F431014

General Info

Members Datasets Scaffolds Average Seq Length
388 203 776 516

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100082959|Ga0070683_1000829592
Length 562
Sequence VVNGEYLDTTQATHNSPLTTHLILHSLLIPILFLSFAKVLTMSTEAVITGKTFHYKNNFPASGSEEERDAFNTLQKTFKKQFEEIFPDRLAPRTVVILPSFTMDIEILSKVKGIMHYEERMLCLLMLLRMPTTKLIYITSMPVSDVIIDYYLHLLPGITGQHARKRLTLLTCFDASAKPLTQKILERPRLMERIRQQITDASSAHLTCYNITSLEKTLAVQLGIPLFGTDPDKFYEGSKSGARKTFRECGVNLPDGFEDLHTKNDIIDALTALKKQHPGLKKTVIKMNDGFSGDGNAIFRYPDIETFEATAQNLEAVLMQNLTPVSKDVSKELFFEKFNSMGGVVEIFLEGEVKTSPSVQCVINPNTTIDIASTHDQLLGGDDGQIFIGAIFPADKAYSVSLAEEGKKIAKALASKGALGRFAIDFLSVKQADNSWKHYAIEINLRKGGTTHPFLMLQFLTNGVYHADTGRFITASGNERFYFASDNVSNENYKGLTPYDLINIAMYHSLMYDGAAQEGVMFHLVGALSEFGKLGLVCIGSSPERAKEFYDKVLQVLDHECC

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
175 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
176 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
177 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
178 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
181 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
182 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
183 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
184 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
185 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
186 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
187 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
192 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 0.26
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100082959 3300005329 Unclassified 3002
2 JGI25406J46586_10006703 3300003203 Bacteria 5292
3 JGI25406J46586_10008251 3300003203 Bacteria 4727
4 JGI25406J46586_10011888 3300003203 Bacteria 3799
5 rootL2_10277312 3300003322 Bacteria 3409
6 Ga0065712_10002523 3300005290 Bacteria 8028
7 Ga0065712_10015818 3300005290 Bacteria 2337
8 Ga0065712_10073468 3300005290 Bacteria 4382
9 Ga0065715_10144938 3300005293 Bacteria 1801
10 Ga0065707_10106269 3300005295 Bacteria 2604
11 Ga0070658_10131467 3300005327 Bacteria 2086
12 Ga0070683_100000711 3300005329 Bacteria 24242
13 Ga0070683_100045079 3300005329 Bacteria 4071
14 Ga0070683_100078656 3300005329 Bacteria 3085
15 Ga0070683_100199006 3300005329 Bacteria 1903
16 Ga0070670_100035608 3300005331 Bacteria 4285
17 Ga0070670_100139830 3300005331 Bacteria 2094
18 Ga0070670_100147429 3300005331 Bacteria 2036
19 Ga0068869_100014100 3300005334 Bacteria 5334
20 Ga0068869_100037479 3300005334 Bacteria 3447
21 Ga0068869_100037738 3300005334 Bacteria 3436
22 Ga0068869_100067292 3300005334 Bacteria 2642
23 Ga0068869_100148676 3300005334 Bacteria 1815
24 Ga0070666_10060435 3300005335 Bacteria 2564
25 Ga0070666_10120412 3300005335 Bacteria 1820
26 Ga0070680_100023785 3300005336 Bacteria 4890
27 Ga0068868_100030774 3300005338 Unclassified 4116
28 Ga0068868_100126180 3300005338 Bacteria 2091
29 Ga0068868_100191234 3300005338 Bacteria 1702
30 Ga0070660_100032618 3300005339 Bacteria 3920
31 Ga0070660_100061106 3300005339 Bacteria 2925
32 Ga0070689_100076355 3300005340 Bacteria 2624
33 Ga0070661_100035523 3300005344 Bacteria 3619
34 Ga0070661_100073407 3300005344 Unclassified 2519
35 Ga0070661_100089454 3300005344 Bacteria 2280
36 Ga0070668_100113950 3300005347 Bacteria 2154
37 Ga0070669_100126080 3300005353 Bacteria 1959
38 Ga0070669_100172483 3300005353 Unclassified 1687
39 Ga0070675_100022427 3300005354 Bacteria 5046
40 Ga0070675_100027557 3300005354 Bacteria 4566
41 Ga0070675_100065238 3300005354 Bacteria 3010
42 Ga0070671_100054353 3300005355 Unclassified 3329
43 Ga0070671_100083141 3300005355 Bacteria 2677
44 Ga0070674_100100325 3300005356 Bacteria 2108
45 Ga0070673_100011228 3300005364 Bacteria 6108
46 Ga0070673_100093242 3300005364 Bacteria 2465
47 Ga0070659_100035539 3300005366 Bacteria 3880
48 Ga0070659_100043462 3300005366 Bacteria 3514
49 Ga0070667_100095101 3300005367 Bacteria 2568
50 Ga0070678_100030485 3300005456 Bacteria 3708
51 Ga0070662_100028786 3300005457 Bacteria 3870
52 Ga0070662_100095321 3300005457 Bacteria 2242
53 Ga0070681_10114938 3300005458 Bacteria 2629
54 Ga0068867_100015225 3300005459 Bacteria 5453
55 Ga0068867_100033289 3300005459 Bacteria 3731
56 Ga0068867_100036058 3300005459 Bacteria 3588
57 Ga0068867_100061148 3300005459 Bacteria 2796
58 Ga0070685_10004069 3300005466 Bacteria 7388
59 Ga0070685_10052892 3300005466 Bacteria 2350
60 Ga0070698_100005145 3300005471 Bacteria 14305
61 Ga0070698_100061482 3300005471 Bacteria 3790
62 Ga0070698_100071919 3300005471 Bacteria 3467
63 Ga0070679_100031127 3300005530 Bacteria 5270
64 Ga0070679_100069447 3300005530 Bacteria 3514
65 Ga0070679_100080831 3300005530 Bacteria 3240
66 Ga0070679_100105408 3300005530 Bacteria 2805
67 Ga0070684_100001934 3300005535 Bacteria 15200
68 Ga0070684_100040270 3300005535 Bacteria 4022
69 Ga0070684_100154704 3300005535 Bacteria 2079
70 Ga0070684_100182728 3300005535 Bacteria 1907
71 Ga0068853_100035864 3300005539 Bacteria 4215
72 Ga0068853_100043953 3300005539 Bacteria 3823
73 Ga0068853_100105702 3300005539 Bacteria 2494
74 Ga0068853_100140152 3300005539 Bacteria 2170
75 Ga0070672_100090545 3300005543 Unclassified 2467
76 Ga0070686_100012034 3300005544 Bacteria 4920
77 Ga0070665_100185338 3300005548 Bacteria 2082
78 Ga0068855_100048795 3300005563 Bacteria 4995
79 Ga0068855_100055796 3300005563 Bacteria 4638
80 Ga0070664_100006250 3300005564 Bacteria 9618
81 Ga0070664_100006493 3300005564 Bacteria 9428
82 Ga0070664_100050830 3300005564 Bacteria 3509
83 Ga0070664_100158482 3300005564 Bacteria 2001
84 Ga0068857_100010197 3300005577 Bacteria 8168
85 Ga0068857_100027126 3300005577 Bacteria 5052
86 Ga0068857_100074290 3300005577 Bacteria 3029
87 Ga0068857_100106667 3300005577 Bacteria 2516
88 Ga0068857_100181852 3300005577 Unclassified 1913
89 Ga0068854_100040924 3300005578 Bacteria 3272
90 Ga0068854_100074619 3300005578 Bacteria 2488
91 Ga0068856_100132280 3300005614 Bacteria 2500
92 Ga0068852_100019563 3300005616 Bacteria 5362
93 Ga0068852_100032847 3300005616 Bacteria 4301
94 Ga0068859_100003537 3300005617 Bacteria 15905
95 Ga0068859_100015913 3300005617 Bacteria 7559
96 Ga0068859_100040262 3300005617 Bacteria 4691
97 Ga0068859_100075765 3300005617 Bacteria 3405
98 Ga0068859_100114637 3300005617 Bacteria 2759
99 Ga0068864_100009851 3300005618 Bacteria 7880
100 Ga0068864_100019671 3300005618 Bacteria 5647
101 Ga0068864_100055904 3300005618 Bacteria 3409
102 Ga0068864_100133918 3300005618 Bacteria 2230
103 Ga0068861_100104960 3300005719 Bacteria 2255
104 Ga0068863_100029214 3300005841 Bacteria 5264
105 Ga0068863_100067041 3300005841 Bacteria 3395
106 Ga0068863_100158298 3300005841 Bacteria 2169
107 Ga0068858_100026468 3300005842 Bacteria 5388
108 Ga0068860_100009276 3300005843 Bacteria 9780
109 Ga0068860_100016865 3300005843 Bacteria 7120
110 Ga0068862_100002596 3300005844 Bacteria 15949
111 Ga0068862_100009951 3300005844 Bacteria 7855
112 Ga0068862_100010410 3300005844 Bacteria 7677
113 Ga0081539_10000252 3300005985 Bacteria 124764
114 Ga0081539_10000707 3300005985 Bacteria 66881
115 Ga0081539_10001570 3300005985 Bacteria 37891
116 Ga0081539_10016753 3300005985 Bacteria 5203
117 Ga0081539_10022807 3300005985 Bacteria 4124
118 Ga0097621_100000118 3300006237 Bacteria 45384
119 Ga0097621_100006187 3300006237 Bacteria 8483
120 Ga0097621_100006636 3300006237 Bacteria 8224
121 Ga0097621_100024672 3300006237 Bacteria 4698
122 Ga0068871_100001511 3300006358 Bacteria 15592
123 Ga0068871_100017861 3300006358 Bacteria 5378
124 Ga0075428_100006664 3300006844 Bacteria 12848
125 Ga0075428_100013038 3300006844 Bacteria 9238
126 Ga0075428_100042965 3300006844 Bacteria 4970
127 Ga0075428_100045535 3300006844 Bacteria 4820
128 Ga0075428_100056403 3300006844 Bacteria 4303
129 Ga0075430_100025669 3300006846 Bacteria 5014
130 Ga0075431_100023157 3300006847 Bacteria 6351
131 Ga0075431_100048461 3300006847 Unclassified 4382
132 Ga0075429_100003302 3300006880 Bacteria 13736
133 Ga0075429_100003886 3300006880 Bacteria 12763
134 Ga0068865_100107263 3300006881 Bacteria 2054
135 Ga0097620_100003537 3300006931 Bacteria 15905
136 Ga0097620_100015913 3300006931 Bacteria 7559
137 Ga0097620_100040262 3300006931 Bacteria 4691
138 Ga0097620_100075766 3300006931 Bacteria 3405
139 Ga0097620_100114635 3300006931 Bacteria 2759
140 Ga0111539_10009307 3300009094 Bacteria 12405
141 Ga0111539_10190429 3300009094 Bacteria 2394
142 Ga0111539_10195785 3300009094 Bacteria 2357
143 Ga0105247_10002541 3300009101 Bacteria 12384
144 Ga0114129_10007759 3300009147 Bacteria 15265
145 Ga0114129_10316733 3300009147 Bacteria 2075
146 Ga0105241_10029698 3300009174 Bacteria 4081
147 Ga0105242_10002571 3300009176 Bacteria 14204
148 Ga0105242_10065391 3300009176 Bacteria 3000
149 Ga0105242_10070981 3300009176 Bacteria 2889
150 Ga0105242_10183525 3300009176 Bacteria 1847
151 Ga0105242_10192065 3300009176 Bacteria 1808
152 Ga0105248_10100214 3300009177 Unclassified 3264
153 Ga0105237_10013353 3300009545 Bacteria 8615
154 Ga0105249_10003010 3300009553 Bacteria 14538
155 Ga0105249_10008356 3300009553 Bacteria 9016
156 Ga0105249_10012725 3300009553 Bacteria 7415
157 Ga0105249_10026212 3300009553 Bacteria 5251
158 Ga0105249_10092915 3300009553 Unclassified 2825
159 Ga0105239_10137964 3300010375 Bacteria 2716
160 Ga0157373_10024205 3300013100 Bacteria 4399
161 Ga0157373_10054477 3300013100 Bacteria 2842
162 Ga0157373_10076342 3300013100 Bacteria 2364
163 Ga0157371_10025316 3300013102 Bacteria 4326
164 Ga0157371_10080346 3300013102 Bacteria 2309
165 Ga0157371_10087898 3300013102 Bacteria 2200
166 Ga0157370_10150885 3300013104 Bacteria 2163
167 Ga0157369_10054798 3300013105 Bacteria 4305
168 Ga0157369_10120347 3300013105 Bacteria 2786
169 Ga0157374_10008638 3300013296 Bacteria 8716
170 Ga0157374_10014220 3300013296 Bacteria 6960
171 Ga0157374_10075825 3300013296 Bacteria 3178
172 Ga0157378_10008739 3300013297 Bacteria 8817
173 Ga0157378_10009769 3300013297 Bacteria 8362
174 Ga0157378_10032284 3300013297 Bacteria 4626
175 Ga0163162_10000086 3300013306 Bacteria 85949
176 Ga0163162_10004603 3300013306 Bacteria 13291
177 Ga0163162_10006420 3300013306 Bacteria 11387
178 Ga0163162_10021178 3300013306 Bacteria 6396
179 Ga0163162_10031301 3300013306 Bacteria 5277
180 Ga0163162_10042154 3300013306 Bacteria 4567
181 Ga0163162_10056918 3300013306 Bacteria 3937
182 Ga0163162_10096601 3300013306 Bacteria 3043
183 Ga0157372_10022840 3300013307 Bacteria 6773
184 Ga0157372_10167498 3300013307 Bacteria 2541
185 Ga0157372_10321540 3300013307 Bacteria 1801
186 Ga0157375_10000115 3300013308 Bacteria 77964
187 Ga0157375_10002992 3300013308 Bacteria 14682
188 Ga0157375_10126771 3300013308 Bacteria 2668
189 Ga0157375_10225929 3300013308 Bacteria 2031
190 Ga0163163_10000244 3300014325 Bacteria 55634
191 Ga0163163_10104921 3300014325 Bacteria 2852
192 Ga0163163_10109278 3300014325 Unclassified 2792
193 Ga0157380_10001228 3300014326 Bacteria 16637
194 Ga0157380_10020135 3300014326 Bacteria 4983
195 Ga0157380_10094665 3300014326 Bacteria 2473
196 Ga0182008_10002098 3300014497 Bacteria 12727
197 Ga0157377_10018392 3300014745 Bacteria 3630
198 Ga0157377_10021205 3300014745 Bacteria 3416
199 Ga0157377_10035752 3300014745 Bacteria 2728
200 Ga0157377_10076214 3300014745 Bacteria 1950
201 Ga0157379_10005725 3300014968 Bacteria 10690
202 Ga0157379_10011716 3300014968 Bacteria 7656
203 Ga0157379_10028462 3300014968 Bacteria 4970
204 Ga0157376_10000429 3300014969 Bacteria 27200
205 Ga0157376_10060824 3300014969 Bacteria 3173
206 Ga0157376_10153480 3300014969 Bacteria 2079
207 Ga0163161_10000888 3300017792 Bacteria 23222
208 Ga0163161_10005537 3300017792 Bacteria 8749
209 Ga0163161_10074511 3300017792 Bacteria 2489
210 Ga0213876_10005696 3300021384 Bacteria 6832
211 Ga0207710_10001416 3300025900 Bacteria 11988
212 Ga0207680_10040054 3300025903 Bacteria 2723
213 Ga0207645_10000193 3300025907 Bacteria 49552
214 Ga0207645_10020595 3300025907 Unclassified 4315
215 Ga0207643_10044115 3300025908 Bacteria 2517
216 Ga0207707_10096872 3300025912 Bacteria 2578
217 Ga0207671_10024738 3300025914 Bacteria 4510
218 Ga0207657_10109651 3300025919 Bacteria 2281
219 Ga0207649_10016210 3300025920 Bacteria 4197
220 Ga0207652_10110917 3300025921 Bacteria 2433
221 Ga0207652_10160879 3300025921 Bacteria 2013
222 Ga0207681_10001539 3300025923 Bacteria 14856
223 Ga0207681_10112254 3300025923 Unclassified 1985
224 Ga0207650_10003598 3300025925 Bacteria 10634
225 Ga0207650_10062861 3300025925 Bacteria 2774
226 Ga0207650_10107020 3300025925 Bacteria 2160
227 Ga0207650_10118603 3300025925 Bacteria 2057
228 Ga0207659_10126382 3300025926 Bacteria 1967
229 Ga0207644_10004244 3300025931 Bacteria 9303
230 Ga0207690_10074260 3300025932 Bacteria 2355
231 Ga0207706_10016244 3300025933 Bacteria 6724
232 Ga0207706_10026360 3300025933 Bacteria 5203
233 Ga0207706_10044788 3300025933 Bacteria 3921
234 Ga0207706_10067004 3300025933 Bacteria 3159
235 Ga0207686_10080952 3300025934 Bacteria 2118
236 Ga0207670_10012853 3300025936 Bacteria 4914
237 Ga0207670_10056083 3300025936 Bacteria 2666
238 Ga0207670_10110362 3300025936 Bacteria 1981
239 Ga0207669_10086489 3300025937 Bacteria 2027
240 Ga0207704_10069548 3300025938 Bacteria 2225
241 Ga0207691_10016995 3300025940 Bacteria 6904
242 Ga0207691_10040087 3300025940 Bacteria 4330
243 Ga0207691_10076465 3300025940 Bacteria 3017
244 Ga0207691_10084353 3300025940 Unclassified 2852
245 Ga0207711_10111447 3300025941 Unclassified 2434
246 Ga0207689_10004608 3300025942 Bacteria 12471
247 Ga0207689_10006148 3300025942 Bacteria 10627
248 Ga0207689_10011219 3300025942 Bacteria 7689
249 Ga0207689_10031624 3300025942 Bacteria 4404
250 Ga0207689_10033738 3300025942 Bacteria 4252
251 Ga0207689_10053039 3300025942 Unclassified 3341
252 Ga0207689_10064946 3300025942 Bacteria 3002
253 Ga0207661_10008977 3300025944 Bacteria 7161
254 Ga0207679_10090754 3300025945 Bacteria 2363
255 Ga0207667_10141844 3300025949 Unclassified 2474
256 Ga0207651_10030711 3300025960 Bacteria 3426
257 Ga0207651_10090328 3300025960 Bacteria 2239
258 Ga0207712_10007623 3300025961 Bacteria 6841
259 Ga0207712_10007675 3300025961 Bacteria 6822
260 Ga0207668_10041166 3300025972 Unclassified 3122
261 Ga0207640_10073705 3300025981 Bacteria 2308
262 Ga0207658_10024943 3300025986 Bacteria 4184
263 Ga0207658_10176240 3300025986 Bacteria 1766
264 Ga0207677_10060206 3300026023 Bacteria 2623
265 Ga0207677_10080320 3300026023 Unclassified 2336
266 Ga0207703_10166282 3300026035 Bacteria 1936
267 Ga0207639_10190127 3300026041 Bacteria 1753
268 Ga0207678_10038242 3300026067 Bacteria 4170
269 Ga0207708_10214624 3300026075 Bacteria 1539
270 Ga0207702_10028468 3300026078 Bacteria 4644
271 Ga0207641_10000416 3300026088 Bacteria 49757
272 Ga0207648_10063394 3300026089 Bacteria 3222
273 Ga0207648_10073585 3300026089 Unclassified 2978
274 Ga0207648_10124818 3300026089 Unclassified 2264
275 Ga0207676_10011991 3300026095 Bacteria 6203
276 Ga0207676_10071594 3300026095 Bacteria 2784
277 Ga0207676_10119433 3300026095 Bacteria 2220
278 Ga0207674_10011401 3300026116 Bacteria 9990
279 Ga0207674_10012226 3300026116 Bacteria 9601
280 Ga0207674_10013053 3300026116 Bacteria 9251
281 Ga0207674_10057301 3300026116 Bacteria 3950
282 Ga0207675_100003096 3300026118 Bacteria 16296
283 Ga0207675_100007992 3300026118 Bacteria 9967
284 Ga0207675_100028719 3300026118 Bacteria 5181
285 Ga0207683_10001560 3300026121 Bacteria 20614
286 Ga0207683_10026686 3300026121 Bacteria 4988
287 Ga0207698_10061008 3300026142 Bacteria 2936
288 Ga0207428_10007518 3300027907 Bacteria 9927
289 Ga0268264_10005081 3300028381 Bacteria 11145
290 Ga0268264_10007688 3300028381 Bacteria 8981
291 Ga0268264_10028518 3300028381 Unclassified 4566
292 Ga0316576_10000008 3300031727 Bacteria 53821
293 Ga0316576_10098369 3300031727 Bacteria 2185
294 Ga0373959_0000030 3300034820 Bacteria 31057
295 Ga0316574_0008947 3300035398 Bacteria 5591
296 Ga0373947_0142366 3300035725 Bacteria 1539
297 Ga0316584_0000923 3300036712 Bacteria 16738
298 Ga0316584_0037560 3300036712 Bacteria 3599
299 Ga0395905_0030373 3300037471 Bacteria 5092
300 Ga0395901_0075049 3300038443 Bacteria 3527
301 Ga0400485_05622 3300038735 Bacteria 4800
302 Ga0436365_0390857 3300039437 Bacteria 26340
303 Ga0451577_0068297 3300042876 Bacteria 3170
304 Ga0453684_0098263 3300044712 Unclassified 3590
305 Ga0451576_0254889 3300045051 Bacteria 1834
306 Ga0495629_0066904 3300046459 Unclassified 2508
307 Ga0495629_0112620 3300046459 Bacteria 1897
308 Ga0495650_0019475 3300046471 Unclassified 3338
309 Ga0495580_0125451 3300046472 Bacteria 1782
310 Ga0495594_0125256 3300046499 Bacteria 1454
311 Ga0495630_0078225 3300046517 Unclassified 2494
312 Ga0495598_0028896 3300046537 Unclassified 1541
313 Ga0495634_0006373 3300046642 Bacteria 8974
314 Ga0495684_0073690 3300047471 Bacteria 2594
315 Ga0495686_0005211 3300047472 Bacteria 10338
316 Ga0496114_0070683 3300048917 Bacteria 2933
317 Ga0501032_0001404 3300049569 Bacteria 19156
318 Ga0501033_0027751 3300049570 Bacteria 4256
319 Ga0501034_0007014 3300049571 Bacteria 12029
320 Ga0501036_0001169 3300049572 Bacteria 19962
321 Ga0501038_0021687 3300049574 Bacteria 5762
322 Ga0501038_0060373 3300049574 Bacteria 3245
323 Ga0501039_0019265 3300049575 Bacteria 5233
324 Ga0501039_0023831 3300049575 Bacteria 4699
325 Ga0501039_0099404 3300049575 Bacteria 2270
326 Ga0501040_0010940 3300049576 Bacteria 5934
327 Ga0501040_0013361 3300049576 Bacteria 5395
328 Ga0501041_0009663 3300049577 Bacteria 5685
329 Ga0501042_0001332 3300049578 Bacteria 14421
330 Ga0501043_0003535 3300049579 Bacteria 12843
331 Ga0501046_0004169 3300049580 Bacteria 13164
332 Ga0501046_0021487 3300049580 Bacteria 5325
333 Ga0501047_0012534 3300049581 Bacteria 8028
334 Ga0501047_0067961 3300049581 Unclassified 3433
335 Ga0501048_0013341 3300049582 Bacteria 6097
336 Ga0501068_0004384 3300049584 Bacteria 7681
337 Ga0501069_0055402 3300049585 Unclassified 2209
338 Ga0501070_0035699 3300049586 Bacteria 4152
339 Ga0501070_0068929 3300049586 Bacteria 2928
340 Ga0501071_0005000 3300049587 Bacteria 8474
341 Ga0501071_0053945 3300049587 Bacteria 2900
342 Ga0501071_0069979 3300049587 Bacteria 2556
343 Ga0501072_0041726 3300049588 Bacteria 3604
344 Ga0501073_0000839 3300049589 Bacteria 21859
345 Ga0501074_0002773 3300049590 Bacteria 12257
346 Ga0501074_0015627 3300049590 Bacteria 5517
347 Ga0501075_0006187 3300049591 Bacteria 8226
348 Ga0501075_0009169 3300049591 Bacteria 6915
349 Ga0501076_0032006 3300049592 Bacteria 4104
350 Ga0501076_0100759 3300049592 Bacteria 2327
351 Ga0501076_0119673 3300049592 Bacteria 2132
352 Ga0501077_0032271 3300049593 Bacteria 3334
353 Ga0501201_000564 3300049651 Bacteria 3458
354 Ga0501202_001405 3300049652 Bacteria 3856
355 Ga0501206_003155 3300049653 Bacteria 2094
356 Ga0501216_004587 3300049660 Bacteria 2055
357 Ga0501217_002688 3300049661 Bacteria 3526
358 Ga0501223_006178 3300049663 Bacteria 2485
359 Ga0501242_001852 3300049674 Bacteria 2175
360 Ga0501251_001091 3300049681 Bacteria 2494
361 Ga0501253_002974 3300049683 Bacteria 1979
362 Ga0501259_000656 3300049688 Bacteria 5559
363 Ga0501261_001364 3300049690 Bacteria 2993
364 Ga0501221_000013 3300049704 Bacteria 22152
365 Ga0501234_000394 3300049707 Bacteria 6465
366 Ga0501245_000600 3300049708 Bacteria 4425
367 Ga0501079_0004032 3300049741 Bacteria 10870
368 Ga0501079_0019429 3300049741 Bacteria 5190
369 Ga0501080_0022325 3300049742 Bacteria 5862
370 Ga0501081_0003191 3300049743 Bacteria 10423
371 Ga0501268_001357 3300049765 Bacteria 3043
372 Ga0501283_001400 3300049779 Bacteria 3146
373 Ga0501035_0006639 3300049822 Bacteria 10827
374 Ga0501044_0004241 3300049823 Bacteria 16092
375 Ga0501045_0021155 3300049824 Bacteria 4651
376 nmdc:mga05p37_121177_c1 3300050507 Bacteria 3213
377 nmdc:mga05p37_50461_c1 3300050507 Bacteria 5117
378 nmdc:mga09592_22814_c1 3300050508 Bacteria 5164
379 nmdc:mga09592_36679_c1 3300050508 Bacteria 4108
380 nmdc:mga09592_40480_c1 3300050508 Unclassified 3915
381 nmdc:mga06r32_4427_c1 3300050510 Bacteria 12565
382 nmdc:mga08y16_24475_c1 3300050511 Bacteria 6372
383 Ga0500611_000004 3300053727 Bacteria 253326
384 Ga0501084_0020740 3300054114 Bacteria 5481
385 Ga0501082_0039244 3300060353 Bacteria 4085
386 Ga0530510_0004848 3300061734 Bacteria 9311
387 Ga0530510_0012950 3300061734 Bacteria 5866
388 Ga0530510_0018534 3300061734 Bacteria 4935
389 Ga0070683_100082959
390 JGI25406J46586_10006703
391 JGI25406J46586_10008251
392 JGI25406J46586_10011888
393 rootL2_10277312
394 Ga0065712_10002523
395 Ga0065712_10015818
396 Ga0065712_10073468
397 Ga0065715_10144938
398 Ga0065707_10106269
399 Ga0070658_10131467
400 Ga0070683_100000711
401 Ga0070683_100045079
402 Ga0070683_100078656
403 Ga0070683_100199006
404 Ga0070670_100035608
405 Ga0070670_100139830
406 Ga0070670_100147429
407 Ga0068869_100014100
408 Ga0068869_100037479
409 Ga0068869_100037738
410 Ga0068869_100067292
411 Ga0068869_100148676
412 Ga0070666_10060435
413 Ga0070666_10120412
414 Ga0070680_100023785
415 Ga0068868_100030774
416 Ga0068868_100126180
417 Ga0068868_100191234
418 Ga0070660_100032618
419 Ga0070660_100061106
420 Ga0070689_100076355
421 Ga0070661_100035523
422 Ga0070661_100073407
423 Ga0070661_100089454
424 Ga0070668_100113950
425 Ga0070669_100126080
426 Ga0070669_100172483
427 Ga0070675_100022427
428 Ga0070675_100027557
429 Ga0070675_100065238
430 Ga0070671_100054353
431 Ga0070671_100083141
432 Ga0070674_100100325
433 Ga0070673_100011228
434 Ga0070673_100093242
435 Ga0070659_100035539
436 Ga0070659_100043462
437 Ga0070667_100095101
438 Ga0070678_100030485
439 Ga0070662_100028786
440 Ga0070662_100095321
441 Ga0070681_10114938
442 Ga0068867_100015225
443 Ga0068867_100033289
444 Ga0068867_100036058
445 Ga0068867_100061148
446 Ga0070685_10004069
447 Ga0070685_10052892
448 Ga0070698_100005145
449 Ga0070698_100061482
450 Ga0070698_100071919
451 Ga0070679_100031127
452 Ga0070679_100069447
453 Ga0070679_100080831
454 Ga0070679_100105408
455 Ga0070684_100001934
456 Ga0070684_100040270
457 Ga0070684_100154704
458 Ga0070684_100182728
459 Ga0068853_100035864
460 Ga0068853_100043953
461 Ga0068853_100105702
462 Ga0068853_100140152
463 Ga0070672_100090545
464 Ga0070686_100012034
465 Ga0070665_100185338
466 Ga0068855_100048795
467 Ga0068855_100055796
468 Ga0070664_100006250
469 Ga0070664_100006493
470 Ga0070664_100050830
471 Ga0070664_100158482
472 Ga0068857_100010197
473 Ga0068857_100027126
474 Ga0068857_100074290
475 Ga0068857_100106667
476 Ga0068857_100181852
477 Ga0068854_100040924
478 Ga0068854_100074619
479 Ga0068856_100132280
480 Ga0068852_100019563
481 Ga0068852_100032847
482 Ga0068859_100003537
483 Ga0068859_100015913
484 Ga0068859_100040262
485 Ga0068859_100075765
486 Ga0068859_100114637
487 Ga0068864_100009851
488 Ga0068864_100019671
489 Ga0068864_100055904
490 Ga0068864_100133918
491 Ga0068861_100104960
492 Ga0068863_100029214
493 Ga0068863_100067041
494 Ga0068863_100158298
495 Ga0068858_100026468
496 Ga0068860_100009276
497 Ga0068860_100016865
498 Ga0068862_100002596
499 Ga0068862_100009951
500 Ga0068862_100010410
501 Ga0081539_10000252
502 Ga0081539_10000707
503 Ga0081539_10001570
504 Ga0081539_10016753
505 Ga0081539_10022807
506 Ga0097621_100000118
507 Ga0097621_100006187
508 Ga0097621_100006636
509 Ga0097621_100024672
510 Ga0068871_100001511
511 Ga0068871_100017861
512 Ga0075428_100006664
513 Ga0075428_100013038
514 Ga0075428_100042965
515 Ga0075428_100045535
516 Ga0075428_100056403
517 Ga0075430_100025669
518 Ga0075431_100023157
519 Ga0075431_100048461
520 Ga0075429_100003302
521 Ga0075429_100003886
522 Ga0068865_100107263
523 Ga0097620_100003537
524 Ga0097620_100015913
525 Ga0097620_100040262
526 Ga0097620_100075766
527 Ga0097620_100114635
528 Ga0111539_10009307
529 Ga0111539_10190429
530 Ga0111539_10195785
531 Ga0105247_10002541
532 Ga0114129_10007759
533 Ga0114129_10316733
534 Ga0105241_10029698
535 Ga0105242_10002571
536 Ga0105242_10065391
537 Ga0105242_10070981
538 Ga0105242_10183525
539 Ga0105242_10192065
540 Ga0105248_10100214
541 Ga0105237_10013353
542 Ga0105249_10003010
543 Ga0105249_10008356
544 Ga0105249_10012725
545 Ga0105249_10026212
546 Ga0105249_10092915
547 Ga0105239_10137964
548 Ga0157373_10024205
549 Ga0157373_10054477
550 Ga0157373_10076342
551 Ga0157371_10025316
552 Ga0157371_10080346
553 Ga0157371_10087898
554 Ga0157370_10150885
555 Ga0157369_10054798
556 Ga0157369_10120347
557 Ga0157374_10008638
558 Ga0157374_10014220
559 Ga0157374_10075825
560 Ga0157378_10008739
561 Ga0157378_10009769
562 Ga0157378_10032284
563 Ga0163162_10000086
564 Ga0163162_10004603
565 Ga0163162_10006420
566 Ga0163162_10021178
567 Ga0163162_10031301
568 Ga0163162_10042154
569 Ga0163162_10056918
570 Ga0163162_10096601
571 Ga0157372_10022840
572 Ga0157372_10167498
573 Ga0157372_10321540
574 Ga0157375_10000115
575 Ga0157375_10002992
576 Ga0157375_10126771
577 Ga0157375_10225929
578 Ga0163163_10000244
579 Ga0163163_10104921
580 Ga0163163_10109278
581 Ga0157380_10001228
582 Ga0157380_10020135
583 Ga0157380_10094665
584 Ga0182008_10002098
585 Ga0157377_10018392
586 Ga0157377_10021205
587 Ga0157377_10035752
588 Ga0157377_10076214
589 Ga0157379_10005725
590 Ga0157379_10011716
591 Ga0157379_10028462
592 Ga0157376_10000429
593 Ga0157376_10060824
594 Ga0157376_10153480
595 Ga0163161_10000888
596 Ga0163161_10005537
597 Ga0163161_10074511
598 Ga0213876_10005696
599 Ga0207710_10001416
600 Ga0207680_10040054
601 Ga0207645_10000193
602 Ga0207645_10020595
603 Ga0207643_10044115
604 Ga0207707_10096872
605 Ga0207671_10024738
606 Ga0207657_10109651
607 Ga0207649_10016210
608 Ga0207652_10110917
609 Ga0207652_10160879
610 Ga0207681_10001539
611 Ga0207681_10112254
612 Ga0207650_10003598
613 Ga0207650_10062861
614 Ga0207650_10107020
615 Ga0207650_10118603
616 Ga0207659_10126382
617 Ga0207644_10004244
618 Ga0207690_10074260
619 Ga0207706_10016244
620 Ga0207706_10026360
621 Ga0207706_10044788
622 Ga0207706_10067004
623 Ga0207686_10080952
624 Ga0207670_10012853
625 Ga0207670_10056083
626 Ga0207670_10110362
627 Ga0207669_10086489
628 Ga0207704_10069548
629 Ga0207691_10016995
630 Ga0207691_10040087
631 Ga0207691_10076465
632 Ga0207691_10084353
633 Ga0207711_10111447
634 Ga0207689_10004608
635 Ga0207689_10006148
636 Ga0207689_10011219
637 Ga0207689_10031624
638 Ga0207689_10033738
639 Ga0207689_10053039
640 Ga0207689_10064946
641 Ga0207661_10008977
642 Ga0207679_10090754
643 Ga0207667_10141844
644 Ga0207651_10030711
645 Ga0207651_10090328
646 Ga0207712_10007623
647 Ga0207712_10007675
648 Ga0207668_10041166
649 Ga0207640_10073705
650 Ga0207658_10024943
651 Ga0207658_10176240
652 Ga0207677_10060206
653 Ga0207677_10080320
654 Ga0207703_10166282
655 Ga0207639_10190127
656 Ga0207678_10038242
657 Ga0207708_10214624
658 Ga0207702_10028468
659 Ga0207641_10000416
660 Ga0207648_10063394
661 Ga0207648_10073585
662 Ga0207648_10124818
663 Ga0207676_10011991
664 Ga0207676_10071594
665 Ga0207676_10119433
666 Ga0207674_10011401
667 Ga0207674_10012226
668 Ga0207674_10013053
669 Ga0207674_10057301
670 Ga0207675_100003096
671 Ga0207675_100007992
672 Ga0207675_100028719
673 Ga0207683_10001560
674 Ga0207683_10026686
675 Ga0207698_10061008
676 Ga0207428_10007518
677 Ga0268264_10005081
678 Ga0268264_10007688
679 Ga0268264_10028518
680 Ga0316576_10000008
681 Ga0316576_10098369
682 Ga0373959_0000030
683 Ga0316574_0008947
684 Ga0373947_0142366
685 Ga0316584_0000923
686 Ga0316584_0037560
687 Ga0395905_0030373
688 Ga0395901_0075049
689 Ga0400485_05622
690 Ga0436365_0390857
691 Ga0451577_0068297
692 Ga0453684_0098263
693 Ga0451576_0254889
694 Ga0495629_0066904
695 Ga0495629_0112620
696 Ga0495650_0019475
697 Ga0495580_0125451
698 Ga0495594_0125256
699 Ga0495630_0078225
700 Ga0495598_0028896
701 Ga0495634_0006373
702 Ga0495684_0073690
703 Ga0495686_0005211
704 Ga0496114_0070683
705 Ga0501032_0001404
706 Ga0501033_0027751
707 Ga0501034_0007014
708 Ga0501036_0001169
709 Ga0501038_0021687
710 Ga0501038_0060373
711 Ga0501039_0019265
712 Ga0501039_0023831
713 Ga0501039_0099404
714 Ga0501040_0010940
715 Ga0501040_0013361
716 Ga0501041_0009663
717 Ga0501042_0001332
718 Ga0501043_0003535
719 Ga0501046_0004169
720 Ga0501046_0021487
721 Ga0501047_0012534
722 Ga0501047_0067961
723 Ga0501048_0013341
724 Ga0501068_0004384
725 Ga0501069_0055402
726 Ga0501070_0035699
727 Ga0501070_0068929
728 Ga0501071_0005000
729 Ga0501071_0053945
730 Ga0501071_0069979
731 Ga0501072_0041726
732 Ga0501073_0000839
733 Ga0501074_0002773
734 Ga0501074_0015627
735 Ga0501075_0006187
736 Ga0501075_0009169
737 Ga0501076_0032006
738 Ga0501076_0100759
739 Ga0501076_0119673
740 Ga0501077_0032271
741 Ga0501201_000564
742 Ga0501202_001405
743 Ga0501206_003155
744 Ga0501216_004587
745 Ga0501217_002688
746 Ga0501223_006178
747 Ga0501242_001852
748 Ga0501251_001091
749 Ga0501253_002974
750 Ga0501259_000656
751 Ga0501261_001364
752 Ga0501221_000013
753 Ga0501234_000394
754 Ga0501245_000600
755 Ga0501079_0004032
756 Ga0501079_0019429
757 Ga0501080_0022325
758 Ga0501081_0003191
759 Ga0501268_001357
760 Ga0501283_001400
761 Ga0501035_0006639
762 Ga0501044_0004241
763 Ga0501045_0021155
764 nmdc:mga05p37_121177_c1
765 nmdc:mga05p37_50461_c1
766 nmdc:mga09592_22814_c1
767 nmdc:mga09592_36679_c1
768 nmdc:mga09592_40480_c1
769 nmdc:mga06r32_4427_c1
770 nmdc:mga08y16_24475_c1
771 Ga0500611_000004
772 Ga0501084_0020740
773 Ga0501082_0039244
774 Ga0530510_0004848
775 Ga0530510_0012950
776 Ga0530510_0018534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18105

PGM1_C

PGM1 C-terminal domain

500

553

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wvr-assembly3.cif.gz_A structure of atp grasp protein with amp 0.8082 52 510
3wvq-assembly5.cif.gz_C structure of atp grasp protein 0.8054 52 513
3wvr-assembly3.cif.gz_A structure of atp grasp protein with amp 0.803 52 510
3wvq-assembly5.cif.gz_C structure of atp grasp protein 0.8001 52 513
3wvr-assembly6.cif.gz_D structure of atp grasp protein with amp 0.7954 52 510
ID Description Score Start End Superfamily
af_Q4DWU2_338_848_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9016 51 517 3.30.470.20
af_Q9D2K4_484_1031_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8921 51 519 3.30.470.20
af_Q1LXZ7_784_997_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8853 313 519 3.30.470.20
af_A0A0G2K4U9_654_956_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8833 193 442 3.30.470.20
af_Q86VS3_602_1001_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8796 193 519 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A800M6H0-F1-model_v4 Carboxylate-amine ligase 0.9935 79 519 GO:0016874
AF-A0A6J4QRQ9-F1-model_v4 PGM1 C-terminal domain-containing protein 0.9934 408 518
AF-A0A0M2PXM1-F1-model_v4 PGM1 C-terminal domain-containing protein 0.991 414 518
AF-A0A7W1FVA4-F1-model_v4 Carboxylate-amine ligase 0.9906 138 518 GO:0016874
AF-A0A2W0BRN7-F1-model_v4 PGM1 C-terminal domain-containing protein 0.9898 398 518

Map