F431256

General Info

Members Datasets Scaffolds Average Seq Length
388 231 386 217

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0120397|Ga0501071_0120397_133_843
Length 236
Sequence VQIAIFAYDHMTALDAVGPYEVLSRLPGAEVVVVGEQRGPVRCDTRSLALVADAALDDVTTPDVVVIPGWSGSRQCNLLRPGPVQDWLRAVDGHTTWTTAVGTGGIVLAAAGLLAGRRATTYWLTVDWLAELGAVPADERVVREGKYVTAAGVTAGIDMGLALAARIAGEQTAKAIQLLVEYDPQPPFTCGSVATAPPEIVAPLRALRPFIVNGAPEGDGNSEKSEGVRPMAHRAP

Samples

Sample ID Description Type Environment
1 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
2 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0.52
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 3.87
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10278923 3300003322 Bacteria 1046
2 Ga0006562J51391_1162525 3300003578 Bacteria 1660
3 Ga0070658_10181092 3300005327 Bacteria 1773
4 Ga0070676_10000345 3300005328 Bacteria 21264
5 Ga0070676_10372386 3300005328 Bacteria 987
6 Ga0070670_100030889 3300005331 Bacteria 4614
7 Ga0070677_10021875 3300005333 Bacteria 2350
8 Ga0068869_100001452 3300005334 Bacteria 14017
9 Ga0068869_100081323 3300005334 Bacteria 2419
10 Ga0070680_100000565 3300005336 Bacteria 25380
11 Ga0070682_100011794 3300005337 Bacteria 4999
12 Ga0070682_100445497 3300005337 Bacteria 990
13 Ga0068868_100041899 3300005338 Bacteria 3570
14 Ga0070660_100018299 3300005339 Bacteria 5117
15 Ga0070660_100041676 3300005339 Bacteria 3500
16 Ga0070660_100100681 3300005339 Bacteria 2289
17 Ga0070691_10061639 3300005341 Bacteria 1804
18 Ga0070691_10103106 3300005341 Bacteria 1419
19 Ga0070687_100010202 3300005343 Bacteria 4052
20 Ga0070661_100000993 3300005344 Bacteria 20123
21 Ga0070692_10011437 3300005345 Bacteria 4074
22 Ga0070692_10064164 3300005345 Bacteria 1942
23 Ga0070668_100575983 3300005347 Bacteria 982
24 Ga0070669_100083101 3300005353 Bacteria 2388
25 Ga0070671_100305348 3300005355 Bacteria 1355
26 Ga0070688_100366835 3300005365 Bacteria 1058
27 Ga0070659_100000377 3300005366 Bacteria 33695
28 Ga0070703_10026593 3300005406 Bacteria 1721
29 Ga0070714_100000163 3300005435 Bacteria 53786
30 Ga0070713_100117442 3300005436 Bacteria 2328
31 Ga0070710_10174918 3300005437 Bacteria 1340
32 Ga0070711_100001758 3300005439 Bacteria 12021
33 Ga0070705_100009173 3300005440 Bacteria 4911
34 Ga0070700_100281923 3300005441 Bacteria 1205
35 Ga0070694_100008088 3300005444 Bacteria 6424
36 Ga0070694_100026879 3300005444 Bacteria 3734
37 Ga0070708_100019212 3300005445 Bacteria 5738
38 Ga0070663_100022883 3300005455 Bacteria 4182
39 Ga0070662_100007534 3300005457 Bacteria 7061
40 Ga0070681_10390190 3300005458 Bacteria 1303
41 Ga0068867_100003302 3300005459 Bacteria 11361
42 Ga0070685_10165776 3300005466 Bacteria 1412
43 Ga0070685_10274353 3300005466 Bacteria 1126
44 Ga0070706_100010715 3300005467 Bacteria 8509
45 Ga0070707_100055560 3300005468 Bacteria 3796
46 Ga0070707_100145414 3300005468 Bacteria 2308
47 Ga0070707_100197811 3300005468 Bacteria 1959
48 Ga0070707_101041540 3300005468 Bacteria 784
49 Ga0070679_100028993 3300005530 Bacteria 5460
50 Ga0070679_100056501 3300005530 Bacteria 3911
51 Ga0070684_100981517 3300005535 Bacteria 792
52 Ga0070697_100221057 3300005536 Bacteria 1614
53 Ga0068853_100023899 3300005539 Bacteria 5122
54 Ga0070672_100031194 3300005543 Bacteria 4010
55 Ga0070695_100002346 3300005545 Bacteria 10861
56 Ga0070695_100870070 3300005545 Bacteria 726
57 Ga0070696_100002742 3300005546 Bacteria 11687
58 Ga0070696_100004112 3300005546 Bacteria 9700
59 Ga0070696_100360191 3300005546 Bacteria 1129
60 Ga0070693_100000929 3300005547 Bacteria 12998
61 Ga0070704_100002122 3300005549 Bacteria 11035
62 Ga0070704_100018081 3300005549 Bacteria 4498
63 Ga0070704_100097862 3300005549 Bacteria 2203
64 Ga0068855_100017721 3300005563 Bacteria 8563
65 Ga0068857_100163329 3300005577 Bacteria 2021
66 Ga0068854_100004148 3300005578 Bacteria 9108
67 Ga0068856_100001687 3300005614 Bacteria 23089
68 Ga0068856_100190586 3300005614 Bacteria 2064
69 Ga0070702_100002523 3300005615 Bacteria 7940
70 Ga0068859_100007912 3300005617 Bacteria 10781
71 Ga0068861_100067767 3300005719 Bacteria 2756
72 Ga0068861_100425477 3300005719 Bacteria 1184
73 Ga0068870_10001427 3300005840 Bacteria 9660
74 Ga0068863_100019605 3300005841 Bacteria 6470
75 Ga0068863_100772670 3300005841 Bacteria 957
76 Ga0068860_100026389 3300005843 Bacteria 5600
77 Ga0068860_100262144 3300005843 Bacteria 1685
78 Ga0068862_100019157 3300005844 Bacteria 5706
79 Ga0068862_100408951 3300005844 Bacteria 1271
80 Ga0081455_10000135 3300005937 Bacteria 87177
81 Ga0081538_10000357 3300005981 Bacteria 51919
82 Ga0097621_100156248 3300006237 Bacteria 1958
83 Ga0075428_100000002 3300006844 Bacteria 546374
84 Ga0075428_100083607 3300006844 Bacteria 3483
85 Ga0075428_100168837 3300006844 Bacteria 2373
86 Ga0075428_100210153 3300006844 Bacteria 2103
87 Ga0075428_100293041 3300006844 Bacteria 1750
88 Ga0075430_100127518 3300006846 Bacteria 2121
89 Ga0075430_100314308 3300006846 Bacteria 1295
90 Ga0075433_10028414 3300006852 Bacteria 4754
91 Ga0075434_100061171 3300006871 Bacteria 3746
92 Ga0075429_100842102 3300006880 Bacteria 803
93 Ga0075436_100008603 3300006914 Bacteria 6976
94 Ga0097620_100007912 3300006931 Bacteria 10781
95 Ga0075435_100019476 3300007076 Bacteria 5185
96 Ga0111539_10227701 3300009094 Bacteria 2171
97 Ga0111539_10367781 3300009094 Bacteria 1674
98 Ga0105245_10095505 3300009098 Bacteria 2742
99 Ga0105245_10155731 3300009098 Bacteria 2164
100 Ga0105245_11553931 3300009098 Bacteria 713
101 Ga0114129_10069272 3300009147 Bacteria 4917
102 Ga0114129_10383139 3300009147 Bacteria 1857
103 Ga0114129_10505387 3300009147 Bacteria 1578
104 Ga0114129_10743846 3300009147 Bacteria 1256
105 Ga0114129_11483580 3300009147 Bacteria 834
106 Ga0105243_10131163 3300009148 Bacteria 2126
107 Ga0105241_10010031 3300009174 Bacteria 6956
108 Ga0105242_10862200 3300009176 Bacteria 902
109 Ga0105249_10141316 3300009553 Bacteria 2309
110 Ga0105239_10414870 3300010375 Bacteria 1525
111 Ga0105246_10002437 3300011119 Bacteria 11226
112 Ga0105246_10093397 3300011119 Bacteria 2173
113 Ga0157373_10000671 3300013100 Bacteria 26720
114 Ga0157369_10010014 3300013105 Bacteria 10828
115 Ga0163162_10195178 3300013306 Bacteria 2153
116 Ga0157372_10000646 3300013307 Bacteria 38275
117 Ga0157372_10542623 3300013307 Bacteria 1355
118 Ga0157375_10096324 3300013308 Bacteria 3032
119 Ga0157375_10961431 3300013308 Bacteria 995
120 Ga0163163_10041235 3300014325 Bacteria 4513
121 Ga0157380_10496870 3300014326 Bacteria 1184
122 Ga0157377_10110370 3300014745 Bacteria 1652
123 Ga0157379_10664928 3300014968 Bacteria 976
124 Ga0206354_10166421 3300020081 Bacteria 985
125 Ga0213876_10073036 3300021384 Bacteria 1811
126 Ga0207653_10010038 3300025885 Bacteria 2952
127 Ga0207682_10083287 3300025893 Bacteria 1375
128 Ga0207692_10353076 3300025898 Bacteria 907
129 Ga0207645_10003896 3300025907 Bacteria 11157
130 Ga0207643_10000355 3300025908 Bacteria 30699
131 Ga0207705_10309116 3300025909 Bacteria 1213
132 Ga0207684_10001611 3300025910 Bacteria 23952
133 Ga0207684_10304180 3300025910 Bacteria 1375
134 Ga0207654_10050204 3300025911 Bacteria 2396
135 Ga0207707_10000047 3300025912 Bacteria 118016
136 Ga0207663_10001192 3300025916 Bacteria 12004
137 Ga0207660_10041981 3300025917 Bacteria 3208
138 Ga0207662_10018911 3300025918 Bacteria 3913
139 Ga0207657_10000021 3300025919 Bacteria 155900
140 Ga0207657_10002303 3300025919 Bacteria 20690
141 Ga0207657_10649308 3300025919 Bacteria 821
142 Ga0207649_10059444 3300025920 Bacteria 2398
143 Ga0207652_10000582 3300025921 Bacteria 36770
144 Ga0207652_10041008 3300025921 Bacteria 3933
145 Ga0207652_10136574 3300025921 Bacteria 2190
146 Ga0207646_10094820 3300025922 Bacteria 2673
147 Ga0207646_10169961 3300025922 Bacteria 1968
148 Ga0207646_10337888 3300025922 Bacteria 1361
149 Ga0207646_10514428 3300025922 Bacteria 1078
150 Ga0207646_10974875 3300025922 Bacteria 750
151 Ga0207681_10015719 3300025923 Bacteria 4725
152 Ga0207650_10011270 3300025925 Bacteria 6150
153 Ga0207687_10113298 3300025927 Bacteria 2017
154 Ga0207687_10371684 3300025927 Bacteria 1169
155 Ga0207687_10598733 3300025927 Bacteria 929
156 Ga0207664_10002138 3300025929 Bacteria 13006
157 Ga0207664_10682555 3300025929 Bacteria 923
158 Ga0207690_10026791 3300025932 Bacteria 3634
159 Ga0207690_10838581 3300025932 Bacteria 761
160 Ga0207706_10011731 3300025933 Bacteria 7986
161 Ga0207709_10725882 3300025935 Bacteria 797
162 Ga0207665_10820886 3300025939 Bacteria 735
163 Ga0207691_10039543 3300025940 Bacteria 4363
164 Ga0207689_10000697 3300025942 Bacteria 32204
165 Ga0207689_10013135 3300025942 Bacteria 7067
166 Ga0207689_10038318 3300025942 Bacteria 3971
167 Ga0207661_10035728 3300025944 Bacteria 3875
168 Ga0207679_10001442 3300025945 Bacteria 14946
169 Ga0207679_10279630 3300025945 Bacteria 1431
170 Ga0207667_10000620 3300025949 Bacteria 45914
171 Ga0207667_10374753 3300025949 Bacteria 1450
172 Ga0207668_10200726 3300025972 Bacteria 1588
173 Ga0207640_10038060 3300025981 Bacteria 3032
174 Ga0207703_10456872 3300026035 Bacteria 1194
175 Ga0207639_10030653 3300026041 Bacteria 3946
176 Ga0207678_10179646 3300026067 Bacteria 1807
177 Ga0207702_10028302 3300026078 Bacteria 4657
178 Ga0207702_10119567 3300026078 Bacteria 2356
179 Ga0207641_10058539 3300026088 Bacteria 3279
180 Ga0207648_10001227 3300026089 Bacteria 28750
181 Ga0207648_10353230 3300026089 Bacteria 1325
182 Ga0207676_10047953 3300026095 Bacteria 3313
183 Ga0207674_10043184 3300026116 Bacteria 4649
184 Ga0207675_100005398 3300026118 Bacteria 12247
185 Ga0207675_100505116 3300026118 Bacteria 1204
186 Ga0209969_1002709 3300027360 Bacteria 2456
187 Ga0209968_1002022 3300027526 Bacteria 3082
188 Ga0209971_1000018 3300027682 Bacteria 65254
189 Ga0209966_1000141 3300027695 Bacteria 30369
190 Ga0209998_10000020 3300027717 Bacteria 77474
191 Ga0209974_10006177 3300027876 Bacteria 4196
192 Ga0268265_10013767 3300028380 Bacteria 5505
193 Ga0268265_10327797 3300028380 Bacteria 1389
194 Ga0268264_10018768 3300028381 Bacteria 5654
195 Ga0268264_10097767 3300028381 Bacteria 2545
196 Ga0265325_10006391 3300031241 Bacteria 7150
197 Ga0265314_10332333 3300031711 Bacteria 842
198 Ga0307413_10143733 3300031824 Bacteria 1652
199 Ga0307413_10722523 3300031824 Bacteria 830
200 Ga0307410_10281905 3300031852 Bacteria 1304
201 Ga0307412_10636253 3300031911 Bacteria 908
202 Ga0307409_100301012 3300031995 Bacteria 1492
203 Ga0307409_100890438 3300031995 Bacteria 903
204 Ga0307415_100070319 3300032126 Bacteria 2457
205 Ga0307415_100543724 3300032126 Bacteria 1024
206 Ga0373959_0054829 3300034820 Bacteria 869
207 Ga0373932_0038064 3300035112 Bacteria 1374
208 Ga0373939_0012282 3300035114 Bacteria 2181
209 Ga0373962_0019391 3300035242 Bacteria 1779
210 Ga0395899_0024269 3300037312 Bacteria 4586
211 Ga0395899_0059564 3300037312 Bacteria 2815
212 Ga0395900_0007097 3300037418 Bacteria 11607
213 Ga0395900_0011647 3300037418 Bacteria 8997
214 Ga0395898_0001355 3300037466 Bacteria 35270
215 Ga0395898_0035740 3300037466 Bacteria 4937
216 Ga0436364_1416572 3300037853 Bacteria 7940
217 Ga0395901_0000999 3300038443 Bacteria 30559
218 Ga0395901_0541324 3300038443 Bacteria 1181
219 Ga0436365_1035815 3300039437 Bacteria 5701
220 Ga0436361_0642059 3300039447 Bacteria 1460
221 Ga0439441_007678 3300042001 Bacteria 1746
222 Ga0439448_0113283 3300042005 Bacteria 928
223 Ga0439458_0023733 3300042157 Bacteria 1431
224 Ga0439459_0002452 3300042438 Bacteria 2860
225 Ga0439464_0044507 3300042439 Bacteria 1272
226 Ga0439460_0000312 3300042461 Bacteria 10222
227 Ga0451577_0014859 3300042876 Bacteria 7254
228 Ga0451577_0027209 3300042876 Bacteria 5175
229 Ga0451577_0325695 3300042876 Bacteria 1393
230 Ga0466972_0012097 3300044658 Bacteria 4335
231 Ga0466965_0144562 3300044683 Bacteria 1240
232 Ga0466966_0012193 3300044684 Bacteria 5694
233 Ga0466964_0268143 3300044706 Bacteria 848
234 Ga0453684_0000580 3300044712 Bacteria 136230
235 Ga0453684_0002596 3300044712 Bacteria 43215
236 Ga0453684_0004050 3300044712 Bacteria 31860
237 Ga0453684_0016123 3300044712 Bacteria 11722
238 Ga0453684_0394223 3300044712 Bacteria 1552
239 Ga0453684_0672469 3300044712 Bacteria 1128
240 Ga0466968_0106499 3300044735 Bacteria 1257
241 Ga0466968_0180801 3300044735 Bacteria 981
242 Ga0466970_0203496 3300044765 Bacteria 1102
243 Ga0466957_0005518 3300044842 Bacteria 7102
244 Ga0466960_0005773 3300044901 Bacteria 4927
245 Ga0466960_0040770 3300044901 Bacteria 2197
246 Ga0466960_0356078 3300044901 Bacteria 836
247 Ga0466959_0649714 3300045049 Bacteria 708
248 Ga0451576_0103146 3300045051 Bacteria 2967
249 Ga0451576_0140007 3300045051 Bacteria 2523
250 Ga0466958_0097700 3300045836 Bacteria 1823
251 Ga0466958_0130299 3300045836 Bacteria 1579
252 Ga0466967_0071798 3300045976 Bacteria 3100
253 Ga0466967_0340615 3300045976 Bacteria 1450
254 Ga0495630_0065656 3300046517 Bacteria 2727
255 Ga0495667_0258752 3300046559 Bacteria 1107
256 Ga0495672_0009649 3300047320 Bacteria 6966
257 Ga0495593_0256668 3300047673 Bacteria 875
258 Ga0496102_0126615 3300048905 Bacteria 2388
259 Ga0496102_0128122 3300048905 Bacteria 2374
260 Ga0496102_0663017 3300048905 Bacteria 966
261 Ga0496103_0083359 3300048906 Bacteria 2013
262 Ga0496106_0386010 3300048909 Bacteria 1125
263 Ga0496107_0552390 3300048910 Bacteria 853
264 Ga0496108_0738707 3300048911 Bacteria 852
265 Ga0496109_0055264 3300048912 Bacteria 3621
266 Ga0496110_0209455 3300048913 Bacteria 1772
267 Ga0496110_0463483 3300048913 Bacteria 1155
268 Ga0496111_0134330 3300048914 Bacteria 1832
269 Ga0496111_0144466 3300048914 Bacteria 1763
270 Ga0496111_0201204 3300048914 Bacteria 1481
271 Ga0496112_0241787 3300048915 Bacteria 1758
272 Ga0496114_0184278 3300048917 Bacteria 1824
273 Ga0501031_0060542 3300049568 Bacteria 2467
274 Ga0501031_0064933 3300049568 Bacteria 2378
275 Ga0501031_0450561 3300049568 Bacteria 831
276 Ga0501032_0284021 3300049569 Bacteria 1071
277 Ga0501033_0012942 3300049570 Bacteria 6363
278 Ga0501033_0052594 3300049570 Bacteria 3018
279 Ga0501036_0008153 3300049572 Bacteria 8585
280 Ga0501036_0118502 3300049572 Bacteria 2236
281 Ga0501037_0125554 3300049573 Bacteria 1843
282 Ga0501037_0176231 3300049573 Bacteria 1518
283 Ga0501038_0050743 3300049574 Bacteria 3584
284 Ga0501038_0055249 3300049574 Bacteria 3412
285 Ga0501038_0148834 3300049574 Bacteria 1910
286 Ga0501039_0004889 3300049575 Bacteria 10154
287 Ga0501039_0037433 3300049575 Bacteria 3744
288 Ga0501039_0363894 3300049575 Bacteria 1136
289 Ga0501040_0001172 3300049576 Bacteria 16669
290 Ga0501040_0006432 3300049576 Bacteria 7630
291 Ga0501040_0181703 3300049576 Bacteria 1491
292 Ga0501041_0005463 3300049577 Bacteria 7443
293 Ga0501041_0011684 3300049577 Bacteria 5196
294 Ga0501041_0037911 3300049577 Bacteria 2922
295 Ga0501042_0015939 3300049578 Bacteria 5154
296 Ga0501042_0038929 3300049578 Bacteria 3377
297 Ga0501042_0078861 3300049578 Bacteria 2359
298 Ga0501043_0401436 3300049579 Bacteria 1036
299 Ga0501046_0000473 3300049580 Bacteria 40255
300 Ga0501046_0023840 3300049580 Bacteria 5028
301 Ga0501047_0020168 3300049581 Bacteria 6400
302 Ga0501047_0025293 3300049581 Bacteria 5706
303 Ga0501048_0005628 3300049582 Bacteria 9530
304 Ga0501048_0051734 3300049582 Bacteria 2923
305 Ga0501067_0073531 3300049583 Bacteria 1894
306 Ga0501070_0342574 3300049586 Bacteria 1214
307 Ga0501070_0442310 3300049586 Bacteria 1049
308 Ga0501071_0018292 3300049587 Bacteria 4850
309 Ga0501071_0040727 3300049587 Bacteria 3325
310 Ga0501071_0060756 3300049587 Bacteria 2736
311 Ga0501071_0120397 3300049587 Bacteria 1945
312 Ga0501072_0022748 3300049588 Bacteria 4864
313 Ga0501072_0075708 3300049588 Bacteria 2662
314 Ga0501072_0308792 3300049588 Bacteria 1257
315 Ga0501072_0311772 3300049588 Bacteria 1251
316 Ga0501072_0401575 3300049588 Bacteria 1087
317 Ga0501072_0423678 3300049588 Bacteria 1055
318 Ga0501074_0019690 3300049590 Bacteria 4899
319 Ga0501075_0007563 3300049591 Bacteria 7539
320 Ga0501075_0014598 3300049591 Bacteria 5629
321 Ga0501075_0038667 3300049591 Bacteria 3568
322 Ga0501075_0057301 3300049591 Bacteria 2933
323 Ga0501076_0007967 3300049592 Bacteria 7731
324 Ga0501076_0010548 3300049592 Bacteria 6859
325 Ga0501076_0010733 3300049592 Bacteria 6810
326 Ga0501076_0170756 3300049592 Bacteria 1772
327 Ga0501076_0324864 3300049592 Bacteria 1262
328 Ga0501077_0001053 3300049593 Bacteria 16630
329 Ga0501077_0023921 3300049593 Bacteria 3875
330 Ga0501077_0058125 3300049593 Bacteria 2455
331 Ga0501079_0000497 3300049741 Bacteria 25626
332 Ga0501079_0001001 3300049741 Bacteria 19537
333 Ga0501079_0010916 3300049741 Bacteria 6920
334 Ga0501079_0039687 3300049741 Bacteria 3631
335 Ga0501080_0040260 3300049742 Bacteria 4359
336 Ga0501080_0130249 3300049742 Bacteria 2329
337 Ga0501081_0005528 3300049743 Bacteria 8158
338 Ga0501081_0006164 3300049743 Bacteria 7764
339 Ga0501081_0027518 3300049743 Bacteria 3834
340 Ga0501081_0053784 3300049743 Bacteria 2780
341 Ga0501083_0000755 3300049744 Bacteria 21112
342 Ga0501083_0029094 3300049744 Bacteria 3804
343 Ga0501083_0041058 3300049744 Bacteria 3139
344 Ga0501083_0094736 3300049744 Bacteria 1971
345 Ga0501035_0412752 3300049822 Bacteria 1122
346 Ga0501045_0001532 3300049824 Bacteria 15398
347 Ga0501045_0028186 3300049824 Bacteria 4050
348 Ga0501045_0061644 3300049824 Bacteria 2752
349 Ga0501045_0234012 3300049824 Bacteria 1368
350 nmdc:mga05p37_277710_c1 3300050507 Bacteria 1999
351 nmdc:mga05p37_33822_c1 3300050507 Bacteria 6262
352 nmdc:mga05p37_372824_c1 3300050507 Bacteria 1674
353 nmdc:mga05p37_422889_c1 3300050507 Bacteria 1550
354 nmdc:mga05p37_84003_c1 3300050507 Bacteria 3923
355 nmdc:mga05p37_94921_c1 3300050507 Bacteria 3674
356 nmdc:mga09592_491246_c1 3300050508 Bacteria 1057
357 nmdc:mga0qj67_181252_c1 3300050509 Bacteria 1711
358 nmdc:mga0qj67_325118_c1 3300050509 Bacteria 1245
359 nmdc:mga06r32_240125_c1 3300050510 Bacteria 1799
360 nmdc:mga06r32_330849_c1 3300050510 Bacteria 1508
361 nmdc:mga08y16_405752_c1 3300050511 Bacteria 1394
362 nmdc:mga08y16_59495_c1 3300050511 Bacteria 3990
363 nmdc:mga08y16_741188_c1 3300050511 Bacteria 979
364 nmdc:mga0n895_108451_c1 3300050512 Bacteria 2791
365 nmdc:mga0n895_332653_c1 3300050512 Bacteria 1539
366 nmdc:mga0rr50_23510_c1 3300050513 Bacteria 4251
367 nmdc:mga08x19_33641_c1 3300050514 Bacteria 3235
368 nmdc:mga08x19_9436_c1 3300050514 Bacteria 5844
369 nmdc:mga0a205_199054_c1 3300050515 Bacteria 1894
370 nmdc:mga0a205_337820_c1 3300050515 Bacteria 1375
371 Ga0495655_0025739 3300053083 Bacteria 1379
372 Ga0500641_0115002 3300053096 Bacteria 1159
373 Ga0501084_0003081 3300054114 Bacteria 13518
374 Ga0501084_0011520 3300054114 Bacteria 7322
375 Ga0501084_0023752 3300054114 Bacteria 5113
376 Ga0501084_0105908 3300054114 Bacteria 2362
377 Ga0501084_0711010 3300054114 Bacteria 847
378 Ga0501082_0000407 3300060353 Bacteria 38099
379 Ga0501082_0011289 3300060353 Bacteria 7679
380 Ga0501082_0027415 3300060353 Bacteria 4904
381 Ga0501082_0030527 3300060353 Bacteria 4645
382 Ga0501082_0459829 3300060353 Bacteria 1112
383 Ga0530510_0006398 3300061734 Bacteria 8200
384 Ga0530510_0011536 3300061734 Bacteria 6201
385 Ga0530510_0098296 3300061734 Bacteria 2140
386 Ga0530510_0302053 3300061734 Bacteria 1198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100041899 Ga0068868_1000418992 173
2 3300045049 Ga0466959_0649714 Ga0466959_0649714_146_688 178
3 3300031711 Ga0265314_10332333 Ga0265314_103323331 181
4 3300013100 Ga0157373_10000671 Ga0157373_100006714 182
5 3300049741 Ga0501079_0039687 Ga0501079_0039687_3015_3608 182
6 3300005468 Ga0070707_100055560 Ga0070707_1000555603 184
7 3300025922 Ga0207646_10094820 Ga0207646_100948202 184
8 3300044901 Ga0466960_0356078 Ga0466960_0356078_10_579 184
9 3300025932 Ga0207690_10838581 Ga0207690_108385812 186
10 3300025939 Ga0207665_10820886 Ga0207665_108208862 186
11 3300044712 Ga0453684_0004050 Ga0453684_0004050_17769_18416 187
12 3300005458 Ga0070681_10390190 Ga0070681_103901902 188
13 3300005530 Ga0070679_100056501 Ga0070679_1000565018 188
14 3300006844 Ga0075428_100000002 Ga0075428_100000002427 188
15 3300025921 Ga0207652_10041008 Ga0207652_100410082 188
16 3300025949 Ga0207667_10374753 Ga0207667_103747532 188
17 3300053096 Ga0500641_0115002 Ga0500641_0115002_441_1073 189
18 3300039447 Ga0436361_0642059 Ga0436361_0642059_732_1379 190
19 3300005530 Ga0070679_100028993 Ga0070679_1000289933 191
20 3300025921 Ga0207652_10136574 Ga0207652_101365742 191
21 3300025927 Ga0207687_10598733 Ga0207687_105987332 191
22 3300005339 Ga0070660_100100681 Ga0070660_1001006812 192
23 3300046517 Ga0495630_0065656 Ga0495630_0065656_808_1464 192
24 3300046559 Ga0495667_0258752 Ga0495667_0258752_83_739 192
25 3300049742 Ga0501080_0130249 Ga0501080_0130249_1660_2313 192
26 3300005439 Ga0070711_100001758 Ga0070711_1000017587 195
27 3300025916 Ga0207663_10001192 Ga0207663_100011928 195
28 3300005468 Ga0070707_101041540 Ga0070707_1010415401 196
29 3300025922 Ga0207646_10514428 Ga0207646_105144281 196
30 3300044712 Ga0453684_0000580 Ga0453684_0000580_127873_128535 196
31 3300045836 Ga0466958_0097700 Ga0466958_0097700_86_721 196
32 3300005467 Ga0070706_100010715 Ga0070706_1000107157 197
33 3300009147 Ga0114129_10743846 Ga0114129_107438462 197
34 3300025910 Ga0207684_10001611 Ga0207684_100016112 197
35 3300050511 nmdc:mga08y16_405752_c1 nmdc:mga08y16_405752_c1_225_878 198
36 3300011119 Ga0105246_10002437 Ga0105246_100024373 199
37 3300044712 Ga0453684_0002596 Ga0453684_0002596_36857_37516 199
38 3300044712 Ga0453684_0016123 Ga0453684_0016123_190_852 199
39 3300044712 Ga0453684_0394223 Ga0453684_0394223_855_1520 199
40 3300050511 nmdc:mga08y16_59495_c1 nmdc:mga08y16_59495_c1_542_1195 200
41 3300005327 Ga0070658_10181092 Ga0070658_101810922 201
42 3300005339 Ga0070660_100041676 Ga0070660_1000416766 201
43 3300025909 Ga0207705_10309116 Ga0207705_103091163 201
44 3300025919 Ga0207657_10002303 Ga0207657_1000230328 201
45 3300025922 Ga0207646_10974875 Ga0207646_109748751 201
46 3300005334 Ga0068869_100081323 Ga0068869_1000813231 202
47 3300005343 Ga0070687_100010202 Ga0070687_1000102023 202
48 3300005365 Ga0070688_100366835 Ga0070688_1003668352 202
49 3300005466 Ga0070685_10274353 Ga0070685_102743531 202
50 3300005841 Ga0068863_100772670 Ga0068863_1007726702 202
51 3300025918 Ga0207662_10018911 Ga0207662_100189115 202
52 3300025942 Ga0207689_10038318 Ga0207689_100383183 202
53 3300005468 Ga0070707_100145414 Ga0070707_1001454143 203
54 3300025922 Ga0207646_10337888 Ga0207646_103378881 203
55 3300049581 Ga0501047_0025293 Ga0501047_0025293_3305_3967 204
56 3300049744 Ga0501083_0000755 Ga0501083_0000755_11223_11885 204
57 3300054114 Ga0501084_0105908 Ga0501084_0105908_1209_1871 204
58 3300060353 Ga0501082_0030527 Ga0501082_0030527_2057_2719 204
59 3300005435 Ga0070714_100000163 Ga0070714_1000001636 205
60 3300005436 Ga0070713_100117442 Ga0070713_1001174423 205
61 3300025929 Ga0207664_10002138 Ga0207664_100021383 205
62 3300005546 Ga0070696_100360191 Ga0070696_1003601911 206
63 3300021384 Ga0213876_10073036 Ga0213876_100730362 207
64 3300039437 Ga0436365_1035815 Ga0436365_1035815_287_940 207
65 3300042876 Ga0451577_0027209 Ga0451577_0027209_3392_4015 207
66 iso_pu_bacteria 2808606359 2808845283 207
67 3300006844 Ga0075428_100293041 Ga0075428_1002930412 208
68 3300009094 Ga0111539_10227701 Ga0111539_102277012 208
69 3300049588 Ga0501072_0075708 Ga0501072_0075708_52_708 208
70 3300049588 Ga0501072_0401575 Ga0501072_0401575_42_752 208
71 3300049588 Ga0501072_0423678 Ga0501072_0423678_205_858 208
72 3300049592 Ga0501076_0324864 Ga0501076_0324864_423_1076 208
73 iso_pu_bacteria 2870782633 2870783998 208
74 3300005337 Ga0070682_100445497 Ga0070682_1004454972 209
75 3300005466 Ga0070685_10165776 Ga0070685_101657762 209
76 3300009098 Ga0105245_10095505 Ga0105245_100955052 209
77 3300009148 Ga0105243_10131163 Ga0105243_101311631 209
78 3300013307 Ga0157372_10542623 Ga0157372_105426232 209
79 3300025935 Ga0207709_10725882 Ga0207709_107258821 209
80 3300044706 Ga0466964_0268143 Ga0466964_0268143_88_732 209
81 3300044842 Ga0466957_0005518 Ga0466957_0005518_5731_6375 209
82 3300045836 Ga0466958_0130299 Ga0466958_0130299_215_859 209
83 3300045976 Ga0466967_0071798 Ga0466967_0071798_216_860 209
84 3300047673 Ga0495593_0256668 Ga0495593_0256668_164_832 209
85 3300048905 Ga0496102_0663017 Ga0496102_0663017_129_797 209
86 3300048913 Ga0496110_0463483 Ga0496110_0463483_166_834 209
87 3300048917 Ga0496114_0184278 Ga0496114_0184278_710_1378 209
88 3300005981 Ga0081538_10000357 Ga0081538_1000035741 210
89 3300006844 Ga0075428_100210153 Ga0075428_1002101533 210
90 3300009098 Ga0105245_11553931 Ga0105245_115539311 210
91 3300009147 Ga0114129_11483580 Ga0114129_114835802 210
92 3300009176 Ga0105242_10862200 Ga0105242_108622002 210
93 3300025910 Ga0207684_10304180 Ga0207684_103041802 210
94 3300025919 Ga0207657_10649308 Ga0207657_106493082 210
95 3300031824 Ga0307413_10722523 Ga0307413_107225231 210
96 3300037853 Ga0436364_1416572 Ga0436364_1416572_3675_4307 210
97 3300038443 Ga0395901_0541324 Ga0395901_0541324_100_732 210
98 3300048905 Ga0496102_0128122 Ga0496102_0128122_651_1283 210
99 3300048910 Ga0496107_0552390 Ga0496107_0552390_90_722 210
100 3300049579 Ga0501043_0401436 Ga0501043_0401436_50_682 210
101 3300003578 Ga0006562J51391_1162525 Ga0006562J51391_11625252 211
102 3300005441 Ga0070700_100281923 Ga0070700_1002819232 211
103 3300005445 Ga0070708_100019212 Ga0070708_1000192123 211
104 3300005468 Ga0070707_100197811 Ga0070707_1001978112 211
105 3300005545 Ga0070695_100870070 Ga0070695_1008700701 211
106 3300005549 Ga0070704_100018081 Ga0070704_1000180812 211
107 3300005614 Ga0068856_100190586 Ga0068856_1001905862 211
108 3300006844 Ga0075428_100083607 Ga0075428_1000836072 211
109 3300013308 Ga0157375_10961431 Ga0157375_109614311 211
110 3300025922 Ga0207646_10169961 Ga0207646_101699612 211
111 3300026078 Ga0207702_10119567 Ga0207702_101195673 211
112 3300037418 Ga0395900_0011647 Ga0395900_0011647_7304_7942 211
113 3300037466 Ga0395898_0001355 Ga0395898_0001355_25345_25983 211
114 3300044901 Ga0466960_0005773 Ga0466960_0005773_3070_3705 211
115 3300006844 Ga0075428_100168837 Ga0075428_1001688372 212
116 3300006846 Ga0075430_100127518 Ga0075430_1001275182 212
117 3300009147 Ga0114129_10069272 Ga0114129_100692723 212
118 3300044901 Ga0466960_0040770 Ga0466960_0040770_1059_1706 212
119 3300045976 Ga0466967_0340615 Ga0466967_0340615_83_721 212
120 3300049568 Ga0501031_0450561 Ga0501031_0450561_48_686 212
121 3300049569 Ga0501032_0284021 Ga0501032_0284021_84_743 212
122 3300049576 Ga0501040_0181703 Ga0501040_0181703_257_895 212
123 3300049824 Ga0501045_0234012 Ga0501045_0234012_352_990 212
124 3300050507 nmdc:mga05p37_372824_c1 nmdc:mga05p37_372824_c1_554_1192 212
125 3300050507 nmdc:mga05p37_94921_c1 nmdc:mga05p37_94921_c1_2512_3150 212
126 3300050509 nmdc:mga0qj67_181252_c1 nmdc:mga0qj67_181252_c1_932_1570 212
127 3300054114 Ga0501084_0711010 Ga0501084_0711010_164_802 212
128 3300061734 Ga0530510_0302053 Ga0530510_0302053_543_1181 212
129 3300006852 Ga0075433_10028414 Ga0075433_100284143 213
130 3300009147 Ga0114129_10505387 Ga0114129_105053872 213
131 3300031241 Ga0265325_10006391 Ga0265325_100063912 213
132 3300037312 Ga0395899_0059564 Ga0395899_0059564_1723_2388 213
133 3300037418 Ga0395900_0007097 Ga0395900_0007097_9532_10197 213
134 3300037466 Ga0395898_0035740 Ga0395898_0035740_3924_4589 213
135 3300038443 Ga0395901_0000999 Ga0395901_0000999_4271_4936 213
136 3300042439 Ga0439464_0044507 Ga0439464_0044507_46_738 213
137 3300042461 Ga0439460_0000312 Ga0439460_0000312_4689_5381 213
138 3300048913 Ga0496110_0209455 Ga0496110_0209455_950_1627 213
139 3300048914 Ga0496111_0134330 Ga0496111_0134330_192_869 213
140 3300049568 Ga0501031_0060542 Ga0501031_0060542_1579_2274 213
141 3300049570 Ga0501033_0012942 Ga0501033_0012942_270_965 213
142 3300049572 Ga0501036_0008153 Ga0501036_0008153_3517_4212 213
143 3300049573 Ga0501037_0125554 Ga0501037_0125554_353_1048 213
144 3300049574 Ga0501038_0050743 Ga0501038_0050743_2614_3309 213
145 3300049575 Ga0501039_0004889 Ga0501039_0004889_85_780 213
146 3300049576 Ga0501040_0001172 Ga0501040_0001172_6874_7569 213
147 3300049577 Ga0501041_0005463 Ga0501041_0005463_3558_4253 213
148 3300049578 Ga0501042_0015939 Ga0501042_0015939_3123_3818 213
149 3300049580 Ga0501046_0023840 Ga0501046_0023840_2944_3639 213
150 3300049582 Ga0501048_0051734 Ga0501048_0051734_1988_2683 213
151 3300049586 Ga0501070_0342574 Ga0501070_0342574_41_736 213
152 3300049587 Ga0501071_0040727 Ga0501071_0040727_26_721 213
153 3300049588 Ga0501072_0022748 Ga0501072_0022748_3039_3734 213
154 3300049591 Ga0501075_0007563 Ga0501075_0007563_2735_3430 213
155 3300049592 Ga0501076_0010548 Ga0501076_0010548_1572_2267 213
156 3300049593 Ga0501077_0001053 Ga0501077_0001053_14126_14821 213
157 3300049741 Ga0501079_0010916 Ga0501079_0010916_1982_2677 213
158 3300049743 Ga0501081_0027518 Ga0501081_0027518_2224_2919 213
159 3300049744 Ga0501083_0094736 Ga0501083_0094736_526_1221 213
160 3300049824 Ga0501045_0028186 Ga0501045_0028186_701_1396 213
161 3300050508 nmdc:mga09592_491246_c1 nmdc:mga09592_491246_c1_163_828 213
162 3300050512 nmdc:mga0n895_108451_c1 nmdc:mga0n895_108451_c1_184_825 213
163 3300050515 nmdc:mga0a205_337820_c1 nmdc:mga0a205_337820_c1_424_1089 213
164 3300054114 Ga0501084_0003081 Ga0501084_0003081_2001_2696 213
165 3300060353 Ga0501082_0027415 Ga0501082_0027415_798_1493 213
166 3300061734 Ga0530510_0006398 Ga0530510_0006398_4219_4914 213
167 3300005536 Ga0070697_100221057 Ga0070697_1002210572 214
168 3300025927 Ga0207687_10371684 Ga0207687_103716842 214
169 3300044658 Ga0466972_0012097 Ga0466972_0012097_1508_2152 214
170 3300044683 Ga0466965_0144562 Ga0466965_0144562_70_714 214
171 3300044684 Ga0466966_0012193 Ga0466966_0012193_3443_4087 214
172 3300044735 Ga0466968_0106499 Ga0466968_0106499_395_1039 214
173 3300005347 Ga0070668_100575983 Ga0070668_1005759832 215
174 3300009147 Ga0114129_10383139 Ga0114129_103831392 215
175 3300025945 Ga0207679_10279630 Ga0207679_102796303 215
176 3300037312 Ga0395899_0024269 Ga0395899_0024269_3889_4536 215
177 3300048912 Ga0496109_0055264 Ga0496109_0055264_1843_2490 215
178 3300048914 Ga0496111_0144466 Ga0496111_0144466_165_812 215
179 3300048915 Ga0496112_0241787 Ga0496112_0241787_1003_1650 215
180 3300049574 Ga0501038_0148834 Ga0501038_0148834_367_1092 215
181 3300049575 Ga0501039_0363894 Ga0501039_0363894_180_905 215
182 3300049586 Ga0501070_0442310 Ga0501070_0442310_288_1013 215
183 3300049587 Ga0501071_0060756 Ga0501071_0060756_534_1259 215
184 3300049588 Ga0501072_0308792 Ga0501072_0308792_281_1006 215
185 3300049591 Ga0501075_0038667 Ga0501075_0038667_304_1029 215
186 3300049592 Ga0501076_0010733 Ga0501076_0010733_5815_6540 215
187 3300049593 Ga0501077_0023921 Ga0501077_0023921_1186_1911 215
188 3300049743 Ga0501081_0053784 Ga0501081_0053784_555_1280 215
189 3300049822 Ga0501035_0412752 Ga0501035_0412752_31_756 215
190 3300050507 nmdc:mga05p37_422889_c1 nmdc:mga05p37_422889_c1_178_825 215
191 3300050510 nmdc:mga06r32_330849_c1 nmdc:mga06r32_330849_c1_211_858 215
192 3300060353 Ga0501082_0459829 Ga0501082_0459829_328_1053 215
193 3300061734 Ga0530510_0098296 Ga0530510_0098296_1082_1807 215
194 3300006880 Ga0075429_100842102 Ga0075429_1008421021 216
195 3300009094 Ga0111539_10367781 Ga0111539_103677812 216
196 3300031824 Ga0307413_10143733 Ga0307413_101437332 216
197 3300031852 Ga0307410_10281905 Ga0307410_102819052 216
198 3300031911 Ga0307412_10636253 Ga0307412_106362532 216
199 3300032126 Ga0307415_100070319 Ga0307415_1000703192 216
200 3300050507 nmdc:mga05p37_84003_c1 nmdc:mga05p37_84003_c1_1401_2051 216
201 3300050511 nmdc:mga08y16_741188_c1 nmdc:mga08y16_741188_c1_300_950 216
202 3300005328 Ga0070676_10000345 Ga0070676_1000034520 217
203 3300005328 Ga0070676_10372386 Ga0070676_103723861 217
204 3300005331 Ga0070670_100030889 Ga0070670_1000308892 217
205 3300005333 Ga0070677_10021875 Ga0070677_100218752 217
206 3300005334 Ga0068869_100001452 Ga0068869_1000014524 217
207 3300005336 Ga0070680_100000565 Ga0070680_10000056525 217
208 3300005337 Ga0070682_100011794 Ga0070682_1000117941 217
209 3300005339 Ga0070660_100018299 Ga0070660_1000182992 217
210 3300005341 Ga0070691_10061639 Ga0070691_100616392 217
211 3300005341 Ga0070691_10103106 Ga0070691_101031063 217
212 3300005344 Ga0070661_100000993 Ga0070661_1000009932 217
213 3300005345 Ga0070692_10011437 Ga0070692_100114373 217
214 3300005345 Ga0070692_10064164 Ga0070692_100641643 217
215 3300005353 Ga0070669_100083101 Ga0070669_1000831011 217
216 3300005355 Ga0070671_100305348 Ga0070671_1003053482 217
217 3300005366 Ga0070659_100000377 Ga0070659_1000003779 217
218 3300005406 Ga0070703_10026593 Ga0070703_100265932 217
219 3300005440 Ga0070705_100009173 Ga0070705_1000091731 217
220 3300005444 Ga0070694_100008088 Ga0070694_1000080884 217
221 3300005444 Ga0070694_100026879 Ga0070694_1000268793 217
222 3300005455 Ga0070663_100022883 Ga0070663_1000228832 217
223 3300005457 Ga0070662_100007534 Ga0070662_1000075342 217
224 3300005459 Ga0068867_100003302 Ga0068867_1000033027 217
225 3300005535 Ga0070684_100981517 Ga0070684_1009815171 217
226 3300005539 Ga0068853_100023899 Ga0068853_1000238992 217
227 3300005543 Ga0070672_100031194 Ga0070672_1000311943 217
228 3300005545 Ga0070695_100002346 Ga0070695_10000234612 217
229 3300005546 Ga0070696_100002742 Ga0070696_1000027427 217
230 3300005546 Ga0070696_100004112 Ga0070696_1000041123 217
231 3300005547 Ga0070693_100000929 Ga0070693_1000009299 217
232 3300005549 Ga0070704_100002122 Ga0070704_10000212210 217
233 3300005549 Ga0070704_100097862 Ga0070704_1000978622 217
234 3300005563 Ga0068855_100017721 Ga0068855_1000177218 217
235 3300005577 Ga0068857_100163329 Ga0068857_1001633292 217
236 3300005578 Ga0068854_100004148 Ga0068854_1000041483 217
237 3300005614 Ga0068856_100001687 Ga0068856_1000016874 217
238 3300005615 Ga0070702_100002523 Ga0070702_1000025235 217
239 3300005617 Ga0068859_100007912 Ga0068859_1000079124 217
240 3300005719 Ga0068861_100067767 Ga0068861_1000677672 217
241 3300005719 Ga0068861_100425477 Ga0068861_1004254772 217
242 3300005840 Ga0068870_10001427 Ga0068870_100014272 217
243 3300005841 Ga0068863_100019605 Ga0068863_1000196055 217
244 3300005843 Ga0068860_100026389 Ga0068860_1000263893 217
245 3300005843 Ga0068860_100262144 Ga0068860_1002621442 217
246 3300005844 Ga0068862_100019157 Ga0068862_1000191574 217
247 3300005844 Ga0068862_100408951 Ga0068862_1004089512 217
248 3300005937 Ga0081455_10000135 Ga0081455_1000013527 217
249 3300006237 Ga0097621_100156248 Ga0097621_1001562482 217
250 3300006846 Ga0075430_100314308 Ga0075430_1003143082 217
251 3300006871 Ga0075434_100061171 Ga0075434_1000611713 217
252 3300006914 Ga0075436_100008603 Ga0075436_1000086034 217
253 3300006931 Ga0097620_100007912 Ga0097620_1000079129 217
254 3300007076 Ga0075435_100019476 Ga0075435_1000194762 217
255 3300009098 Ga0105245_10155731 Ga0105245_101557312 217
256 3300009174 Ga0105241_10010031 Ga0105241_100100315 217
257 3300009553 Ga0105249_10141316 Ga0105249_101413162 217
258 3300010375 Ga0105239_10414870 Ga0105239_104148702 217
259 3300011119 Ga0105246_10093397 Ga0105246_100933972 217
260 3300013105 Ga0157369_10010014 Ga0157369_100100142 217
261 3300013306 Ga0163162_10195178 Ga0163162_101951782 217
262 3300013307 Ga0157372_10000646 Ga0157372_1000064615 217
263 3300013308 Ga0157375_10096324 Ga0157375_100963242 217
264 3300014325 Ga0163163_10041235 Ga0163163_100412353 217
265 3300014326 Ga0157380_10496870 Ga0157380_104968702 217
266 3300014745 Ga0157377_10110370 Ga0157377_101103702 217
267 3300014968 Ga0157379_10664928 Ga0157379_106649282 217
268 3300020081 Ga0206354_10166421 Ga0206354_101664212 217
269 3300025885 Ga0207653_10010038 Ga0207653_100100383 217
270 3300025893 Ga0207682_10083287 Ga0207682_100832871 217
271 3300025907 Ga0207645_10003896 Ga0207645_100038962 217
272 3300025908 Ga0207643_10000355 Ga0207643_100003556 217
273 3300025911 Ga0207654_10050204 Ga0207654_100502042 217
274 3300025912 Ga0207707_10000047 Ga0207707_10000047120 217
275 3300025917 Ga0207660_10041981 Ga0207660_100419813 217
276 3300025919 Ga0207657_10000021 Ga0207657_1000002112 217
277 3300025920 Ga0207649_10059444 Ga0207649_100594442 217
278 3300025921 Ga0207652_10000582 Ga0207652_100005823 217
279 3300025923 Ga0207681_10015719 Ga0207681_100157192 217
280 3300025925 Ga0207650_10011270 Ga0207650_100112702 217
281 3300025927 Ga0207687_10113298 Ga0207687_101132982 217
282 3300025932 Ga0207690_10026791 Ga0207690_100267912 217
283 3300025933 Ga0207706_10011731 Ga0207706_100117313 217
284 3300025940 Ga0207691_10039543 Ga0207691_100395434 217
285 3300025942 Ga0207689_10000697 Ga0207689_100006972 217
286 3300025942 Ga0207689_10013135 Ga0207689_100131354 217
287 3300025944 Ga0207661_10035728 Ga0207661_100357282 217
288 3300025945 Ga0207679_10001442 Ga0207679_100014424 217
289 3300025949 Ga0207667_10000620 Ga0207667_1000062011 217
290 3300025972 Ga0207668_10200726 Ga0207668_102007262 217
291 3300025981 Ga0207640_10038060 Ga0207640_100380602 217
292 3300026035 Ga0207703_10456872 Ga0207703_104568722 217
293 3300026041 Ga0207639_10030653 Ga0207639_100306533 217
294 3300026067 Ga0207678_10179646 Ga0207678_101796462 217
295 3300026078 Ga0207702_10028302 Ga0207702_100283024 217
296 3300026088 Ga0207641_10058539 Ga0207641_100585393 217
297 3300026089 Ga0207648_10001227 Ga0207648_1000122714 217
298 3300026089 Ga0207648_10353230 Ga0207648_103532302 217
299 3300026095 Ga0207676_10047953 Ga0207676_100479533 217
300 3300026116 Ga0207674_10043184 Ga0207674_100431844 217
301 3300026118 Ga0207675_100005398 Ga0207675_1000053982 217
302 3300026118 Ga0207675_100505116 Ga0207675_1005051162 217
303 3300027360 Ga0209969_1002709 Ga0209969_10027092 217
304 3300027526 Ga0209968_1002022 Ga0209968_10020222 217
305 3300027682 Ga0209971_1000018 Ga0209971_100001841 217
306 3300027695 Ga0209966_1000141 Ga0209966_10001419 217
307 3300027717 Ga0209998_10000020 Ga0209998_1000002064 217
308 3300027876 Ga0209974_10006177 Ga0209974_100061774 217
309 3300028380 Ga0268265_10013767 Ga0268265_100137674 217
310 3300028380 Ga0268265_10327797 Ga0268265_103277972 217
311 3300028381 Ga0268264_10018768 Ga0268264_100187683 217
312 3300028381 Ga0268264_10097767 Ga0268264_100977672 217
313 3300031995 Ga0307409_100301012 Ga0307409_1003010122 217
314 3300031995 Ga0307409_100890438 Ga0307409_1008904381 217
315 3300032126 Ga0307415_100543724 Ga0307415_1005437242 217
316 3300034820 Ga0373959_0054829 Ga0373959_0054829_165_830 217
317 3300035112 Ga0373932_0038064 Ga0373932_0038064_249_914 217
318 3300035114 Ga0373939_0012282 Ga0373939_0012282_1055_1720 217
319 3300035242 Ga0373962_0019391 Ga0373962_0019391_848_1513 217
320 3300042001 Ga0439441_007678 Ga0439441_007678_544_1209 217
321 3300042005 Ga0439448_0113283 Ga0439448_0113283_44_709 217
322 3300042157 Ga0439458_0023733 Ga0439458_0023733_721_1386 217
323 3300042438 Ga0439459_0002452 Ga0439459_0002452_1543_2208 217
324 3300042876 Ga0451577_0014859 Ga0451577_0014859_2454_3119 217
325 3300042876 Ga0451577_0325695 Ga0451577_0325695_84_749 217
326 3300044712 Ga0453684_0672469 Ga0453684_0672469_35_703 217
327 3300045051 Ga0451576_0103146 Ga0451576_0103146_1711_2376 217
328 3300045051 Ga0451576_0140007 Ga0451576_0140007_645_1310 217
329 3300048905 Ga0496102_0126615 Ga0496102_0126615_677_1342 217
330 3300048906 Ga0496103_0083359 Ga0496103_0083359_214_879 217
331 3300048909 Ga0496106_0386010 Ga0496106_0386010_21_686 217
332 3300048911 Ga0496108_0738707 Ga0496108_0738707_167_832 217
333 3300049568 Ga0501031_0064933 Ga0501031_0064933_1397_2062 217
334 3300049570 Ga0501033_0052594 Ga0501033_0052594_1414_2079 217
335 3300049572 Ga0501036_0118502 Ga0501036_0118502_1546_2211 217
336 3300049573 Ga0501037_0176231 Ga0501037_0176231_275_940 217
337 3300049574 Ga0501038_0055249 Ga0501038_0055249_1985_2650 217
338 3300049575 Ga0501039_0037433 Ga0501039_0037433_1435_2100 217
339 3300049576 Ga0501040_0006432 Ga0501040_0006432_5577_6242 217
340 3300049577 Ga0501041_0011684 Ga0501041_0011684_1780_2445 217
341 3300049577 Ga0501041_0037911 Ga0501041_0037911_105_770 217
342 3300049578 Ga0501042_0038929 Ga0501042_0038929_2081_2746 217
343 3300049578 Ga0501042_0078861 Ga0501042_0078861_1023_1688 217
344 3300049580 Ga0501046_0000473 Ga0501046_0000473_24871_25536 217
345 3300049581 Ga0501047_0020168 Ga0501047_0020168_802_1467 217
346 3300049582 Ga0501048_0005628 Ga0501048_0005628_3073_3738 217
347 3300049587 Ga0501071_0018292 Ga0501071_0018292_3978_4643 217
348 3300049588 Ga0501072_0311772 Ga0501072_0311772_463_1128 217
349 3300049590 Ga0501074_0019690 Ga0501074_0019690_3719_4384 217
350 3300049591 Ga0501075_0014598 Ga0501075_0014598_1397_2062 217
351 3300049591 Ga0501075_0057301 Ga0501075_0057301_658_1323 217
352 3300049592 Ga0501076_0007967 Ga0501076_0007967_3906_4571 217
353 3300049592 Ga0501076_0170756 Ga0501076_0170756_1064_1729 217
354 3300049593 Ga0501077_0058125 Ga0501077_0058125_53_718 217
355 3300049741 Ga0501079_0000497 Ga0501079_0000497_18410_19075 217
356 3300049741 Ga0501079_0001001 Ga0501079_0001001_3277_3942 217
357 3300049742 Ga0501080_0040260 Ga0501080_0040260_922_1587 217
358 3300049743 Ga0501081_0005528 Ga0501081_0005528_1061_1726 217
359 3300049743 Ga0501081_0006164 Ga0501081_0006164_1281_1946 217
360 3300049744 Ga0501083_0029094 Ga0501083_0029094_1044_1709 217
361 3300049744 Ga0501083_0041058 Ga0501083_0041058_224_889 217
362 3300049824 Ga0501045_0001532 Ga0501045_0001532_9315_9980 217
363 3300049824 Ga0501045_0061644 Ga0501045_0061644_1352_2017 217
364 3300050507 nmdc:mga05p37_277710_c1 nmdc:mga05p37_277710_c1_1030_1695 217
365 3300050510 nmdc:mga06r32_240125_c1 nmdc:mga06r32_240125_c1_1078_1743 217
366 3300050512 nmdc:mga0n895_332653_c1 nmdc:mga0n895_332653_c1_212_877 217
367 3300050513 nmdc:mga0rr50_23510_c1 nmdc:mga0rr50_23510_c1_274_939 217
368 3300050514 nmdc:mga08x19_33641_c1 nmdc:mga08x19_33641_c1_959_1624 217
369 3300050514 nmdc:mga08x19_9436_c1 nmdc:mga08x19_9436_c1_4862_5527 217
370 3300050515 nmdc:mga0a205_199054_c1 nmdc:mga0a205_199054_c1_1018_1683 217
371 3300054114 Ga0501084_0011520 Ga0501084_0011520_4266_4931 217
372 3300054114 Ga0501084_0023752 Ga0501084_0023752_1998_2663 217
373 3300060353 Ga0501082_0000407 Ga0501082_0000407_23395_24060 217
374 3300060353 Ga0501082_0011289 Ga0501082_0011289_4834_5499 217
375 3300061734 Ga0530510_0011536 Ga0530510_0011536_1251_1916 217
376 3300005437 Ga0070710_10174918 Ga0070710_101749181 218
377 3300025898 Ga0207692_10353076 Ga0207692_103530762 218
378 3300025929 Ga0207664_10682555 Ga0207664_106825551 218
379 3300044735 Ga0466968_0180801 Ga0466968_0180801_106_768 218
380 3300044765 Ga0466970_0203496 Ga0466970_0203496_139_801 218
381 3300047320 Ga0495672_0009649 Ga0495672_0009649_781_1452 218
382 3300048914 Ga0496111_0201204 Ga0496111_0201204_301_978 218
383 3300049583 Ga0501067_0073531 Ga0501067_0073531_409_1077 218
384 3300050507 nmdc:mga05p37_33822_c1 nmdc:mga05p37_33822_c1_425_1090 218
385 3300050509 nmdc:mga0qj67_325118_c1 nmdc:mga0qj67_325118_c1_499_1197 218
386 3300053083 Ga0495655_0025739 Ga0495655_0025739_610_1266 218
387 3300049587 Ga0501071_0120397 Ga0501071_0120397_133_843 222
388 3300003322 rootL2_10278923 rootL2_102789232 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

1

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3noq-assembly1.cif.gz_A crystal structure of c101s isocyanide hydratase from pseudomonas fluorescens 0.9708 2 212
3nor-assembly1.cif.gz_A-2 crystal structure of t102s isocyanide hydratase from pseudomonas fluorescens 0.9694 2 212
3nov-assembly1.cif.gz_A-2 crystal structure of d17e isocyanide hydratase from pseudomonas fluorescens 0.9687 2 212
7l9q-assembly1.cif.gz_B wild-type pseudomonas fluorescens isocyanide hydratase (wt-1) at 274k, refmac5-refined 0.9657 2 212
7la0-assembly1.cif.gz_B pseudomonas fluorescens g150a isocyanide hydratase (g150a-2) at 274k, refmac5-refined 0.9648 2 212
ID Description Score Start End Superfamily
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9706 27 207 3.40.50.880
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9694 2 212 3.40.50.880
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9399 27 207 3.40.50.880
3ewnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9161 2 208 3.40.50.880
af_O16228_2_184_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9127 1 182 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2I0SLU9-F1-model_v4 Glutamine amidotransferase 0.9969 2 129 GO:0006355
GO:0016740
AF-A0A7K2KTE8-F1-model_v4 DJ-1/PfpI family protein 0.9938 9 155 GO:0006355
AF-A0A4R1DL35-F1-model_v4 deleted 0.9919 2 193
AF-Q2Y9T0-F1-model_v4 DJ-1/PfpI family protein (Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain-like protein) 0.9919 2 110 GO:0003677
GO:0006355
GO:0016020
AF-A0A7W1M1T5-F1-model_v4 DJ-1/PfpI family protein 0.9915 2 195 GO:0006355

Feature Viewer

pLDDT pTM Quality
93.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map