F430985

General Info

Members Datasets Scaffolds Average Seq Length
387 299 774 138

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|643692032|643824218
Length 165
Sequence SRCRSRRSPARACGRFAPWHCKLRGTTLAAALEGILETALYADDLDAAEAFYGNVLGLARITRVGNRHVFFRCGDGVLLIFNAAETVKPPAAGALPVPSHGTQGKGHMCFRVGAPALEAWKAKLEAAGVAIEADIRWPNGARSFYFRDPAGNSLECAEPGLWDID

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
70 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
71 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
216 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
217 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
222 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
223 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
224 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
225 2516143018 Ensifer sp. BR816 Isolate Nodule
226 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
227 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
228 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
229 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
230 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
231 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
232 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
233 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
234 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
235 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
236 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
237 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
238 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
239 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
240 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
241 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
242 2643221557 Ensifer sp. Root558 Isolate Unclassified
243 2643221610 Ensifer sp. Root74 Isolate Unclassified
244 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
245 2643221668 Ensifer sp. Root423 Isolate Unclassified
246 2643221675 Ensifer sp. Root1298 Isolate Unclassified
247 2643221680 Ensifer sp. Root1312 Isolate Unclassified
248 2643221688 Rhizobium sp. Root482 Isolate Unclassified
249 2643221718 Rhizobium sp. Root268 Isolate Unclassified
250 2643221723 Ensifer sp. Root278 Isolate Unclassified
251 2643221726 Ensifer sp. Root954 Isolate Unclassified
252 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
253 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
254 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
255 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
256 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
257 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
258 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
259 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
260 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
261 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
262 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
263 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
264 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
265 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
266 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
267 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
268 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
269 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
270 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
271 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
272 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
273 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
274 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
275 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
276 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
277 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
278 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
279 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
280 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
281 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
282 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
283 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
284 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
285 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
286 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
287 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
288 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
289 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
290 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
291 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
292 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
293 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
294 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
295 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
296 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
297 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
298 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
299 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.33
Metatranscriptomes 0.26
Isolates 20.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.38
Nodule 5.94
Rhizoplane 1.81
Rhizosphere 52.97
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000013 3300002704 Bacteria 198215
2 JGI25156J39149_1000011 3300002705 Bacteria 198215
3 JGI25162J39368_1000501 3300002737 Bacteria 29578
4 JGI25162J39368_1000723 3300002737 Bacteria 22734
5 JGI25154J39366_1000030 3300002738 Bacteria 191444
6 JGI25158J39367_1010649 3300002739 Bacteria 1239
7 JGI25157J39369_1000013 3300002741 Bacteria 198211
8 JGI25159J45721_1000003 3300002987 Bacteria 274069
9 JGI25159J45721_1003453 3300002987 Bacteria 5581
10 JGI25159J45721_1005078 3300002987 Bacteria 4188
11 JGI25151J46595_10013617 3300003187 Bacteria 3654
12 JGI25165J46597_1000485 3300003214 Bacteria 38628
13 JGI25165J46597_1001540 3300003214 Bacteria 11452
14 rootH1_10097352 3300003316 Bacteria 1164
15 rootH2_10040474 3300003320 Bacteria 1370
16 rootL2_10030557 3300003322 Bacteria 1587
17 rootH1_10126813 3300003323 Bacteria 1538
18 JGI25160J50197_1000003 3300003354 Bacteria 482719
19 JGI25160J50197_1000012 3300003354 Bacteria 267582
20 JGI25160J50197_1005073 3300003354 Bacteria 5559
21 JGI25161J50226_1000002 3300003374 Bacteria 420324
22 JGI25161J50226_1000186 3300003374 Bacteria 40917
23 JGI25161J50226_1000548 3300003374 Bacteria 16030
24 JGI25161J50226_1000611 3300003374 Bacteria 14696
25 Ga0055526_1001274 3300003771 Bacteria 18065
26 Ga0055526_1004203 3300003771 Bacteria 8745
27 Ga0055526_1011723 3300003771 Bacteria 3909
28 Ga0055524_1003130 3300003775 Bacteria 8165
29 Ga0055524_1020604 3300003775 Bacteria 2215
30 Ga0055524_1041024 3300003775 Bacteria 1172
31 Ga0055536_1001589 3300003781 Bacteria 13586
32 Ga0055528_1002183 3300003790 Bacteria 10715
33 Ga0055528_1015240 3300003790 Bacteria 2789
34 Ga0055530_10021668 3300003791 Bacteria 1888
35 Ga0055540_1025536 3300003792 Bacteria 1445
36 Ga0055531_10019497 3300003794 Bacteria 2740
37 Ga0055531_10023410 3300003794 Bacteria 2318
38 Ga0058692_1035401 3300003856 Bacteria 910
39 Ga0055543_1000011 3300004625 Bacteria 196089
40 Ga0055543_1000073 3300004625 Bacteria 88583
41 Ga0055543_1000223 3300004625 Bacteria 45570
42 Ga0065165_1000025 3300005262 Bacteria 246909
43 Ga0065165_1001668 3300005262 Bacteria 22466
44 Ga0065165_1006569 3300005262 Bacteria 6054
45 Ga0070670_100002580 3300005331 Bacteria 14983
46 Ga0070677_10569947 3300005333 Bacteria 623
47 Ga0070680_100005127 3300005336 Bacteria 9896
48 Ga0070682_100132449 3300005337 Bacteria 1689
49 Ga0070660_100375270 3300005339 Bacteria 1174
50 Ga0070668_100401674 3300005347 Bacteria 1170
51 Ga0070668_100557418 3300005347 Bacteria 998
52 Ga0070668_101107842 3300005347 Bacteria 715
53 Ga0070669_100593818 3300005353 Bacteria 927
54 Ga0070669_100974517 3300005353 Bacteria 727
55 Ga0070688_100680681 3300005365 Bacteria 795
56 Ga0070678_100325558 3300005456 Bacteria 1314
57 Ga0070662_100228085 3300005457 Bacteria 1489
58 Ga0070681_10006073 3300005458 Bacteria 11714
59 Ga0070679_100002677 3300005530 Bacteria 16220
60 Ga0068853_100548163 3300005539 Bacteria 1095
61 Ga0070672_100634942 3300005543 Bacteria 932
62 Ga0070686_100270591 3300005544 Bacteria 1249
63 Ga0070686_100528162 3300005544 Bacteria 920
64 Ga0070693_100119510 3300005547 Bacteria 1632
65 Ga0070665_100012444 3300005548 Bacteria 8579
66 Ga0070665_100295024 3300005548 Bacteria 1624
67 Ga0070665_101225781 3300005548 Bacteria 761
68 Ga0070665_101844999 3300005548 Bacteria 611
69 Ga0068855_100177776 3300005563 Bacteria 2407
70 Ga0070664_102140224 3300005564 Bacteria 531
71 Ga0068856_100055520 3300005614 Bacteria 3909
72 Ga0068852_100127170 3300005616 Bacteria 2342
73 Ga0068864_100998669 3300005618 Bacteria 830
74 Ga0068862_100966340 3300005844 Bacteria 841
75 Ga0079104_1000033 3300006946 Bacteria 202636
76 Ga0105240_10000024 3300009093 Bacteria 375919
77 Ga0111539_10481446 3300009094 Bacteria 1446
78 Ga0111539_12746258 3300009094 Unclassified 571
79 Ga0105245_10767694 3300009098 Bacteria 1001
80 Ga0105245_11236129 3300009098 Bacteria 795
81 Ga0105243_10185033 3300009148 Bacteria 1815
82 Ga0105243_10260375 3300009148 Bacteria 1553
83 Ga0105243_11707328 3300009148 Bacteria 659
84 Ga0105248_10389811 3300009177 Bacteria 1568
85 Ga0105237_10002690 3300009545 Bacteria 21778
86 Ga0105238_10364534 3300009551 Bacteria 1435
87 Ga0105249_10464880 3300009553 Bacteria 1306
88 Ga0105033_113527 3300009986 Bacteria 726
89 Ga0105239_10151893 3300010375 Bacteria 2585
90 Ga0105239_11611202 3300010375 Bacteria 751
91 Ga0157373_10427541 3300013100 Bacteria 951
92 Ga0157370_10000236 3300013104 Bacteria 70330
93 Ga0157369_10514473 3300013105 Bacteria 1238
94 Ga0171463_1001 3300013249 Bacteria 1406070
95 Ga0157375_10925382 3300013308 Bacteria 1015
96 Ga0163163_10879155 3300014325 Bacteria 960
97 Ga0182008_10021132 3300014497 Bacteria 3346
98 Ga0182007_10006249 3300015262 Bacteria 5125
99 Ga0182005_1001862 3300015265 Bacteria 8013
100 Ga0183363_1051 3300015690 Bacteria 37819
101 Ga0209435_100026 3300025206 Bacteria 198295
102 Ga0209760_106930 3300025207 Bacteria 880
103 Ga0209436_100048 3300025208 Bacteria 66177
104 Ga0209436_100220 3300025208 Bacteria 26273
105 Ga0209672_122288 3300025228 Bacteria 597
106 Ga0207427_110662 3300025231 Bacteria 951
107 Ga0209437_100050 3300025233 Bacteria 394010
108 Ga0209437_100056 3300025233 Bacteria 363071
109 Ga0209646_1000084 3300025246 Bacteria 198295
110 Ga0209646_1004941 3300025246 Bacteria 2380
111 Ga0209026_1000080 3300025250 Bacteria 198295
112 Ga0209677_100813 3300025253 Bacteria 15606
113 Ga0209759_1000061 3300025256 Bacteria 198295
114 Ga0209233_1000037 3300025261 Bacteria 554620
115 Ga0209233_1000071 3300025261 Bacteria 363290
116 Ga0209233_1000234 3300025261 Bacteria 95145
117 Ga0209673_1000135 3300025273 Bacteria 160333
118 Ga0209673_1002722 3300025273 Bacteria 11658
119 Ga0209130_1000002 3300025284 Bacteria 722648
120 Ga0209130_1000005 3300025284 Bacteria 599620
121 Ga0209130_1000028 3300025284 Bacteria 325668
122 Ga0209676_1001378 3300025292 Bacteria 23720
123 Ga0209025_1000037 3300025294 Bacteria 383429
124 Ga0209025_1000105 3300025294 Bacteria 224157
125 Ga0209564_1000138 3300025295 Bacteria 181512
126 Ga0209564_1000217 3300025295 Bacteria 131090
127 Ga0209564_1000746 3300025295 Bacteria 46142
128 Ga0209050_1006791 3300025298 Bacteria 6668
129 Ga0209256_1000027 3300025299 Bacteria 423283
130 Ga0209256_1001687 3300025299 Bacteria 21373
131 Ga0209256_1002449 3300025299 Bacteria 15133
132 Ga0209256_1004753 3300025299 Bacteria 8292
133 Ga0207426_1000012 3300025302 Bacteria 730942
134 Ga0207426_1000013 3300025302 Bacteria 721897
135 Ga0207426_1000015 3300025302 Bacteria 599316
136 Ga0209051_1011813 3300025303 Bacteria 4276
137 Ga0209257_1010748 3300025304 Bacteria 4556
138 Ga0207697_10372973 3300025315 Bacteria 634
139 Ga0207656_10028531 3300025321 Bacteria 2291
140 Ga0207707_10051225 3300025912 Bacteria 3595
141 Ga0207695_10000036 3300025913 Bacteria 477897
142 Ga0207671_10000354 3300025914 Bacteria 66092
143 Ga0207660_10099147 3300025917 Bacteria 2173
144 Ga0207657_10072851 3300025919 Bacteria 2904
145 Ga0207649_11020588 3300025920 Bacteria 651
146 Ga0207652_10183283 3300025921 Bacteria 1882
147 Ga0207681_10054476 3300025923 Bacteria 2720
148 Ga0207681_11229475 3300025923 Bacteria 629
149 Ga0207650_10000658 3300025925 Bacteria 27263
150 Ga0207687_11582365 3300025927 Bacteria 562
151 Ga0207706_10535524 3300025933 Bacteria 1009
152 Ga0207670_10344900 3300025936 Bacteria 1178
153 Ga0207670_10873694 3300025936 Bacteria 752
154 Ga0207704_11484661 3300025938 Bacteria 582
155 Ga0207691_10079669 3300025940 Bacteria 2947
156 Ga0207667_10734569 3300025949 Bacteria 988
157 Ga0207668_11642937 3300025972 Bacteria 580
158 Ga0207658_10291747 3300025986 Bacteria 1402
159 Ga0207708_10149345 3300026075 Bacteria 1838
160 Ga0207702_10039855 3300026078 Bacteria 3938
161 Ga0207683_10834521 3300026121 Bacteria 856
162 Ga0207698_10005132 3300026142 Bacteria 8048
163 Ga0207698_10618131 3300026142 Bacteria 1070
164 Ga0209281_1000043 3300027111 Bacteria 341543
165 Ga0209371_1000989 3300027312 Bacteria 21873
166 Ga0207428_10855918 3300027907 Unclassified 644
167 Ga0268266_10060133 3300028379 Bacteria 3275
168 Ga0268266_10163351 3300028379 Bacteria 2016
169 Ga0268266_10606608 3300028379 Bacteria 1052
170 Ga0268256_1000953 3300030500 Bacteria 19750
171 Ga0265325_10000703 3300031241 Bacteria 24247
172 Ga0265325_10106885 3300031241 Bacteria 1364
173 Ga0265340_10055844 3300031247 Bacteria 1901
174 Ga0307513_10008282 3300031456 Bacteria 13329
175 Ga0307408_100388780 3300031548 Bacteria 1195
176 Ga0316576_10278945 3300031727 Bacteria 1252
177 Ga0307405_10116353 3300031731 Bacteria 1821
178 Ga0307413_10093171 3300031824 Bacteria 1968
179 Ga0307410_10134793 3300031852 Bacteria 1819
180 Ga0307406_10266848 3300031901 Bacteria 1298
181 Ga0307414_10051702 3300032004 Bacteria 2854
182 Ga0307414_11141260 3300032004 Bacteria 720
183 Ga0307411_12345316 3300032005 Bacteria 502
184 Ga0373929_0076486 3300035085 Bacteria 809
185 Ga0373949_0156711 3300035090 Bacteria 662
186 Ga0373955_0302294 3300035172 Bacteria 965
187 Ga0373962_0391543 3300035242 Bacteria 510
188 Ga0439436_0040550 3300041404 Bacteria 1334
189 Ga0439439_0058391 3300041406 Bacteria 1021
190 Ga0439447_090662 3300041407 Bacteria 703
191 Ga0439466_0058665 3300041411 Bacteria 1245
192 Ga0451807_2009903 3300041486 Bacteria 597
193 Ga0439449_0045649 3300042007 Bacteria 1624
194 Ga0450918_075325 3300042531 Bacteria 638
195 Ga0466963_0121280 3300044694 Bacteria 1799
196 Ga0466968_0180451 3300044735 Bacteria 982
197 Ga0466970_0068944 3300044765 Bacteria 1900
198 Ga0495617_061778 3300046452 Bacteria 1238
199 Ga0495605_0036045 3300046474 Bacteria 2496
200 Ga0495585_0021179 3300046492 Bacteria 3735
201 Ga0495607_0057844 3300046501 Bacteria 2220
202 Ga0495583_0021666 3300046506 Bacteria 3301
203 Ga0495631_0032468 3300046518 Bacteria 2354
204 Ga0495654_0116524 3300046530 Bacteria 1213
205 Ga0495668_0114425 3300046616 Bacteria 1475
206 Ga0495611_0030175 3300046648 Bacteria 2383
207 Ga0495625_0007266 3300046660 Bacteria 9688
208 Ga0495647_0280785 3300046681 Bacteria 747
209 Ga0495670_0221346 3300046691 Bacteria 1005
210 Ga0495660_0076572 3300046810 Bacteria 1762
211 Ga0495680_0110791 3300047322 Bacteria 2034
212 Ga0495683_0105894 3300047323 Bacteria 1348
213 Ga0495687_237489 3300047443 Bacteria 552
214 Ga0495686_0001100 3300047472 Bacteria 32113
215 Ga0495686_0046156 3300047472 Bacteria 2755
216 Ga0495626_0056023 3300048091 Bacteria 1806
217 Ga0496101_1012258 3300048904 Bacteria 653
218 Ga0496102_0207481 3300048905 Bacteria 1847
219 Ga0496108_0674682 3300048911 Bacteria 897
220 Ga0496116_0204063 3300048919 Bacteria 1031
221 Ga0496116_0216101 3300048919 Bacteria 988
222 Ga0496117_0001724 3300048920 Bacteria 30250
223 Ga0496117_0027670 3300048920 Bacteria 4409
224 Ga0496118_0031465 3300048921 Bacteria 4397
225 Ga0496118_0080919 3300048921 Bacteria 2283
226 Ga0496118_0439843 3300048921 Bacteria 665
227 Ga0496119_0085386 3300048922 Bacteria 1807
228 Ga0496119_0163390 3300048922 Bacteria 1181
229 Ga0496119_0203888 3300048922 Bacteria 1022
230 Ga0496120_0087240 3300048923 Bacteria 1675
231 Ga0496121_0029548 3300048924 Bacteria 5064
232 Ga0496121_0230567 3300048924 Bacteria 1297
233 Ga0496121_0667659 3300048924 Bacteria 630
234 Ga0496122_0000309 3300048925 Bacteria 107844
235 Ga0496122_0090292 3300048925 Bacteria 2091
236 Ga0496123_0000396 3300048926 Bacteria 81106
237 Ga0496123_0093450 3300048926 Bacteria 1776
238 Ga0496124_0000532 3300048927 Bacteria 64777
239 Ga0496124_0030753 3300048927 Bacteria 4759
240 Ga0496124_0085301 3300048927 Bacteria 2588
241 Ga0496124_0215851 3300048927 Bacteria 1447
242 Ga0496125_0002207 3300048928 Bacteria 25974
243 Ga0496125_0140552 3300048928 Bacteria 1680
244 Ga0496125_0209180 3300048928 Bacteria 1268
245 Ga0496126_0000923 3300048929 Bacteria 50791
246 Ga0496126_0065870 3300048929 Bacteria 3240
247 Ga0496126_0079230 3300048929 Bacteria 2908
248 Ga0501306_051290 3300049127 Bacteria 662
249 Ga0495678_117189 3300049459 Bacteria 899
250 Ga0501031_0059390 3300049568 Bacteria 2492
251 Ga0501031_0432357 3300049568 Bacteria 850
252 Ga0501032_0053794 3300049569 Bacteria 2710
253 Ga0501032_0699314 3300049569 Bacteria 642
254 Ga0501033_0420614 3300049570 Bacteria 930
255 Ga0501034_0009010 3300049571 Bacteria 10481
256 Ga0501034_0777269 3300049571 Bacteria 851
257 Ga0501034_0906300 3300049571 Bacteria 769
258 Ga0501034_1133538 3300049571 Bacteria 662
259 Ga0501036_0030950 3300049572 Bacteria 4522
260 Ga0501036_0082391 3300049572 Bacteria 2719
261 Ga0501037_0121306 3300049573 Bacteria 1879
262 Ga0501037_0300195 3300049573 Bacteria 1115
263 Ga0501038_0012012 3300049574 Bacteria 7909
264 Ga0501038_0315673 3300049574 Bacteria 1223
265 Ga0501039_0016379 3300049575 Bacteria 5680
266 Ga0501042_0009123 3300049578 Bacteria 6594
267 Ga0501043_0006297 3300049579 Bacteria 9530
268 Ga0501046_0190177 3300049580 Bacteria 1531
269 Ga0501047_0098667 3300049581 Bacteria 2799
270 Ga0501047_0215518 3300049581 Bacteria 1777
271 Ga0501048_0031280 3300049582 Bacteria 3850
272 Ga0501048_0511987 3300049582 Bacteria 861
273 Ga0501067_0222636 3300049583 Bacteria 1051
274 Ga0501067_0538960 3300049583 Bacteria 653
275 Ga0501068_0848952 3300049584 Bacteria 600
276 Ga0501069_0001041 3300049585 Bacteria 13260
277 Ga0501070_0167490 3300049586 Bacteria 1810
278 Ga0501071_0058478 3300049587 Bacteria 2788
279 Ga0501072_0193263 3300049588 Bacteria 1623
280 Ga0501073_0018041 3300049589 Bacteria 5103
281 Ga0501074_0013637 3300049590 Bacteria 5907
282 Ga0501076_1730493 3300049592 Unclassified 513
283 Ga0501238_036735 3300049671 Bacteria 715
284 Ga0501079_0110039 3300049741 Bacteria 2140
285 Ga0501080_0020465 3300049742 Bacteria 6126
286 Ga0501083_0042197 3300049744 Bacteria 3093
287 Ga0501280_005854 3300049776 Bacteria 1747
288 Ga0501035_0027579 3300049822 Bacteria 5190
289 Ga0501035_0041358 3300049822 Bacteria 4161
290 Ga0501044_0000708 3300049823 Bacteria 40261
291 Ga0501044_0197229 3300049823 Bacteria 1972
292 Ga0501044_0202938 3300049823 Bacteria 1940
293 Ga0501045_0543012 3300049824 Bacteria 862
294 Ga0501045_1160403 3300049824 Bacteria 564
295 nmdc:mga03683_502108_c1 3300050489 Bacteria 587
296 nmdc:mga0k408_249641_c1 3300050493 Bacteria 1059
297 nmdc:mga07m45_49273_c1 3300050496 Bacteria 2370
298 nmdc:mga08y16_178273_c1 3300050511 Bacteria 2207
299 Ga0495612_0032682 3300053078 Bacteria 2103
300 Ga0500610_0293495 3300053079 Bacteria 721
301 Ga0495655_0055090 3300053083 Unclassified 1066
302 Ga0500557_012259 3300053105 Bacteria 2217
303 Ga0500569_001752 3300053109 Bacteria 4155
304 Ga0500594_0025142 3300053118 Bacteria 1523
305 Ga0500627_0032258 3300053158 Bacteria 2207
306 Ga0501084_0248027 3300054114 Bacteria 1503
307 Ga0501084_0476776 3300054114 Bacteria 1055
308 Ga0501082_0389132 3300060353 Bacteria 1217
309 643824218 643692032 Bacteria 6891900
310 2510839009 2510461069 Bacteria 5505000
311 2511134586 2510917022 Bacteria 6504556
312 2513911335 2513237144 Bacteria 7530820
313 2516204646 2516143018 Bacteria 6951533
314 2524458086 2524023209 Bacteria 6679728
315 2585273667 2582581307 Bacteria 6597605
316 2585279971 2582581308 Bacteria 7413247
317 2585326252 2582581315 Bacteria 7318924
318 2585330416 2582581316 Bacteria 7774528
319 2585533775 2585427527 Bacteria 7273426
320 2585553368 2585427530 Bacteria 7383882
321 2585559841 2585427531 Bacteria 6992870
322 2585900520 2585427608 Bacteria 6544331
323 2585905981 2585427609 Bacteria 6667127
324 2587978904 2585428125 Bacteria 6662905
325 2599332726 2599185156 Bacteria 5403036
326 2600194990 2599185352 Bacteria 7228948
327 2616309391 2615840626 Bacteria 7921970
328 2616556281 2615840698 Bacteria 7319877
329 2617380525 2617270742 Bacteria 6808054
330 2643805964 2643221557 Bacteria 7184309
331 2644066140 2643221610 Bacteria 7480339
332 2644207148 2643221637 Bacteria 5345260
333 2644377224 2643221668 Bacteria 7306521
334 2644417471 2643221675 Bacteria 7473456
335 2644450867 2643221680 Bacteria 7473610
336 2644495530 2643221688 Bacteria 5260751
337 2644650796 2643221718 Bacteria 5345506
338 2644671648 2643221723 Bacteria 7095460
339 2644692710 2643221726 Bacteria 7455827
340 2657682915 2657244999 Bacteria 5946535
341 2671113937 2667528174 Bacteria 6435400
342 2692317600 2690316117 Bacteria 6800650
343 2738948710 2738541317 Bacteria 5340176
344 2753459802 2751185821 Bacteria 6189929
345 2776911688 2775507049 Bacteria 6284736
346 2778173892 2775507266 Bacteria 7392367
347 2792621112 2791355091 Bacteria 6135441
348 2792625326 2791355092 Bacteria 6248105
349 2792637757 2791355094 Bacteria 7011481
350 2804750634 2802429268 Bacteria 6094027
351 2819608678 2818991448 Bacteria 6772224
352 2819640788 2818991453 Bacteria 7181617
353 2838029567 2838029111 Bacteria 6603031
354 2838075028 2838074704 Bacteria 6785777
355 2842299730 2842298080 Bacteria 6123127
356 2842359748 2842357229 Bacteria 6485165
357 2842476003 2842475841 Bacteria 6603183
358 2842486087 2842482326 Bacteria 7212537
359 2842503095 2842502639 Bacteria 6604161
360 2842512957 2842509118 Bacteria 6850950
361 2842923001 2842922631 Bacteria 5824079
362 2847417330 2847417321 Bacteria 6913799
363 2848992115 2848992105 Bacteria 6810864
364 2852388146 2852387548 Bacteria 8025568
365 2855875244 2855872281 Bacteria 6964271
366 2884299265 2884298095 Bacteria 3823049
367 2891375305 2891373044 Bacteria 5202277
368 2896384738 2896384573 Bacteria 7700774
369 2899805643 2899803654 Bacteria 5577784
370 2913311475 2913308742 Bacteria 5350706
371 2919408519 2919408235 Bacteria 6149349
372 2920763716 2920760137 Bacteria 7427611
373 2920823001 2920822456 Bacteria 6897201
374 2929205012 2929199973 Bacteria 7260745
375 2989351771 2989349275 Bacteria 6349068
376 2989772523 2989771324 Bacteria 5605128
377 3003931614 3003930520 Bacteria 5667563
378 3005423088 3005416602 Bacteria 7064308
379 8005247736 8005246636 Bacteria 4933972
380 8005315415 8005314921 Bacteria 7072929
381 8005484673 8005484373 Bacteria 6297373
382 8005649366 8005645114 Bacteria 6950293
383 8005685394 8005682033 Bacteria 6726518
384 8046769565 8046767195 Bacteria 7547379
385 8055913059 8055909800 Bacteria 7278581
386 8056878801 8056875544 Bacteria 4355797
387 8057580398 8057575449 Bacteria 7367519
388 JGI25155J39150_1000013
389 JGI25156J39149_1000011
390 JGI25162J39368_1000501
391 JGI25162J39368_1000723
392 JGI25154J39366_1000030
393 JGI25158J39367_1010649
394 JGI25157J39369_1000013
395 JGI25159J45721_1000003
396 JGI25159J45721_1003453
397 JGI25159J45721_1005078
398 JGI25151J46595_10013617
399 JGI25165J46597_1000485
400 JGI25165J46597_1001540
401 rootH1_10097352
402 rootH2_10040474
403 rootL2_10030557
404 rootH1_10126813
405 JGI25160J50197_1000003
406 JGI25160J50197_1000012
407 JGI25160J50197_1005073
408 JGI25161J50226_1000002
409 JGI25161J50226_1000186
410 JGI25161J50226_1000548
411 JGI25161J50226_1000611
412 Ga0055526_1001274
413 Ga0055526_1004203
414 Ga0055526_1011723
415 Ga0055524_1003130
416 Ga0055524_1020604
417 Ga0055524_1041024
418 Ga0055536_1001589
419 Ga0055528_1002183
420 Ga0055528_1015240
421 Ga0055530_10021668
422 Ga0055540_1025536
423 Ga0055531_10019497
424 Ga0055531_10023410
425 Ga0058692_1035401
426 Ga0055543_1000011
427 Ga0055543_1000073
428 Ga0055543_1000223
429 Ga0065165_1000025
430 Ga0065165_1001668
431 Ga0065165_1006569
432 Ga0070670_100002580
433 Ga0070677_10569947
434 Ga0070680_100005127
435 Ga0070682_100132449
436 Ga0070660_100375270
437 Ga0070668_100401674
438 Ga0070668_100557418
439 Ga0070668_101107842
440 Ga0070669_100593818
441 Ga0070669_100974517
442 Ga0070688_100680681
443 Ga0070678_100325558
444 Ga0070662_100228085
445 Ga0070681_10006073
446 Ga0070679_100002677
447 Ga0068853_100548163
448 Ga0070672_100634942
449 Ga0070686_100270591
450 Ga0070686_100528162
451 Ga0070693_100119510
452 Ga0070665_100012444
453 Ga0070665_100295024
454 Ga0070665_101225781
455 Ga0070665_101844999
456 Ga0068855_100177776
457 Ga0070664_102140224
458 Ga0068856_100055520
459 Ga0068852_100127170
460 Ga0068864_100998669
461 Ga0068862_100966340
462 Ga0079104_1000033
463 Ga0105240_10000024
464 Ga0111539_10481446
465 Ga0111539_12746258
466 Ga0105245_10767694
467 Ga0105245_11236129
468 Ga0105243_10185033
469 Ga0105243_10260375
470 Ga0105243_11707328
471 Ga0105248_10389811
472 Ga0105237_10002690
473 Ga0105238_10364534
474 Ga0105249_10464880
475 Ga0105033_113527
476 Ga0105239_10151893
477 Ga0105239_11611202
478 Ga0157373_10427541
479 Ga0157370_10000236
480 Ga0157369_10514473
481 Ga0171463_1001
482 Ga0157375_10925382
483 Ga0163163_10879155
484 Ga0182008_10021132
485 Ga0182007_10006249
486 Ga0182005_1001862
487 Ga0183363_1051
488 Ga0209435_100026
489 Ga0209760_106930
490 Ga0209436_100048
491 Ga0209436_100220
492 Ga0209672_122288
493 Ga0207427_110662
494 Ga0209437_100050
495 Ga0209437_100056
496 Ga0209646_1000084
497 Ga0209646_1004941
498 Ga0209026_1000080
499 Ga0209677_100813
500 Ga0209759_1000061
501 Ga0209233_1000037
502 Ga0209233_1000071
503 Ga0209233_1000234
504 Ga0209673_1000135
505 Ga0209673_1002722
506 Ga0209130_1000002
507 Ga0209130_1000005
508 Ga0209130_1000028
509 Ga0209676_1001378
510 Ga0209025_1000037
511 Ga0209025_1000105
512 Ga0209564_1000138
513 Ga0209564_1000217
514 Ga0209564_1000746
515 Ga0209050_1006791
516 Ga0209256_1000027
517 Ga0209256_1001687
518 Ga0209256_1002449
519 Ga0209256_1004753
520 Ga0207426_1000012
521 Ga0207426_1000013
522 Ga0207426_1000015
523 Ga0209051_1011813
524 Ga0209257_1010748
525 Ga0207697_10372973
526 Ga0207656_10028531
527 Ga0207707_10051225
528 Ga0207695_10000036
529 Ga0207671_10000354
530 Ga0207660_10099147
531 Ga0207657_10072851
532 Ga0207649_11020588
533 Ga0207652_10183283
534 Ga0207681_10054476
535 Ga0207681_11229475
536 Ga0207650_10000658
537 Ga0207687_11582365
538 Ga0207706_10535524
539 Ga0207670_10344900
540 Ga0207670_10873694
541 Ga0207704_11484661
542 Ga0207691_10079669
543 Ga0207667_10734569
544 Ga0207668_11642937
545 Ga0207658_10291747
546 Ga0207708_10149345
547 Ga0207702_10039855
548 Ga0207683_10834521
549 Ga0207698_10005132
550 Ga0207698_10618131
551 Ga0209281_1000043
552 Ga0209371_1000989
553 Ga0207428_10855918
554 Ga0268266_10060133
555 Ga0268266_10163351
556 Ga0268266_10606608
557 Ga0268256_1000953
558 Ga0265325_10000703
559 Ga0265325_10106885
560 Ga0265340_10055844
561 Ga0307513_10008282
562 Ga0307408_100388780
563 Ga0316576_10278945
564 Ga0307405_10116353
565 Ga0307413_10093171
566 Ga0307410_10134793
567 Ga0307406_10266848
568 Ga0307414_10051702
569 Ga0307414_11141260
570 Ga0307411_12345316
571 Ga0373929_0076486
572 Ga0373949_0156711
573 Ga0373955_0302294
574 Ga0373962_0391543
575 Ga0439436_0040550
576 Ga0439439_0058391
577 Ga0439447_090662
578 Ga0439466_0058665
579 Ga0451807_2009903
580 Ga0439449_0045649
581 Ga0450918_075325
582 Ga0466963_0121280
583 Ga0466968_0180451
584 Ga0466970_0068944
585 Ga0495617_061778
586 Ga0495605_0036045
587 Ga0495585_0021179
588 Ga0495607_0057844
589 Ga0495583_0021666
590 Ga0495631_0032468
591 Ga0495654_0116524
592 Ga0495668_0114425
593 Ga0495611_0030175
594 Ga0495625_0007266
595 Ga0495647_0280785
596 Ga0495670_0221346
597 Ga0495660_0076572
598 Ga0495680_0110791
599 Ga0495683_0105894
600 Ga0495687_237489
601 Ga0495686_0001100
602 Ga0495686_0046156
603 Ga0495626_0056023
604 Ga0496101_1012258
605 Ga0496102_0207481
606 Ga0496108_0674682
607 Ga0496116_0204063
608 Ga0496116_0216101
609 Ga0496117_0001724
610 Ga0496117_0027670
611 Ga0496118_0031465
612 Ga0496118_0080919
613 Ga0496118_0439843
614 Ga0496119_0085386
615 Ga0496119_0163390
616 Ga0496119_0203888
617 Ga0496120_0087240
618 Ga0496121_0029548
619 Ga0496121_0230567
620 Ga0496121_0667659
621 Ga0496122_0000309
622 Ga0496122_0090292
623 Ga0496123_0000396
624 Ga0496123_0093450
625 Ga0496124_0000532
626 Ga0496124_0030753
627 Ga0496124_0085301
628 Ga0496124_0215851
629 Ga0496125_0002207
630 Ga0496125_0140552
631 Ga0496125_0209180
632 Ga0496126_0000923
633 Ga0496126_0065870
634 Ga0496126_0079230
635 Ga0501306_051290
636 Ga0495678_117189
637 Ga0501031_0059390
638 Ga0501031_0432357
639 Ga0501032_0053794
640 Ga0501032_0699314
641 Ga0501033_0420614
642 Ga0501034_0009010
643 Ga0501034_0777269
644 Ga0501034_0906300
645 Ga0501034_1133538
646 Ga0501036_0030950
647 Ga0501036_0082391
648 Ga0501037_0121306
649 Ga0501037_0300195
650 Ga0501038_0012012
651 Ga0501038_0315673
652 Ga0501039_0016379
653 Ga0501042_0009123
654 Ga0501043_0006297
655 Ga0501046_0190177
656 Ga0501047_0098667
657 Ga0501047_0215518
658 Ga0501048_0031280
659 Ga0501048_0511987
660 Ga0501067_0222636
661 Ga0501067_0538960
662 Ga0501068_0848952
663 Ga0501069_0001041
664 Ga0501070_0167490
665 Ga0501071_0058478
666 Ga0501072_0193263
667 Ga0501073_0018041
668 Ga0501074_0013637
669 Ga0501076_1730493
670 Ga0501238_036735
671 Ga0501079_0110039
672 Ga0501080_0020465
673 Ga0501083_0042197
674 Ga0501280_005854
675 Ga0501035_0027579
676 Ga0501035_0041358
677 Ga0501044_0000708
678 Ga0501044_0197229
679 Ga0501044_0202938
680 Ga0501045_0543012
681 Ga0501045_1160403
682 nmdc:mga03683_502108_c1
683 nmdc:mga0k408_249641_c1
684 nmdc:mga07m45_49273_c1
685 nmdc:mga08y16_178273_c1
686 Ga0495612_0032682
687 Ga0500610_0293495
688 Ga0495655_0055090
689 Ga0500557_012259
690 Ga0500569_001752
691 Ga0500594_0025142
692 Ga0500627_0032258
693 Ga0501084_0248027
694 Ga0501084_0476776
695 Ga0501082_0389132
696 643824218
697 2510839009
698 2511134586
699 2513911335
700 2516204646
701 2524458086
702 2585273667
703 2585279971
704 2585326252
705 2585330416
706 2585533775
707 2585553368
708 2585559841
709 2585900520
710 2585905981
711 2587978904
712 2599332726
713 2600194990
714 2616309391
715 2616556281
716 2617380525
717 2643805964
718 2644066140
719 2644207148
720 2644377224
721 2644417471
722 2644450867
723 2644495530
724 2644650796
725 2644671648
726 2644692710
727 2657682915
728 2671113937
729 2692317600
730 2738948710
731 2753459802
732 2776911688
733 2778173892
734 2792621112
735 2792625326
736 2792637757
737 2804750634
738 2819608678
739 2819640788
740 2838029567
741 2838075028
742 2842299730
743 2842359748
744 2842476003
745 2842486087
746 2842503095
747 2842512957
748 2842923001
749 2847417330
750 2848992115
751 2852388146
752 2855875244
753 2884299265
754 2891375305
755 2896384738
756 2899805643
757 2913311475
758 2919408519
759 2920763716
760 2920823001
761 2929205012
762 2989351771
763 2989772523
764 3003931614
765 3005423088
766 8005247736
767 8005315415
768 8005484673
769 8005649366
770 8005685394
771 8046769565
772 8055913059
773 8056878801
774 8057580398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

34

156

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.9473 6 138
3r4q-assembly3.cif.gz_E-2 crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.9316 5 138
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.9269 6 138
3r4q-assembly3.cif.gz_E-2 crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.9181 5 138
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8674 6 132
ID Description Score Start End Superfamily
3r4qE01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9318 10 138 3.10.180.10
3r4qE01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9178 10 138 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8988 78 132 3.30.720.110
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8706 6 132 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8566 6 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4R5UHE4-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9825 5 138 GO:0051213
AF-A0A4S5JA28-F1-model_v4 deleted 0.9798 4 138
AF-A0A517YD97-F1-model_v4 Virulence protein 0.9771 4 138
AF-A0A2S9ISG2-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9732 4 137 GO:0051213
AF-C3MEJ0-F1-model_v4 Predicted glyoxalase/bleomycin resistance protein/dioxygenase 0.9692 1 138

Map