004268573 | 3004269058 | 352 |
| 237 | iso_pu_bacteria | 649633066 | 649871035 | 352 |
| 238 | iso_pu_bacteria | 8004312739 | 8004320345 | 352 |
| 239 | iso_pu_bacteria | 8004361976 | 8004365464 | 352 |
| 240 | iso_pu_bacteria | 8004633249 | 8004639646 | 352 |
| 241 | iso_pu_bacteria | 8004695233 | 8004702228 | 352 |
| 242 | iso_pu_bacteria | 8004727605 | 8004727908 | 352 |
| 243 | 3300003578 | Ga0006562J51391_1127659 | Ga0006562J51391_11276592 | 353 |
| 244 | 3300003578 | Ga0006562J51391_1127661 | Ga0006562J51391_11276611 | 353 |
| 245 | 3300006186 | Ga0075369_10004557 | Ga0075369_100045574 | 353 |
| 246 | 3300009093 | Ga0105240_10072322 | Ga0105240_100723222 | 353 |
| 247 | 3300026067 | Ga0207678_10042813 | Ga0207678_100428132 | 353 |
| 248 | 3300026142 | Ga0207698_10156473 | Ga0207698_101564732 | 353 |
| 249 | 3300044693 | Ga0466961_0024345 | Ga0466961_0024345_2195_3388 | 353 |
| 250 | 3300046460 | Ga0495638_0014321 | Ga0495638_0014321_2242_3414 | 353 |
| 251 | 3300046471 | Ga0495650_0052026 | Ga0495650_0052026_168_1343 | 353 |
| 252 | 3300046512 | Ga0495610_0044249 | Ga0495610_0044249_781_1953 | 353 |
| 253 | 3300046515 | Ga0495620_0020509 | Ga0495620_0020509_394_1566 | 353 |
| 254 | 3300046530 | Ga0495654_0046260 | Ga0495654_0046260_769_1941 | 353 |
| 255 | 3300046616 | Ga0495668_0000040 | Ga0495668_0000040_7454_8620 | 353 |
| 256 | 3300046616 | Ga0495668_0042029 | Ga0495668_0042029_21_1193 | 353 |
| 257 | 3300046665 | Ga0495661_0027915 | Ga0495661_0027915_1117_2289 | 353 |
| 258 | 3300046665 | Ga0495661_0124750 | Ga0495661_0124750_189_1361 | 353 |
| 259 | 3300046691 | Ga0495670_0022960 | Ga0495670_0022960_1090_2262 | 353 |
| 260 | 3300046692 | Ga0495671_0034973 | Ga0495671_0034973_257_1429 | 353 |
| 261 | 3300046810 | Ga0495660_0036548 | Ga0495660_0036548_840_2012 | 353 |
| 262 | 3300047472 | Ga0495686_0021390 | Ga0495686_0021390_1762_2934 | 353 |
| 263 | 3300047472 | Ga0495686_0037910 | Ga0495686_0037910_1164_2330 | 353 |
| 264 | 3300048917 | Ga0496114_0086611 | Ga0496114_0086611_623_1801 | 353 |
| 265 | 3300048923 | Ga0496120_0026976 | Ga0496120_0026976_1506_2678 | 353 |
| 266 | 3300048924 | Ga0496121_0001742 | Ga0496121_0001742_14404_15576 | 353 |
| 267 | 3300048925 | Ga0496122_0020864 | Ga0496122_0020864_4325_5494 | 353 |
| 268 | 3300048925 | Ga0496122_0027150 | Ga0496122_0027150_404_1573 | 353 |
| 269 | 3300048926 | Ga0496123_0032300 | Ga0496123_0032300_2104_3276 | 353 |
| 270 | 3300048929 | Ga0496126_0098241 | Ga0496126_0098241_1089_2261 | 353 |
| 271 | 3300050492 | nmdc:mga0yw44_16757_c1 | nmdc:mga0yw44_16757_c1_15_1187 | 353 |
| 272 | 3300053080 | Ga0500635_0000153 | Ga0500635_0000153_22759_23928 | 353 |
| 273 | 3300053088 | Ga0500644_0030613 | Ga0500644_0030613_21_1193 | 353 |
| 274 | 3300053088 | Ga0500644_0034883 | Ga0500644_0034883_11_1183 | 353 |
| 275 | 3300053089 | Ga0500581_025224 | Ga0500581_025224_1024_2196 | 353 |
| 276 | 3300053096 | Ga0500641_0006452 | Ga0500641_0006452_419_1591 | 353 |
| 277 | 3300053098 | Ga0500650_0001493 | Ga0500650_0001493_4480_5652 | 353 |
| 278 | 3300053104 | Ga0500556_0000413 | Ga0500556_0000413_1755_2927 | 353 |
| 279 | 3300053118 | Ga0500594_0016870 | Ga0500594_0016870_491_1663 | 353 |
| 280 | 3300053131 | Ga0500652_000531 | Ga0500652_000531_4606_5778 | 353 |
| 281 | 3300053134 | Ga0500658_0004847 | Ga0500658_0004847_3521_4693 | 353 |
| 282 | 3300053136 | Ga0500559_0010808 | Ga0500559_0010808_2419_3588 | 353 |
| 283 | 3300053139 | Ga0500568_0002109 | Ga0500568_0002109_6272_7444 | 353 |
| 284 | 3300053148 | Ga0500590_064980 | Ga0500590_064980_102_1274 | 353 |
| 285 | 3300053153 | Ga0500616_0000180 | Ga0500616_0000180_76608_77780 | 353 |
| 286 | 3300053153 | Ga0500616_0057812 | Ga0500616_0057812_252_1421 | 353 |
| 287 | 3300053156 | Ga0500622_0013310 | Ga0500622_0013310_2704_3870 | 353 |
| 288 | 3300053156 | Ga0500622_0073566 | Ga0500622_0073566_118_1287 | 353 |
| 289 | 3300053158 | Ga0500627_0049186 | Ga0500627_0049186_296_1468 | 353 |
| 290 | 3300053161 | Ga0500634_0071692 | Ga0500634_0071692_378_1550 | 353 |
| 291 | iso_pu_bacteria | 2585428057 | 2587729706 | 353 |
| 292 | iso_pu_bacteria | 2585428058 | 2587734155 | 353 |
| 293 | iso_pu_bacteria | 2588253510 | 2588293427 | 353 |
| 294 | iso_pu_bacteria | 2828305725 | 2828307936 | 353 |
| 295 | iso_pu_bacteria | 2844533157 | 2844539047 | 353 |
| 296 | iso_pu_bacteria | 8055617313 | 8055618426 | 353 |
| 297 | 3300032126 | Ga0307415_100165972 | Ga0307415_1001659722 | 354 |
| 298 | 3300046460 | Ga0495638_0028270 | Ga0495638_0028270_62_1237 | 354 |
| 299 | 3300047320 | Ga0495672_0050732 | Ga0495672_0050732_371_1546 | 354 |
| 300 | 3300053088 | Ga0500644_0013048 | Ga0500644_0013048_871_2046 | 354 |
| 301 | 3300053156 | Ga0500622_0000469 | Ga0500622_0000469_33285_34460 | 354 |
| 302 | iso_pu_bacteria | 2643221592 | 2643970143 | 354 |
| 303 | iso_pu_bacteria | 2643221625 | 2644141190 | 354 |
| 304 | iso_pu_bacteria | 2643221648 | 2644274197 | 354 |
| 305 | 3300003203 | JGI25406J46586_10000173 | JGI25406J46586_1000017325 | 355 |
| 306 | 3300003794 | Ga0055531_10013810 | Ga0055531_100138102 | 355 |
| 307 | 3300005295 | Ga0065707_10081730 | Ga0065707_1008173021 | 355 |
| 308 | 3300005719 | Ga0068861_100008801 | Ga0068861_1000088014 | 355 |
| 309 | 3300005985 | Ga0081539_10000101 | Ga0081539_1000010178 | 355 |
| 310 | 3300013250 | Ga0171462_1007 | Ga0171462_1007186 | 355 |
| 311 | 3300025304 | Ga0209257_1001428 | Ga0209257_10014282 | 355 |
| 312 | 3300026118 | Ga0207675_100000691 | Ga0207675_10000069124 | 355 |
| 313 | 3300049582 | Ga0501048_0002122 | Ga0501048_0002122_6892_8085 | 355 |
| 314 | 3300053093 | Ga0500651_0171997 | Ga0500651_0171997_61_1248 | 355 |
| 315 | 3300053156 | Ga0500622_0048392 | Ga0500622_0048392_594_1787 | 355 |
| 316 | 3300002773 | JGI25152J39213_1000787 | JGI25152J39213_100078714 | 356 |
| 317 | 3300003215 | JGI25153J46596_10002668 | JGI25153J46596_1000266811 | 356 |
| 318 | 3300003752 | Ga0055539_1000458 | Ga0055539_100045816 | 356 |
| 319 | 3300003756 | Ga0055533_1000006 | Ga0055533_1000006550 | 356 |
| 320 | 3300003759 | Ga0055525_1000618 | Ga0055525_10006185 | 356 |
| 321 | 3300003771 | Ga0055526_1002727 | Ga0055526_100272711 | 356 |
| 322 | 3300009101 | Ga0105247_10183824 | Ga0105247_101838241 | 356 |
| 323 | 3300025226 | Ga0209674_100003 | Ga0209674_100003783 | 356 |
| 324 | 3300025230 | Ga0209563_100010 | Ga0209563_100010513 | 356 |
| 325 | 3300025245 | Ga0207425_1000463 | Ga0207425_100046312 | 356 |
| 326 | 3300025253 | Ga0209677_100142 | Ga0209677_10014260 | 356 |
| 327 | 3300025258 | Ga0209129_1000122 | Ga0209129_100012271 | 356 |
| 328 | 3300025295 | Ga0209564_1002119 | Ga0209564_10021196 | 356 |
| 329 | 3300025297 | Ga0209758_1000091 | Ga0209758_100009137 | 356 |
| 330 | 3300025914 | Ga0207671_10137438 | Ga0207671_101374382 | 356 |
| 331 | 3300048915 | Ga0496112_0057645 | Ga0496112_0057645_97_1278 | 356 |
| 332 | 3300003215 | JGI25153J46596_10003324 | JGI25153J46596_100033247 | 357 |
| 333 | 3300006186 | Ga0075369_10062781 | Ga0075369_100627812 | 357 |
| 334 | 3300025297 | Ga0209758_1000350 | Ga0209758_100035025 | 357 |
| 335 | 3300048928 | Ga0496125_0040548 | Ga0496125_0040548_1632_2813 | 357 |
| 336 | 3300048929 | Ga0496126_0010364 | Ga0496126_0010364_1308_2489 | 357 |
| 337 | 3300003763 | Ga0055529_1000158 | Ga0055529_100015811 | 358 |
| 338 | 3300025242 | Ga0209258_100110 | Ga0209258_100110105 | 358 |
| 339 | 3300025256 | Ga0209759_1001395 | Ga0209759_10013954 | 358 |
| 340 | 3300025272 | Ga0209455_1000104 | Ga0209455_1000104105 | 358 |
| 341 | 3300046460 | Ga0495638_0007623 | Ga0495638_0007623_2074_3288 | 358 |
| 342 | 3300053096 | Ga0500641_0019038 | Ga0500641_0019038_946_2160 | 358 |
| 343 | 3300025250 | Ga0209026_1000032 | Ga0209026_1000032232 | 360 |
| 344 | 3300025256 | Ga0209759_1000500 | Ga0209759_100050029 | 360 |
| 345 | 3300035695 | Ga0373927_0164947 | Ga0373927_0164947_38_1228 | 360 |
| 346 | 3300046616 | Ga0495668_0017285 | Ga0495668_0017285_2356_3546 | 360 |
| 347 | 3300046660 | Ga0495625_0016488 | Ga0495625_0016488_2857_4047 | 360 |
| 348 | 3300046684 | Ga0495669_0009253 | Ga0495669_0009253_616_1806 | 360 |
| 349 | 3300046694 | Ga0495649_0002377 | Ga0495649_0002377_4841_6031 | 360 |
| 350 | 3300046794 | Ga0495589_0098671 | Ga0495589_0098671_153_1343 | 360 |
| 351 | 3300047446 | Ga0495679_003316 | Ga0495679_003316_2907_4115 | 362 |
| 352 | 3300053125 | Ga0500618_000022 | Ga0500618_000022_64920_66128 | 362 |
| 353 | 3300048929 | Ga0496126_0198593 | Ga0496126_0198593_211_1413 | 363 |
| 354 | iso_pu_bacteria | 2856356410 | 2856357197 | 363 |
| 355 | iso_pu_bacteria | 2881845957 | 2881850677 | 363 |
| 356 | iso_pu_bacteria | 2881861095 | 2881862180 | 363 |
| 357 | iso_pu_bacteria | 2885318864 | 2885322697 | 363 |
| 358 | iso_pu_bacteria | 2924784321 | 2924790711 | 363 |
| 359 | iso_pu_bacteria | 2961170736 | 2961177180 | 363 |
| 360 | iso_pu_bacteria | 2967996073 | 2968002270 | 363 |
| 361 | iso_pu_bacteria | 2968003550 | 2968009504 | 363 |
| 362 | iso_pu_bacteria | 2970503327 | 2970509854 | 363 |
| 363 | iso_pu_bacteria | 2977821940 | 2977828430 | 363 |
| 364 | iso_pu_bacteria | 2979808191 | 2979814730 | 363 |
| 365 | iso_pu_bacteria | 8004374579 | 8004381406 | 363 |
| 366 | 3300005355 | Ga0070671_100034839 | Ga0070671_1000348392 | 365 |
| 367 | 3300009177 | Ga0105248_10260792 | Ga0105248_102607922 | 365 |
| 368 | 3300048911 | Ga0496108_0013144 | Ga0496108_0013144_2113_3336 | 365 |
| 369 | 3300048916 | Ga0496113_0127180 | Ga0496113_0127180_260_1483 | 365 |
| 370 | iso_pu_bacteria | 2503198000 | 2503199201 | 365 |
| 371 | iso_pu_bacteria | 2791355123 | 2792747741 | 365 |
| 372 | iso_pu_bacteria | 2878781027 | 2878783837 | 365 |
| 373 | iso_pu_bacteria | 2894414249 | 2894414610 | 365 |
| 374 | iso_pu_bacteria | 2922151315 | 2922154097 | 365 |
| 375 | iso_pu_bacteria | 2924710171 | 2924712109 | 365 |
| 376 | iso_pu_bacteria | 2965110997 | 2965115770 | 365 |
| 377 | iso_pu_bacteria | 2970489779 | 2970493618 | 365 |
| 378 | iso_pu_bacteria | 2979793036 | 2979797764 | 365 |
| 379 | iso_pu_bacteria | 3004167301 | 3004173821 | 365 |
| 380 | 3300053136 | Ga0500559_0000927 | Ga0500559_0000927_12574_13815 | 366 |
| 381 | iso_pu_bacteria | 8004395343 | 8004397120 | 366 |
| 382 | iso_pu_bacteria | 2937836603 | 2937841246 | 367 |
| 383 | 3300048918 | Ga0496115_0007246 | Ga0496115_0007246_1566_2810 | 368 |
| 384 | 3300048904 | Ga0496101_0133318 | Ga0496101_0133318_317_1597 | 384 |
| 385 | 3300048907 | Ga0496104_0243014 | Ga0496104_0243014_396_1676 | 384 |
| 386 | 3300044666 | Ga0466977_0000010 | Ga0466977_0000010_7658_8965 | 387 |
| 387 | 3300002741 | JGI25157J39369_1005421 | JGI25157J39369_10054212 | 398 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hnh-assembly1.cif.gz_A | cryo-em structure of human oatp1b1 in complex with simeprevir | 0.7563 | 38 | 370 |
| 3wdo-assembly1.cif.gz_A | structure of e. coli yajr transporter | 0.7501 | 36 | 383 |
| 6lz0-assembly1.cif.gz_A | cryo-em structure of human mct1 in complex with basigin-2 in the presence of lactate | 0.7382 | 44 | 370 |
| 6hcl-assembly1.cif.gz_A | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.7377 | 36 | 384 |
| 8jt9-assembly1.cif.gz_A | human vmat2 complex with ketanserin | 0.7339 | 40 | 384 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77389_5_379_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8708 | 42 | 384 | 1.20.1250.20 |
| af_Q8MP22_1_169_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8566 | 74 | 200 | 1.20.1250.20 |
| af_O74395_360_528_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.845 | 221 | 370 | 1.20.1250.20 |
| af_P39980_322_516_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8381 | 221 | 371 | 1.20.1250.20 |
| af_P9WJW9_258_425_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8373 | 223 | 373 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A022MJ67-F1-model_v4 | MFS transporter | 0.9052 | 39 | 350 |
GO:0005886
GO:0022857 |
| AF-A0A022MJ67-F1-model_v4 | MFS transporter | 0.8497 | 39 | 350 |
GO:0005886
GO:0022857 |
| AF-A0A526YEJ9-F1-model_v4 | MFS transporter | 0.843 | 85 | 247 |
GO:0005886
GO:0022857 |
| AF-A0A850NK07-F1-model_v4 | MFS transporter | 0.8424 | 31 | 369 |
GO:0005886
GO:0022857 |
| AF-A0A7C7VV03-F1-model_v4 | MFS transporter | 0.8263 | 34 | 208 |
GO:0012505
GO:0016020 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar