F430898

General Info

Members Datasets Scaffolds Average Seq Length
387 306 226 386

Family's Representative Sequence

Representative Sequence 3300044666|Ga0466977_0000010|Ga0466977_0000010_7658_8965
Length 435
Sequence MIFLCAVYFINVRASIFRSSVGRCDLDGVTVPNTRQEFSVPIALYALTAGAFGIGVTEFVIMGLLLNVGADFGVSIAAAGLLISGYALGVVVGAPLMTTATARWPRKTVLLVLMAIFTVGNAACALAPNYAALMAARVLTSFAHGTFFGVGSVVATGLVSRERRASAIAVMFTGLTVANILGVPFGTWLGQHFGWRASFWAVTLIGALALLVIAGFVPKIAAPKDAGDWRADLRALARRPVLLGLLTTVLGWVGVFGVFTYIAPLLIEVTGFPEGAVSPILLIFGGGLVVGNLLGGRLADRRVVPTVLGSLFVLSVVLGLMTFTLHSRWPAIVSVALLGAAAFATVAPLQLWVMEKASGAGESLASSFNIAAFNLGNAIGAWLGGFVIEHGPGLTAVPWVAALVPLAGVGVAVLSLRLDRRDVRSLTPVCENPAS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
5 2512875024 Mesorhizobium loti R88b Isolate Nodule
6 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
9 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
10 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
11 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
12 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
13 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
14 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
15 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
16 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
17 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
18 2643221583 Caulobacter sp. Root655 Isolate Unclassified
19 2643221584 Caulobacter sp. Root656 Isolate Unclassified
20 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
21 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
22 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
23 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
24 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
25 2643221629 Devosia sp. Root105 Isolate Unclassified
26 2643221640 Caulobacter sp. Root342 Isolate Unclassified
27 2643221642 Caulobacter sp. Root343 Isolate Unclassified
28 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
29 2643221662 Devosia sp. Root413D1 Isolate Unclassified
30 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
31 2643221734 Bosea sp. Root670 Isolate Unclassified
32 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
33 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
34 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
35 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
36 2773857925 Microvirga vignae BR3299 Isolate Unclassified
37 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
38 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
39 2818991435 Caulobacter henricii 536 Isolate Unclassified
40 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
41 2818991467 Bosea vestrisii 3192 Isolate Unclassified
42 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
43 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
44 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
45 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
46 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
47 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
48 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
49 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
50 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
51 2849560528 Caulobacter zeae 410 Isolate Unclassified
52 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
53 2851153111 Caulobacter radicis 736 Isolate Unclassified
54 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
55 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
56 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
57 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
58 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
59 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
60 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
61 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
62 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
63 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
64 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
65 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
66 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
67 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
68 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
69 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
70 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
71 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
72 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
73 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
74 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
75 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
76 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
77 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
78 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
79 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
80 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
81 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
82 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
83 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
84 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
85 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
86 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
87 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
88 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
89 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
90 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
91 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
92 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
93 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
94 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
95 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
96 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
97 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
98 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
99 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
100 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
101 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
102 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
103 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
104 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
105 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
106 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
107 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
108 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
109 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
110 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
111 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
112 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
113 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
114 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
115 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
116 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
117 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
118 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
119 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
120 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
121 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
122 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
123 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
124 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
125 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
126 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
127 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
128 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
129 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
130 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
131 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
132 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
133 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
134 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
135 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
136 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
137 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
138 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
139 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
140 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
141 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
142 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
143 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
144 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
145 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
146 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
147 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
148 3004167301 Mesorhizobium loti 582 Isolate Unclassified
149 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
150 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
151 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
152 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
153 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
154 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
155 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
156 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
157 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
158 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
159 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
160 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
161 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
162 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
163 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
164 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
165 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
166 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
167 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
168 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
169 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
170 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
171 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
172 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
173 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
174 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
175 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
176 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
177 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
178 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
179 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
184 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
187 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
188 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
271 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
274 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
275 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
276 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
277 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
280 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
281 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
282 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
286 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
289 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
293 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
294 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
295 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
296 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
297 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
298 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
299 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
300 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
301 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
302 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
303 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
304 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
305 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
306 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.88
Metatranscriptomes 0.52
Isolates 41.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.87
Nodule 27.65
Rhizoplane 2.58
Rhizosphere 26.61
Stem 0
Stem Tuber 0
Unclassified 16.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1005421 3300002741 Bacteria 2083
2 JGI25152J39213_1000787 3300002773 Bacteria 15889
3 JGI25406J46586_10000173 3300003203 Bacteria 28945
4 JGI25153J46596_10002668 3300003215 Bacteria 10190
5 JGI25153J46596_10003324 3300003215 Bacteria 9040
6 rootL2_10000693 3300003322 Bacteria 4503
7 Ga0006562J51391_1127659 3300003578 Bacteria 2701
8 Ga0006562J51391_1127661 3300003578 Bacteria 1890
9 Ga0055539_1000458 3300003752 Bacteria 13740
10 Ga0055533_1000006 3300003756 Bacteria 635559
11 Ga0055525_1000618 3300003759 Bacteria 14724
12 Ga0055529_1000158 3300003763 Bacteria 93023
13 Ga0055526_1002727 3300003771 Bacteria 11738
14 Ga0055526_1017690 3300003771 Bacteria 2708
15 Ga0055536_1001570 3300003781 Bacteria 13668
16 Ga0055528_1005844 3300003790 Bacteria 5650
17 Ga0055530_10002027 3300003791 Bacteria 13694
18 Ga0055540_1027285 3300003792 Bacteria 1368
19 Ga0055531_10013810 3300003794 Bacteria 3696
20 Ga0065165_1000279 3300005262 Bacteria 87186
21 Ga0065165_1007661 3300005262 Bacteria 5243
22 Ga0065707_10081730 3300005295 Bacteria 59162
23 Ga0070671_100034839 3300005355 Bacteria 4169
24 Ga0068861_100008801 3300005719 Bacteria 6953
25 Ga0081539_10000101 3300005985 Bacteria 198612
26 Ga0075365_10011207 3300006038 Bacteria 5264
27 Ga0075369_10004557 3300006186 Bacteria 5132
28 Ga0075369_10009349 3300006186 Bacteria 3806
29 Ga0075369_10062781 3300006186 Bacteria 1624
30 Ga0105240_10072322 3300009093 Bacteria 4262
31 Ga0105247_10183824 3300009101 Bacteria 1396
32 Ga0105248_10260792 3300009177 Bacteria 1951
33 Ga0171462_1007 3300013250 Bacteria 417698
34 Ga0209674_100003 3300025226 Bacteria 2196646
35 Ga0209563_100010 3300025230 Bacteria 1337457
36 Ga0207427_100373 3300025231 Bacteria 27297
37 Ga0209258_100110 3300025242 Bacteria 201322
38 Ga0207425_1000463 3300025245 Bacteria 25992
39 Ga0209026_1000032 3300025250 Bacteria 322378
40 Ga0209677_100142 3300025253 Bacteria 66505
41 Ga0209759_1000500 3300025256 Bacteria 43016
42 Ga0209759_1001395 3300025256 Bacteria 13836
43 Ga0209129_1000122 3300025258 Bacteria 135306
44 Ga0209565_1000183 3300025263 Bacteria 76983
45 Ga0209455_1000104 3300025272 Bacteria 201321
46 Ga0209673_1000848 3300025273 Bacteria 39892
47 Ga0209676_1000253 3300025292 Bacteria 113412
48 Ga0209564_1000446 3300025295 Bacteria 70931
49 Ga0209564_1002119 3300025295 Bacteria 16835
50 Ga0209758_1000091 3300025297 Bacteria 242583
51 Ga0209758_1000350 3300025297 Bacteria 84141
52 Ga0209758_1000846 3300025297 Bacteria 42613
53 Ga0209758_1002223 3300025297 Bacteria 20148
54 Ga0209050_1000507 3300025298 Bacteria 66169
55 Ga0209050_1000649 3300025298 Bacteria 53856
56 Ga0209256_1000694 3300025299 Bacteria 44757
57 Ga0209256_1011322 3300025299 Bacteria 3584
58 Ga0209256_1016998 3300025299 Bacteria 2443
59 Ga0209051_1001019 3300025303 Bacteria 26792
60 Ga0209051_1002693 3300025303 Bacteria 12365
61 Ga0209257_1000036 3300025304 Bacteria 616006
62 Ga0209257_1001428 3300025304 Bacteria 28367
63 Ga0209257_1007938 3300025304 Bacteria 6224
64 Ga0207695_10109934 3300025913 Bacteria 2737
65 Ga0207671_10137438 3300025914 Bacteria 1880
66 Ga0207709_10189592 3300025935 Bacteria 1459
67 Ga0207678_10042813 3300026067 Bacteria 3921
68 Ga0207675_100000691 3300026118 Bacteria 33312
69 Ga0207698_10156473 3300026142 Bacteria 1986
70 Ga0307515_10047989 3300028794 Bacteria 6470
71 Ga0307513_10057011 3300031456 Bacteria 4166
72 Ga0307408_100077926 3300031548 Bacteria 2469
73 Ga0307406_10138684 3300031901 Bacteria 1718
74 Ga0307412_10049631 3300031911 Bacteria 2766
75 Ga0307415_100041395 3300032126 Bacteria 3059
76 Ga0307415_100165972 3300032126 Bacteria 1717
77 Ga0373927_0164947 3300035695 Bacteria 1452
78 Ga0466977_0000010 3300044666 Bacteria 28877
79 Ga0466961_0024345 3300044693 Bacteria 3895
80 Ga0495627_000233 3300046453 Bacteria 58913
81 Ga0495590_0002832 3300046457 Bacteria 7154
82 Ga0495638_0003351 3300046460 Bacteria 12642
83 Ga0495638_0007623 3300046460 Bacteria 7736
84 Ga0495638_0014321 3300046460 Bacteria 5367
85 Ga0495638_0028270 3300046460 Bacteria 3622
86 Ga0495638_0038610 3300046460 Bacteria 3033
87 Ga0495650_0000207 3300046471 Bacteria 127568
88 Ga0495650_0052026 3300046471 Bacteria 1683
89 Ga0495607_0041191 3300046501 Bacteria 2745
90 Ga0495607_0088235 3300046501 Bacteria 1686
91 Ga0495583_0000025 3300046506 Bacteria 263775
92 Ga0495583_0000623 3300046506 Bacteria 47532
93 Ga0495606_0011040 3300046507 Bacteria 7411
94 Ga0495610_0000140 3300046512 Bacteria 80219
95 Ga0495610_0004119 3300046512 Bacteria 10879
96 Ga0495610_0005029 3300046512 Bacteria 9558
97 Ga0495610_0044249 3300046512 Bacteria 2211
98 Ga0495616_0000061 3300046513 Bacteria 97964
99 Ga0495620_0020509 3300046515 Bacteria 3227
100 Ga0495631_0004112 3300046518 Bacteria 7811
101 Ga0495632_0000979 3300046519 Bacteria 24960
102 Ga0495632_0001285 3300046519 Bacteria 21243
103 Ga0495632_0049874 3300046519 Bacteria 2067
104 Ga0495637_0003345 3300046520 Bacteria 8528
105 Ga0495637_0011508 3300046520 Bacteria 4248
106 Ga0495648_0000634 3300046524 Bacteria 37553
107 Ga0495648_0028049 3300046524 Bacteria 3756
108 Ga0495654_0000016 3300046530 Bacteria 306416
109 Ga0495654_0046260 3300046530 Bacteria 2144
110 Ga0495597_0019126 3300046542 Bacteria 3208
111 Ga0495668_0000040 3300046616 Bacteria 230681
112 Ga0495668_0006769 3300046616 Bacteria 7451
113 Ga0495668_0011175 3300046616 Bacteria 5388
114 Ga0495668_0012532 3300046616 Bacteria 5028
115 Ga0495668_0017285 3300046616 Bacteria 4185
116 Ga0495668_0042029 3300046616 Bacteria 2545
117 Ga0495625_0001102 3300046660 Bacteria 35052
118 Ga0495625_0015585 3300046660 Bacteria 6013
119 Ga0495625_0016488 3300046660 Bacteria 5812
120 Ga0495625_0047125 3300046660 Bacteria 3108
121 Ga0495625_0079986 3300046660 Bacteria 2277
122 Ga0495661_0027915 3300046665 Bacteria 3619
123 Ga0495661_0124750 3300046665 Bacteria 1418
124 Ga0495669_0009253 3300046684 Bacteria 4152
125 Ga0495670_0022960 3300046691 Bacteria 3080
126 Ga0495671_0034973 3300046692 Bacteria 2553
127 Ga0495649_0002377 3300046694 Bacteria 13309
128 Ga0495589_0098671 3300046794 Bacteria 1414
129 Ga0495660_0036548 3300046810 Bacteria 2739
130 Ga0495672_0000782 3300047320 Bacteria 34487
131 Ga0495672_0050732 3300047320 Bacteria 2447
132 Ga0495679_003316 3300047446 Bacteria 7786
133 Ga0495673_0000277 3300047469 Bacteria 69419
134 Ga0495673_0000691 3300047469 Bacteria 32984
135 Ga0495681_0053468 3300047470 Bacteria 1890
136 Ga0495686_0004586 3300047472 Bacteria 11280
137 Ga0495686_0007276 3300047472 Bacteria 8322
138 Ga0495686_0018556 3300047472 Bacteria 4665
139 Ga0495686_0021390 3300047472 Bacteria 4296
140 Ga0495686_0037910 3300047472 Bacteria 3086
141 Ga0496101_0133318 3300048904 Bacteria 1888
142 Ga0496104_0243014 3300048907 Bacteria 1712
143 Ga0496106_0019459 3300048909 Bacteria 5036
144 Ga0496107_0001440 3300048910 Bacteria 14715
145 Ga0496108_0013144 3300048911 Bacteria 6748
146 Ga0496112_0057645 3300048915 Bacteria 3824
147 Ga0496112_0100792 3300048915 Bacteria 2857
148 Ga0496113_0127180 3300048916 Bacteria 1996
149 Ga0496114_0086611 3300048917 Bacteria 2655
150 Ga0496115_0007246 3300048918 Bacteria 8150
151 Ga0496117_0110051 3300048920 Bacteria 1718
152 Ga0496118_0070377 3300048921 Bacteria 2526
153 Ga0496120_0026976 3300048923 Bacteria 3540
154 Ga0496121_0001742 3300048924 Bacteria 35564
155 Ga0496121_0003089 3300048924 Bacteria 24095
156 Ga0496121_0005248 3300048924 Bacteria 16759
157 Ga0496121_0011144 3300048924 Bacteria 10026
158 Ga0496122_0020864 3300048925 Bacteria 5892
159 Ga0496122_0027150 3300048925 Bacteria 4904
160 Ga0496123_0032300 3300048926 Bacteria 3793
161 Ga0496124_0037080 3300048927 Bacteria 4244
162 Ga0496125_0040548 3300048928 Bacteria 3993
163 Ga0496126_0010364 3300048929 Bacteria 9784
164 Ga0496126_0098241 3300048929 Bacteria 2565
165 Ga0496126_0198593 3300048929 Bacteria 1695
166 Ga0495678_000699 3300049459 Bacteria 30520
167 Ga0501037_0033466 3300049573 Bacteria 3796
168 Ga0501048_0002122 3300049582 Bacteria 15118
169 Ga0501238_002860 3300049671 Bacteria 2096
170 nmdc:mga0yw44_16757_c1 3300050492 Bacteria 3968
171 nmdc:mga0yw44_175473_c1 3300050492 Bacteria 1409
172 nmdc:mga0sz30_37340_c1 3300050516 Bacteria 2033
173 Ga0500635_0000153 3300053080 Bacteria 38580
174 Ga0500578_0000013 3300053086 Bacteria 185921
175 Ga0500578_0000166 3300053086 Bacteria 78688
176 Ga0500643_033016 3300053087 Bacteria 1567
177 Ga0500644_0000269 3300053088 Bacteria 29380
178 Ga0500644_0013048 3300053088 Bacteria 2312
179 Ga0500644_0030613 3300053088 Bacteria 1704
180 Ga0500644_0034883 3300053088 Bacteria 1626
181 Ga0500581_025224 3300053089 Bacteria 3022
182 Ga0500651_0171997 3300053093 Bacteria 1291
183 Ga0500566_0000157 3300053094 Bacteria 34534
184 Ga0500641_0006452 3300053096 Bacteria 4162
185 Ga0500641_0019038 3300053096 Bacteria 2591
186 Ga0500650_0001493 3300053098 Bacteria 7107
187 Ga0500556_0000413 3300053104 Bacteria 31142
188 Ga0500556_0001013 3300053104 Bacteria 14773
189 Ga0500594_0000312 3300053118 Bacteria 10863
190 Ga0500594_0016870 3300053118 Bacteria 1780
191 Ga0500594_0035763 3300053118 Bacteria 1334
192 Ga0500595_003935 3300053119 Bacteria 6804
193 Ga0500607_121097 3300053121 Bacteria 1265
194 Ga0500608_000348 3300053122 Bacteria 17856
195 Ga0500608_000629 3300053122 Bacteria 12952
196 Ga0500608_040932 3300053122 Bacteria 2221
197 Ga0500618_000022 3300053125 Bacteria 157907
198 Ga0500618_016639 3300053125 Bacteria 1838
199 Ga0500652_000291 3300053131 Bacteria 18359
200 Ga0500652_000531 3300053131 Bacteria 13423
201 Ga0500658_0004847 3300053134 Bacteria 5018
202 Ga0500559_0000927 3300053136 Bacteria 18564
203 Ga0500559_0002089 3300053136 Bacteria 10664
204 Ga0500559_0010808 3300053136 Bacteria 3914
205 Ga0500564_000357 3300053138 Bacteria 12863
206 Ga0500568_0002109 3300053139 Bacteria 12007
207 Ga0500568_0004073 3300053139 Bacteria 7914
208 Ga0500568_0053490 3300053139 Bacteria 1582
209 Ga0500577_0001207 3300053142 Bacteria 6607
210 Ga0500590_064980 3300053148 Bacteria 1826
211 Ga0500604_0012442 3300053151 Bacteria 2297
212 Ga0500616_0000180 3300053153 Bacteria 106053
213 Ga0500616_0004549 3300053153 Bacteria 9820
214 Ga0500616_0057812 3300053153 Bacteria 2020
215 Ga0500622_0000469 3300053156 Bacteria 38108
216 Ga0500622_0000525 3300053156 Bacteria 35545
217 Ga0500622_0002946 3300053156 Bacteria 11813
218 Ga0500622_0003749 3300053156 Bacteria 9930
219 Ga0500622_0013310 3300053156 Bacteria 4438
220 Ga0500622_0048392 3300053156 Bacteria 2193
221 Ga0500622_0073566 3300053156 Bacteria 1723
222 Ga0500627_0049186 3300053158 Bacteria 1833
223 Ga0500634_0071692 3300053161 Bacteria 1811
224 Ga0500637_0059397 3300053178 Bacteria 2189
225 Ga0500567_076561 3300053723 Bacteria 1455
226 Ga0500609_001466 3300053731 Bacteria 3446

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025935 Ga0207709_10189592 Ga0207709_101895921 323
2 3300046512 Ga0495610_0004119 Ga0495610_0004119_590_1750 325
3 3300046660 Ga0495625_0079986 Ga0495625_0079986_516_1703 325
4 3300049459 Ga0495678_000699 Ga0495678_000699_1842_3002 325
5 3300053118 Ga0500594_0000312 Ga0500594_0000312_466_1626 325
6 3300053087 Ga0500643_033016 Ga0500643_033016_60_1220 326
7 3300053088 Ga0500644_0000269 Ga0500644_0000269_6414_7574 326
8 3300053138 Ga0500564_000357 Ga0500564_000357_6732_7892 326
9 3300028794 Ga0307515_10047989 Ga0307515_100479896 327
10 3300053086 Ga0500578_0000166 Ga0500578_0000166_3757_4917 327
11 3300053121 Ga0500607_121097 Ga0500607_121097_12_1184 330
12 3300003792 Ga0055540_1027285 Ga0055540_10272851 331
13 3300025303 Ga0209051_1001019 Ga0209051_10010192 331
14 3300046453 Ga0495627_000233 Ga0495627_000233_25728_26891 331
15 3300047472 Ga0495686_0007276 Ga0495686_0007276_5077_6246 331
16 3300053118 Ga0500594_0035763 Ga0500594_0035763_48_1229 336
17 3300046519 Ga0495632_0000979 Ga0495632_0000979_16896_18080 337
18 3300053131 Ga0500652_000291 Ga0500652_000291_1639_2823 337
19 3300053139 Ga0500568_0004073 Ga0500568_0004073_3388_4572 337
20 3300053151 Ga0500604_0012442 Ga0500604_0012442_134_1318 337
21 3300053156 Ga0500622_0000525 Ga0500622_0000525_3997_5181 337
22 3300031456 Ga0307513_10057011 Ga0307513_100570114 338
23 3300031901 Ga0307406_10138684 Ga0307406_101386842 339
24 3300032126 Ga0307415_100041395 Ga0307415_1000413954 339
25 3300048924 Ga0496121_0005248 Ga0496121_0005248_4316_5506 340
26 3300025299 Ga0209256_1016998 Ga0209256_10169982 341
27 3300046501 Ga0495607_0041191 Ga0495607_0041191_284_1441 341
28 3300006038 Ga0075365_10011207 Ga0075365_100112075 342
29 3300006186 Ga0075369_10009349 Ga0075369_100093492 342
30 3300050492 nmdc:mga0yw44_175473_c1 nmdc:mga0yw44_175473_c1_180_1361 342
31 3300050516 nmdc:mga0sz30_37340_c1 nmdc:mga0sz30_37340_c1_171_1352 342
32 3300053086 Ga0500578_0000013 Ga0500578_0000013_76149_77333 342
33 3300025231 Ga0207427_100373 Ga0207427_10037318 343
34 3300025913 Ga0207695_10109934 Ga0207695_101099342 343
35 3300031548 Ga0307408_100077926 Ga0307408_1000779262 343
36 3300031911 Ga0307412_10049631 Ga0307412_100496312 343
37 iso_pu_bacteria 8045864390 8045869078 343
38 3300003771 Ga0055526_1017690 Ga0055526_10176903 345
39 3300005262 Ga0065165_1000279 Ga0065165_10002799 345
40 3300025295 Ga0209564_1000446 Ga0209564_100044629 345
41 3300046506 Ga0495583_0000025 Ga0495583_0000025_209132_210295 345
42 3300049671 Ga0501238_002860 Ga0501238_002860_462_1631 346
43 3300053122 Ga0500608_000629 Ga0500608_000629_10728_11900 346
44 iso_pu_bacteria 2961127735 2961133522 346
45 3300025297 Ga0209758_1000846 Ga0209758_100084621 347
46 3300046457 Ga0495590_0002832 Ga0495590_0002832_2446_3606 347
47 3300046460 Ga0495638_0038610 Ga0495638_0038610_396_1559 347
48 3300046507 Ga0495606_0011040 Ga0495606_0011040_447_1616 347
49 3300046512 Ga0495610_0005029 Ga0495610_0005029_2921_4084 347
50 3300046518 Ga0495631_0004112 Ga0495631_0004112_77_1237 347
51 3300046520 Ga0495637_0011508 Ga0495637_0011508_2977_4137 347
52 3300046524 Ga0495648_0000634 Ga0495648_0000634_36240_37400 347
53 3300046524 Ga0495648_0028049 Ga0495648_0028049_1549_2718 347
54 3300046530 Ga0495654_0000016 Ga0495654_0000016_261729_262898 347
55 3300046616 Ga0495668_0006769 Ga0495668_0006769_4720_5880 347
56 3300047469 Ga0495673_0000277 Ga0495673_0000277_38065_39228 347
57 3300047472 Ga0495686_0004586 Ga0495686_0004586_3314_4477 347
58 3300047472 Ga0495686_0018556 Ga0495686_0018556_2404_3564 347
59 3300048909 Ga0496106_0019459 Ga0496106_0019459_2788_3957 347
60 3300048910 Ga0496107_0001440 Ga0496107_0001440_12336_13505 347
61 3300048920 Ga0496117_0110051 Ga0496117_0110051_439_1611 347
62 3300048921 Ga0496118_0070377 Ga0496118_0070377_1130_2302 347
63 3300048924 Ga0496121_0011144 Ga0496121_0011144_7688_8857 347
64 3300053104 Ga0500556_0001013 Ga0500556_0001013_1143_2312 347
65 3300053142 Ga0500577_0001207 Ga0500577_0001207_883_2046 347
66 3300053156 Ga0500622_0002946 Ga0500622_0002946_2216_3376 347
67 iso_pu_bacteria 2582581279 2585148181 347
68 iso_pu_bacteria 2643221583 2643926898 347
69 iso_pu_bacteria 2818991435 2819537655 347
70 iso_pu_bacteria 2818991454 2819647432 347
71 3300003790 Ga0055528_1005844 Ga0055528_10058443 348
72 3300005262 Ga0065165_1007661 Ga0065165_10076615 348
73 3300025263 Ga0209565_1000183 Ga0209565_100018355 348
74 3300025273 Ga0209673_1000848 Ga0209673_100084811 348
75 3300025297 Ga0209758_1002223 Ga0209758_10022235 348
76 3300025298 Ga0209050_1000507 Ga0209050_100050744 348
77 3300025299 Ga0209256_1011322 Ga0209256_10113221 348
78 3300046460 Ga0495638_0003351 Ga0495638_0003351_9720_10889 348
79 3300046501 Ga0495607_0088235 Ga0495607_0088235_63_1232 348
80 3300046513 Ga0495616_0000061 Ga0495616_0000061_29189_30358 348
81 3300046519 Ga0495632_0001285 Ga0495632_0001285_18524_19693 348
82 3300046519 Ga0495632_0049874 Ga0495632_0049874_167_1336 348
83 3300046616 Ga0495668_0011175 Ga0495668_0011175_980_2149 348
84 3300046660 Ga0495625_0001102 Ga0495625_0001102_25985_27148 348
85 3300053723 Ga0500567_076561 Ga0500567_076561_237_1409 348
86 3300053731 Ga0500609_001466 Ga0500609_001466_1089_2258 348
87 iso_pu_bacteria 2510917020 2511123856 348
88 iso_pu_bacteria 2643221598 2644001813 348
89 iso_pu_bacteria 2643221629 2644167146 348
90 iso_pu_bacteria 2857504554 2857506103 348
91 3300047469 Ga0495673_0000691 Ga0495673_0000691_21044_22213 349
92 3300047470 Ga0495681_0053468 Ga0495681_0053468_115_1284 349
93 iso_pu_bacteria 2523231067 2523466494 349
94 iso_pu_bacteria 2582581280 2585154585 349
95 iso_pu_bacteria 2582581293 2585198523 349
96 iso_pu_bacteria 2585428106 2587917087 349
97 iso_pu_bacteria 2643221545 2643750439 349
98 iso_pu_bacteria 2643221584 2643929659 349
99 iso_pu_bacteria 2643221640 2644223708 349
100 iso_pu_bacteria 2643221642 2644236204 349
101 iso_pu_bacteria 2643221662 2644349662 349
102 iso_pu_bacteria 2643221691 2644507329 349
103 iso_pu_bacteria 2738543031 2739351370 349
104 iso_pu_bacteria 2791355048 2792461750 349
105 iso_pu_bacteria 2818991467 2819720467 349
106 iso_pu_bacteria 2842775625 2842779126 349
107 iso_pu_bacteria 2843744320 2843745888 349
108 iso_pu_bacteria 2849560528 2849562200 349
109 iso_pu_bacteria 2849573788 2849574565 349
110 iso_pu_bacteria 2851153111 2851156939 349
111 iso_pu_bacteria 2857524615 2857529965 349
112 iso_pu_bacteria 2884960567 2884963480 349
113 iso_pu_bacteria 2893066018 2893069392 349
114 iso_pu_bacteria 2898329390 2898330302 349
115 iso_pu_bacteria 2919073203 2919077182 349
116 iso_pu_bacteria 2928531327 2928534597 349
117 3300025304 Ga0209257_1000036 Ga0209257_100003657 350
118 3300046616 Ga0495668_0012532 Ga0495668_0012532_2792_3961 350
119 3300048915 Ga0496112_0100792 Ga0496112_0100792_1641_2819 350
120 3300048924 Ga0496121_0003089 Ga0496121_0003089_15581_16822 350
121 3300053094 Ga0500566_0000157 Ga0500566_0000157_5155_6327 350
122 3300053119 Ga0500595_003935 Ga0500595_003935_1001_2242 350
123 3300053122 Ga0500608_000348 Ga0500608_000348_10323_11486 350
124 3300053122 Ga0500608_040932 Ga0500608_040932_422_1594 350
125 3300053125 Ga0500618_016639 Ga0500618_016639_283_1455 350
126 3300053136 Ga0500559_0002089 Ga0500559_0002089_7554_8726 350
127 3300053139 Ga0500568_0053490 Ga0500568_0053490_275_1516 350
128 3300053156 Ga0500622_0003749 Ga0500622_0003749_1202_2419 350
129 3300053178 Ga0500637_0059397 Ga0500637_0059397_1005_2177 350
130 iso_pu_bacteria 2513237087 2513591233 350
131 iso_pu_bacteria 2739367756 2739790523 350
132 iso_pu_bacteria 2773857925 2774869294 350
133 iso_pu_bacteria 2841911363 2841916444 350
134 iso_pu_bacteria 2841917233 2841922341 350
135 3300025299 Ga0209256_1000694 Ga0209256_100069430 351
136 3300046471 Ga0495650_0000207 Ga0495650_0000207_43153_44322 351
137 3300046506 Ga0495583_0000623 Ga0495583_0000623_11693_12883 351
138 3300046512 Ga0495610_0000140 Ga0495610_0000140_5751_6920 351
139 3300046520 Ga0495637_0003345 Ga0495637_0003345_1414_2583 351
140 3300046542 Ga0495597_0019126 Ga0495597_0019126_1317_2486 351
141 3300046660 Ga0495625_0047125 Ga0495625_0047125_1637_2806 351
142 3300048927 Ga0496124_0037080 Ga0496124_0037080_542_1708 351
143 3300049573 Ga0501037_0033466 Ga0501037_0033466_2107_3276 351
144 iso_pu_bacteria 2508501127 2509144259 351
145 iso_pu_bacteria 2597489875 2597811746 351
146 iso_pu_bacteria 2643221734 2644736399 351
147 iso_pu_bacteria 2869162929 2869165927 351
148 iso_pu_bacteria 2874123672 2874130221 351
149 iso_pu_bacteria 2888343758 2888344872 351
150 iso_pu_bacteria 2917699015 2917702423 351
151 iso_pu_bacteria 2924754689 2924761612 351
152 iso_pu_bacteria 2970540015 2970545691 351
153 3300003322 rootL2_10000693 rootL2_100006932 352
154 3300003781 Ga0055536_1001570 Ga0055536_10015703 352
155 3300003791 Ga0055530_10002027 Ga0055530_100020273 352
156 3300025292 Ga0209676_1000253 Ga0209676_100025314 352
157 3300025298 Ga0209050_1000649 Ga0209050_100064919 352
158 3300025303 Ga0209051_1002693 Ga0209051_10026932 352
159 3300025304 Ga0209257_1007938 Ga0209257_10079383 352
160 3300046660 Ga0495625_0015585 Ga0495625_0015585_3656_4825 352
161 3300047320 Ga0495672_0000782 Ga0495672_0000782_19287_20456 352
162 3300053153 Ga0500616_0004549 Ga0500616_0004549_6633_7805 352
163 iso_pu_bacteria 2510065059 2510318167 352
164 iso_pu_bacteria 2512875024 2512961521 352
165 iso_pu_bacteria 2513237164 2514036806 352
166 iso_pu_bacteria 2643221595 2643988349 352
167 iso_pu_bacteria 2643221627 2644154734 352
168 iso_pu_bacteria 2687453392 2688596484 352
169 iso_pu_bacteria 2756170246 2756673870 352
170 iso_pu_bacteria 2841734538 2841736904 352
171 iso_pu_bacteria 2844002411 2844002951 352
172 iso_pu_bacteria 2844009547 2844011309 352
173 iso_pu_bacteria 2856334872 2856337746 352
174 iso_pu_bacteria 2856342000 2856345303 352
175 iso_pu_bacteria 2856349417 2856355558 352
176 iso_pu_bacteria 2857367948 2857375192 352
177 iso_pu_bacteria 2869169390 2869176332 352
178 iso_pu_bacteria 2869242130 2869244578 352
179 iso_pu_bacteria 2869249662 2869254034 352
180 iso_pu_bacteria 2869256925 2869257216 352
181 iso_pu_bacteria 2869264136 2869266375 352
182 iso_pu_bacteria 2871435913 2871438133 352
183 iso_pu_bacteria 2871451962 2871457275 352
184 iso_pu_bacteria 2871459585 2871461040 352
185 iso_pu_bacteria 2871466892 2871471183 352
186 iso_pu_bacteria 2871474448 2871477100 352
187 iso_pu_bacteria 2871481445 2871484257 352
188 iso_pu_bacteria 2871488783 2871494774 352
189 iso_pu_bacteria 2874116593 2874121406 352
190 iso_pu_bacteria 2874168670 2874176677 352
191 iso_pu_bacteria 2876386047 2876390139 352
192 iso_pu_bacteria 2876420981 2876422025 352
193 iso_pu_bacteria 2878753008 2878759908 352
194 iso_pu_bacteria 2878788777 2878788900 352
195 iso_pu_bacteria 2881155292 2881159765 352
196 iso_pu_bacteria 2885312484 2885313637 352
197 iso_pu_bacteria 2885342637 2885348544 352
198 iso_pu_bacteria 2885350715 2885352524 352
199 iso_pu_bacteria 2889914905 2889917321 352
200 iso_pu_bacteria 2903492973 2903494132 352
201 iso_pu_bacteria 2906363423 2906367543 352
202 iso_pu_bacteria 2906370794 2906377744 352
203 iso_pu_bacteria 2906378014 2906379109 352
204 iso_pu_bacteria 2906393657 2906395374 352
205 iso_pu_bacteria 2906401398 2906404726 352
206 iso_pu_bacteria 2906427513 2906433069 352
207 iso_pu_bacteria 2924733363 2924734446 352
208 iso_pu_bacteria 2924741084 2924746031 352
209 iso_pu_bacteria 2937861824 2937866269 352
210 iso_pu_bacteria 2937980651 2937982939 352
211 iso_pu_bacteria 2958071322 2958073180 352
212 iso_pu_bacteria 2958108152 2958112862 352
213 iso_pu_bacteria 2958122699 2958124392 352
214 iso_pu_bacteria 2961183825 2961189293 352
215 iso_pu_bacteria 2965032056 2965039253 352
216 iso_pu_bacteria 2965040258 2965044727 352
217 iso_pu_bacteria 2965089291 2965090759 352
218 iso_pu_bacteria 2968138860 2968144328 352
219 iso_pu_bacteria 2970510686 2970512206 352
220 iso_pu_bacteria 2970524798 2970526596 352
221 iso_pu_bacteria 2970532167 2970534585 352
222 iso_pu_bacteria 2970619444 2970622272 352
223 iso_pu_bacteria 2970627176 2970628528 352
224 iso_pu_bacteria 2977851361 2977852248 352
225 iso_pu_bacteria 2977864932 2977871457 352
226 iso_pu_bacteria 2977872689 2977873925 352
227 iso_pu_bacteria 2977907340 2977912165 352
228 iso_pu_bacteria 2977915119 2977922676 352
229 iso_pu_bacteria 2977950692 2977957321 352
230 iso_pu_bacteria 2977957713 2977962347 352
231 iso_pu_bacteria 2979764755 2979766272 352
232 iso_pu_bacteria 2979772303 2979774947 352
233 iso_pu_bacteria 2996386984 2996387737 352
234 iso_pu_bacteria 3004195979 3004200953 352
235 iso_pu_bacteria 3004239961 3004243098 352
236 iso_pu_bacteria 3004268573 3004269058 352
237 iso_pu_bacteria 649633066 649871035 352
238 iso_pu_bacteria 8004312739 8004320345 352
239 iso_pu_bacteria 8004361976 8004365464 352
240 iso_pu_bacteria 8004633249 8004639646 352
241 iso_pu_bacteria 8004695233 8004702228 352
242 iso_pu_bacteria 8004727605 8004727908 352
243 3300003578 Ga0006562J51391_1127659 Ga0006562J51391_11276592 353
244 3300003578 Ga0006562J51391_1127661 Ga0006562J51391_11276611 353
245 3300006186 Ga0075369_10004557 Ga0075369_100045574 353
246 3300009093 Ga0105240_10072322 Ga0105240_100723222 353
247 3300026067 Ga0207678_10042813 Ga0207678_100428132 353
248 3300026142 Ga0207698_10156473 Ga0207698_101564732 353
249 3300044693 Ga0466961_0024345 Ga0466961_0024345_2195_3388 353
250 3300046460 Ga0495638_0014321 Ga0495638_0014321_2242_3414 353
251 3300046471 Ga0495650_0052026 Ga0495650_0052026_168_1343 353
252 3300046512 Ga0495610_0044249 Ga0495610_0044249_781_1953 353
253 3300046515 Ga0495620_0020509 Ga0495620_0020509_394_1566 353
254 3300046530 Ga0495654_0046260 Ga0495654_0046260_769_1941 353
255 3300046616 Ga0495668_0000040 Ga0495668_0000040_7454_8620 353
256 3300046616 Ga0495668_0042029 Ga0495668_0042029_21_1193 353
257 3300046665 Ga0495661_0027915 Ga0495661_0027915_1117_2289 353
258 3300046665 Ga0495661_0124750 Ga0495661_0124750_189_1361 353
259 3300046691 Ga0495670_0022960 Ga0495670_0022960_1090_2262 353
260 3300046692 Ga0495671_0034973 Ga0495671_0034973_257_1429 353
261 3300046810 Ga0495660_0036548 Ga0495660_0036548_840_2012 353
262 3300047472 Ga0495686_0021390 Ga0495686_0021390_1762_2934 353
263 3300047472 Ga0495686_0037910 Ga0495686_0037910_1164_2330 353
264 3300048917 Ga0496114_0086611 Ga0496114_0086611_623_1801 353
265 3300048923 Ga0496120_0026976 Ga0496120_0026976_1506_2678 353
266 3300048924 Ga0496121_0001742 Ga0496121_0001742_14404_15576 353
267 3300048925 Ga0496122_0020864 Ga0496122_0020864_4325_5494 353
268 3300048925 Ga0496122_0027150 Ga0496122_0027150_404_1573 353
269 3300048926 Ga0496123_0032300 Ga0496123_0032300_2104_3276 353
270 3300048929 Ga0496126_0098241 Ga0496126_0098241_1089_2261 353
271 3300050492 nmdc:mga0yw44_16757_c1 nmdc:mga0yw44_16757_c1_15_1187 353
272 3300053080 Ga0500635_0000153 Ga0500635_0000153_22759_23928 353
273 3300053088 Ga0500644_0030613 Ga0500644_0030613_21_1193 353
274 3300053088 Ga0500644_0034883 Ga0500644_0034883_11_1183 353
275 3300053089 Ga0500581_025224 Ga0500581_025224_1024_2196 353
276 3300053096 Ga0500641_0006452 Ga0500641_0006452_419_1591 353
277 3300053098 Ga0500650_0001493 Ga0500650_0001493_4480_5652 353
278 3300053104 Ga0500556_0000413 Ga0500556_0000413_1755_2927 353
279 3300053118 Ga0500594_0016870 Ga0500594_0016870_491_1663 353
280 3300053131 Ga0500652_000531 Ga0500652_000531_4606_5778 353
281 3300053134 Ga0500658_0004847 Ga0500658_0004847_3521_4693 353
282 3300053136 Ga0500559_0010808 Ga0500559_0010808_2419_3588 353
283 3300053139 Ga0500568_0002109 Ga0500568_0002109_6272_7444 353
284 3300053148 Ga0500590_064980 Ga0500590_064980_102_1274 353
285 3300053153 Ga0500616_0000180 Ga0500616_0000180_76608_77780 353
286 3300053153 Ga0500616_0057812 Ga0500616_0057812_252_1421 353
287 3300053156 Ga0500622_0013310 Ga0500622_0013310_2704_3870 353
288 3300053156 Ga0500622_0073566 Ga0500622_0073566_118_1287 353
289 3300053158 Ga0500627_0049186 Ga0500627_0049186_296_1468 353
290 3300053161 Ga0500634_0071692 Ga0500634_0071692_378_1550 353
291 iso_pu_bacteria 2585428057 2587729706 353
292 iso_pu_bacteria 2585428058 2587734155 353
293 iso_pu_bacteria 2588253510 2588293427 353
294 iso_pu_bacteria 2828305725 2828307936 353
295 iso_pu_bacteria 2844533157 2844539047 353
296 iso_pu_bacteria 8055617313 8055618426 353
297 3300032126 Ga0307415_100165972 Ga0307415_1001659722 354
298 3300046460 Ga0495638_0028270 Ga0495638_0028270_62_1237 354
299 3300047320 Ga0495672_0050732 Ga0495672_0050732_371_1546 354
300 3300053088 Ga0500644_0013048 Ga0500644_0013048_871_2046 354
301 3300053156 Ga0500622_0000469 Ga0500622_0000469_33285_34460 354
302 iso_pu_bacteria 2643221592 2643970143 354
303 iso_pu_bacteria 2643221625 2644141190 354
304 iso_pu_bacteria 2643221648 2644274197 354
305 3300003203 JGI25406J46586_10000173 JGI25406J46586_1000017325 355
306 3300003794 Ga0055531_10013810 Ga0055531_100138102 355
307 3300005295 Ga0065707_10081730 Ga0065707_1008173021 355
308 3300005719 Ga0068861_100008801 Ga0068861_1000088014 355
309 3300005985 Ga0081539_10000101 Ga0081539_1000010178 355
310 3300013250 Ga0171462_1007 Ga0171462_1007186 355
311 3300025304 Ga0209257_1001428 Ga0209257_10014282 355
312 3300026118 Ga0207675_100000691 Ga0207675_10000069124 355
313 3300049582 Ga0501048_0002122 Ga0501048_0002122_6892_8085 355
314 3300053093 Ga0500651_0171997 Ga0500651_0171997_61_1248 355
315 3300053156 Ga0500622_0048392 Ga0500622_0048392_594_1787 355
316 3300002773 JGI25152J39213_1000787 JGI25152J39213_100078714 356
317 3300003215 JGI25153J46596_10002668 JGI25153J46596_1000266811 356
318 3300003752 Ga0055539_1000458 Ga0055539_100045816 356
319 3300003756 Ga0055533_1000006 Ga0055533_1000006550 356
320 3300003759 Ga0055525_1000618 Ga0055525_10006185 356
321 3300003771 Ga0055526_1002727 Ga0055526_100272711 356
322 3300009101 Ga0105247_10183824 Ga0105247_101838241 356
323 3300025226 Ga0209674_100003 Ga0209674_100003783 356
324 3300025230 Ga0209563_100010 Ga0209563_100010513 356
325 3300025245 Ga0207425_1000463 Ga0207425_100046312 356
326 3300025253 Ga0209677_100142 Ga0209677_10014260 356
327 3300025258 Ga0209129_1000122 Ga0209129_100012271 356
328 3300025295 Ga0209564_1002119 Ga0209564_10021196 356
329 3300025297 Ga0209758_1000091 Ga0209758_100009137 356
330 3300025914 Ga0207671_10137438 Ga0207671_101374382 356
331 3300048915 Ga0496112_0057645 Ga0496112_0057645_97_1278 356
332 3300003215 JGI25153J46596_10003324 JGI25153J46596_100033247 357
333 3300006186 Ga0075369_10062781 Ga0075369_100627812 357
334 3300025297 Ga0209758_1000350 Ga0209758_100035025 357
335 3300048928 Ga0496125_0040548 Ga0496125_0040548_1632_2813 357
336 3300048929 Ga0496126_0010364 Ga0496126_0010364_1308_2489 357
337 3300003763 Ga0055529_1000158 Ga0055529_100015811 358
338 3300025242 Ga0209258_100110 Ga0209258_100110105 358
339 3300025256 Ga0209759_1001395 Ga0209759_10013954 358
340 3300025272 Ga0209455_1000104 Ga0209455_1000104105 358
341 3300046460 Ga0495638_0007623 Ga0495638_0007623_2074_3288 358
342 3300053096 Ga0500641_0019038 Ga0500641_0019038_946_2160 358
343 3300025250 Ga0209026_1000032 Ga0209026_1000032232 360
344 3300025256 Ga0209759_1000500 Ga0209759_100050029 360
345 3300035695 Ga0373927_0164947 Ga0373927_0164947_38_1228 360
346 3300046616 Ga0495668_0017285 Ga0495668_0017285_2356_3546 360
347 3300046660 Ga0495625_0016488 Ga0495625_0016488_2857_4047 360
348 3300046684 Ga0495669_0009253 Ga0495669_0009253_616_1806 360
349 3300046694 Ga0495649_0002377 Ga0495649_0002377_4841_6031 360
350 3300046794 Ga0495589_0098671 Ga0495589_0098671_153_1343 360
351 3300047446 Ga0495679_003316 Ga0495679_003316_2907_4115 362
352 3300053125 Ga0500618_000022 Ga0500618_000022_64920_66128 362
353 3300048929 Ga0496126_0198593 Ga0496126_0198593_211_1413 363
354 iso_pu_bacteria 2856356410 2856357197 363
355 iso_pu_bacteria 2881845957 2881850677 363
356 iso_pu_bacteria 2881861095 2881862180 363
357 iso_pu_bacteria 2885318864 2885322697 363
358 iso_pu_bacteria 2924784321 2924790711 363
359 iso_pu_bacteria 2961170736 2961177180 363
360 iso_pu_bacteria 2967996073 2968002270 363
361 iso_pu_bacteria 2968003550 2968009504 363
362 iso_pu_bacteria 2970503327 2970509854 363
363 iso_pu_bacteria 2977821940 2977828430 363
364 iso_pu_bacteria 2979808191 2979814730 363
365 iso_pu_bacteria 8004374579 8004381406 363
366 3300005355 Ga0070671_100034839 Ga0070671_1000348392 365
367 3300009177 Ga0105248_10260792 Ga0105248_102607922 365
368 3300048911 Ga0496108_0013144 Ga0496108_0013144_2113_3336 365
369 3300048916 Ga0496113_0127180 Ga0496113_0127180_260_1483 365
370 iso_pu_bacteria 2503198000 2503199201 365
371 iso_pu_bacteria 2791355123 2792747741 365
372 iso_pu_bacteria 2878781027 2878783837 365
373 iso_pu_bacteria 2894414249 2894414610 365
374 iso_pu_bacteria 2922151315 2922154097 365
375 iso_pu_bacteria 2924710171 2924712109 365
376 iso_pu_bacteria 2965110997 2965115770 365
377 iso_pu_bacteria 2970489779 2970493618 365
378 iso_pu_bacteria 2979793036 2979797764 365
379 iso_pu_bacteria 3004167301 3004173821 365
380 3300053136 Ga0500559_0000927 Ga0500559_0000927_12574_13815 366
381 iso_pu_bacteria 8004395343 8004397120 366
382 iso_pu_bacteria 2937836603 2937841246 367
383 3300048918 Ga0496115_0007246 Ga0496115_0007246_1566_2810 368
384 3300048904 Ga0496101_0133318 Ga0496101_0133318_317_1597 384
385 3300048907 Ga0496104_0243014 Ga0496104_0243014_396_1676 384
386 3300044666 Ga0466977_0000010 Ga0466977_0000010_7658_8965 387
387 3300002741 JGI25157J39369_1005421 JGI25157J39369_10054212 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

47

364

0.83

PF06779

MFS_4

Uncharacterised MFS-type transporter YbfB

50

413

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnh-assembly1.cif.gz_A cryo-em structure of human oatp1b1 in complex with simeprevir 0.7563 38 370
3wdo-assembly1.cif.gz_A structure of e. coli yajr transporter 0.7501 36 383
6lz0-assembly1.cif.gz_A cryo-em structure of human mct1 in complex with basigin-2 in the presence of lactate 0.7382 44 370
6hcl-assembly1.cif.gz_A crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.7377 36 384
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.7339 40 384
ID Description Score Start End Superfamily
af_P77389_5_379_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8708 42 384 1.20.1250.20
af_Q8MP22_1_169_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8566 74 200 1.20.1250.20
af_O74395_360_528_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.845 221 370 1.20.1250.20
af_P39980_322_516_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8381 221 371 1.20.1250.20
af_P9WJW9_258_425_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8373 223 373 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A022MJ67-F1-model_v4 MFS transporter 0.9052 39 350 GO:0005886
GO:0022857
AF-A0A022MJ67-F1-model_v4 MFS transporter 0.8497 39 350 GO:0005886
GO:0022857
AF-A0A526YEJ9-F1-model_v4 MFS transporter 0.843 85 247 GO:0005886
GO:0022857
AF-A0A850NK07-F1-model_v4 MFS transporter 0.8424 31 369 GO:0005886
GO:0022857
AF-A0A7C7VV03-F1-model_v4 MFS transporter 0.8263 34 208 GO:0012505
GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
71.93 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map