F431307

General Info

Members Datasets Scaffolds Average Seq Length
389 285 778 697

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10000160|JGI25151J46595_1000016054
Length 761
Sequence MALATHRHDPAAPPVNAPIRPEFANPAPPYMTMDRAAAPAPCASVAAFLCSGSAMPVLPKTCQSLLLAAGLAAASASGAVIAKEATVTDDPYAWLEDVDGKRALDWVHARNAKTEAEYTDSAQFKQLEASILEILDSDAKIPDVQKIGDHYYNFWQDAQHPRGLWRRTTLAEYRKDKPAWETVLDLDALNAQENEQWVWHGAECLRPDFQRCLISLSRGGSDADVTREFDLLAKTWIKDGFYRPEAKGSLTWIDRDHVYVATDFGKGSMTSSGYARTVKLWTRGTPMAQATPVYEGKDSDMMVGAWHDPTPGFERDFVERTLAFYNNELFLRGADGKLSKLDLPNSANKEVRREWLLLELRDPYEAGGKKYPAGSLIATRLDDFQAGKRDFVSLFAPTDTSSLAGTTWTRHHLIINVLDDVKNKLTVLTPPGAGQGEWTRSALVGAPTFGTVMVGAVDGIDSDAVWLSAADYLTPTTLALAEPGQKPEVLKTMPSFFDASKDTIEQHFAKSQDGTRVPYFLVRPKDLKYDGKAPTLLYGYGGFEVSMTPKYSGGIGRGWLAKGGVYAVANIRGGGEYGPRWHQAALKANRHKAYEDFAAVGRDLIERKITSTPHLGVQGGSNGGLLTGNMLTQYPELFGAVVVQVPLLDMKRYSHLLAGASWMAEYGNPDTDDWSFIKTFSPYHLFDAKREYPPVIFMTSTKDDRVHPGHARKMAAKMLDAGKNVTYYENIEGGHGGAANNAQQAHMSALALTFLWQRLAP

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
95 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
96 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
113 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
114 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
115 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
116 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
117 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
118 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
126 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
176 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
185 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
186 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
187 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
188 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
189 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
190 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
191 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
192 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
193 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
194 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
195 2643221559 Lysobacter sp. Root559 Isolate Unclassified
196 2643221573 Lysobacter sp. Root604 Isolate Unclassified
197 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
198 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
199 2643221586 Lysobacter sp. Root667 Isolate Unclassified
200 2643221593 Lysobacter sp. Root690 Isolate Unclassified
201 2643221612 Lysobacter sp. Root76 Isolate Unclassified
202 2643221613 Oerskovia sp. Root22 Isolate Unclassified
203 2643221695 Lysobacter sp. Root494 Isolate Unclassified
204 2643221720 Lysobacter sp. Root916 Isolate Unclassified
205 2643221721 Oerskovia sp. Root918 Isolate Unclassified
206 2643221727 Lysobacter sp. Root96 Isolate Unclassified
207 2643221728 Lysobacter sp. Root983 Isolate Unclassified
208 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
209 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
210 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
211 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
212 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
213 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
214 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
215 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
216 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
217 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
218 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
219 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
220 2808606394 Promicromonospora sp. C35 Isolate Unclassified
221 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
222 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
223 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
224 2818991457 Xanthomonas translucens 569 Isolate Unclassified
225 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
226 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
227 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
228 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
229 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
230 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
231 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
232 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
233 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
234 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
235 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
236 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
237 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
238 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
239 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
240 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
241 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
242 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
243 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
244 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
245 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
246 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
247 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
248 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
249 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
250 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
251 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
252 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
253 2919513703 Luteimonas sp. 3794 Isolate Unclassified
254 2919675420 Luteimonas terrae 4099 Isolate Unclassified
255 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
256 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
257 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
258 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
259 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
260 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
261 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
262 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
263 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
264 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
265 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
266 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
267 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
268 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
269 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
270 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
271 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
272 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
273 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
274 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
275 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
276 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
277 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
278 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
279 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
280 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
281 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
282 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
283 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
284 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
285 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.78
Metatranscriptomes 0.26
Isolates 25.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 18.77
Nodule 2.31
Rhizoplane 1.03
Rhizosphere 53.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000160 3300003187 Bacteria 86811
2 SwRhRL2b_contig_3090002 2162886007 Bacteria 3831
3 JGI25152J39213_1000033 3300002773 Bacteria 95187
4 JGI25150J39212_1000216 3300002774 Bacteria 31473
5 JGI25150J39212_1000522 3300002774 Bacteria 15710
6 JGI25150J39212_1004573 3300002774 Bacteria 3057
7 JGI25151J46595_10000142 3300003187 Bacteria 95187
8 JGI25151J46595_10016679 3300003187 Bacteria 3205
9 JGI25153J46596_10000107 3300003215 Bacteria 95187
10 Ga0055526_1000014 3300003771 Bacteria 233327
11 Ga0055526_1002302 3300003771 Bacteria 13032
12 Ga0055524_1000019 3300003775 Bacteria 233561
13 Ga0055524_1004153 3300003775 Bacteria 6770
14 Ga0055536_1003020 3300003781 Bacteria 9209
15 Ga0055536_1005331 3300003781 Bacteria 6317
16 Ga0055536_1006941 3300003781 Bacteria 5160
17 Ga0055536_1007122 3300003781 Bacteria 5069
18 Ga0055534_1000012 3300003784 Bacteria 153530
19 Ga0055534_1000112 3300003784 Bacteria 59920
20 Ga0055528_1000007 3300003790 Bacteria 233327
21 Ga0055528_1000305 3300003790 Bacteria 41733
22 Ga0055530_10001409 3300003791 Bacteria 17679
23 Ga0055530_10001757 3300003791 Bacteria 15137
24 Ga0055530_10001876 3300003791 Bacteria 14446
25 Ga0055531_10009010 3300003794 Bacteria 5160
26 Ga0055531_10009236 3300003794 Bacteria 5069
27 Ga0055531_10012472 3300003794 Bacteria 3995
28 Ga0058692_1000028 3300003856 Bacteria 193757
29 Ga0058692_1000053 3300003856 Bacteria 107166
30 Ga0065704_10080719 3300005289 Bacteria 3881
31 Ga0065704_10096844 3300005289 Bacteria 2421
32 Ga0065704_10099878 3300005289 Bacteria 2294
33 Ga0070658_10003170 3300005327 Bacteria 13580
34 Ga0070670_100004111 3300005331 Bacteria 12160
35 Ga0070666_10000099 3300005335 Bacteria 59763
36 Ga0070668_100002752 3300005347 Bacteria 12936
37 Ga0070668_100002795 3300005347 Bacteria 12838
38 Ga0070668_100007264 3300005347 Bacteria 8214
39 Ga0070668_100018143 3300005347 Bacteria 5279
40 Ga0070668_100038840 3300005347 Bacteria 3640
41 Ga0070669_100014104 3300005353 Bacteria 5685
42 Ga0070669_100058584 3300005353 Bacteria 2827
43 Ga0070667_100010485 3300005367 Bacteria 7654
44 Ga0070709_10000802 3300005434 Bacteria 17549
45 Ga0070714_100001005 3300005435 Bacteria 20110
46 Ga0070713_100000980 3300005436 Bacteria 18279
47 Ga0070710_10000603 3300005437 Bacteria 17140
48 Ga0070711_100002781 3300005439 Bacteria 10032
49 Ga0070681_10029330 3300005458 Bacteria 5525
50 Ga0070706_100004091 3300005467 Bacteria 14184
51 Ga0070706_100009568 3300005467 Bacteria 9013
52 Ga0070707_100004395 3300005468 Bacteria 13206
53 Ga0070698_100003069 3300005471 Bacteria 18410
54 Ga0070697_100011718 3300005536 Bacteria 6857
55 Ga0070672_100002566 3300005543 Bacteria 11588
56 Ga0068857_100008335 3300005577 Bacteria 8953
57 Ga0068860_100015097 3300005843 Bacteria 7549
58 Ga0081539_10047852 3300005985 Bacteria 2438
59 Ga0075364_10000199 3300006051 Bacteria 27820
60 Ga0070716_100000609 3300006173 Bacteria 15132
61 Ga0070712_100002034 3300006175 Bacteria 12394
62 Ga0075428_100066361 3300006844 Bacteria 3951
63 Ga0075433_10026823 3300006852 Bacteria 4881
64 Ga0075434_100038069 3300006871 Bacteria 4764
65 Ga0075435_100006218 3300007076 Bacteria 8427
66 Ga0105251_10000155 3300009011 Bacteria 69872
67 Ga0105251_10003814 3300009011 Bacteria 10742
68 Ga0105251_10004748 3300009011 Bacteria 9103
69 Ga0114129_10301532 3300009147 Bacteria 2135
70 Ga0105243_10001863 3300009148 Bacteria 18001
71 Ga0105238_10000428 3300009551 Bacteria 44396
72 Ga0105032_100347 3300009979 Bacteria 4714
73 Ga0163162_10000848 3300013306 Bacteria 28416
74 Ga0182008_10000204 3300014497 Bacteria 46716
75 Ga0182008_10004073 3300014497 Bacteria 8623
76 Ga0182006_1027078 3300015261 Bacteria 2343
77 Ga0182007_10000131 3300015262 Bacteria 52730
78 Ga0182005_1000437 3300015265 Bacteria 22152
79 Ga0182005_1006530 3300015265 Bacteria 3551
80 Ga0183360_10002 3300015689 Bacteria 953821
81 Ga0163161_10018796 3300017792 Bacteria 4844
82 Ga0224712_10009817 3300022467 Bacteria 2901
83 Ga0207425_1000064 3300025245 Bacteria 129075
84 Ga0209129_1000101 3300025258 Bacteria 161931
85 Ga0209565_1000001 3300025263 Bacteria 2950419
86 Ga0209565_1000060 3300025263 Bacteria 188543
87 Ga0209565_1004089 3300025263 Bacteria 4543
88 Ga0209673_1000001 3300025273 Bacteria 3176258
89 Ga0209673_1000047 3300025273 Bacteria 289276
90 Ga0209673_1006429 3300025273 Bacteria 5671
91 Ga0209130_1000907 3300025284 Bacteria 23906
92 Ga0209675_1000001 3300025291 Bacteria 2950293
93 Ga0209675_1000007 3300025291 Bacteria 683430
94 Ga0209675_1009011 3300025291 Bacteria 3580
95 Ga0209676_1000018 3300025292 Bacteria 631385
96 Ga0209676_1000052 3300025292 Bacteria 371539
97 Ga0209676_1000501 3300025292 Bacteria 62489
98 Ga0209676_1000507 3300025292 Bacteria 61441
99 Ga0209676_1000620 3300025292 Bacteria 51683
100 Ga0209676_1002422 3300025292 Bacteria 13292
101 Ga0209025_1000006 3300025294 Bacteria 1153444
102 Ga0209025_1000048 3300025294 Bacteria 335574
103 Ga0209025_1000467 3300025294 Bacteria 78947
104 Ga0209025_1001559 3300025294 Bacteria 29104
105 Ga0209564_1000001 3300025295 Bacteria 3176258
106 Ga0209564_1001294 3300025295 Bacteria 27156
107 Ga0209758_1000056 3300025297 Bacteria 335574
108 Ga0209758_1010976 3300025297 Bacteria 5323
109 Ga0209050_1000740 3300025298 Bacteria 47372
110 Ga0209050_1000870 3300025298 Bacteria 40796
111 Ga0209050_1002028 3300025298 Bacteria 18769
112 Ga0209256_1000006 3300025299 Bacteria 1250310
113 Ga0209256_1001986 3300025299 Bacteria 18396
114 Ga0209256_1002865 3300025299 Bacteria 13112
115 Ga0209256_1006371 3300025299 Bacteria 6284
116 Ga0209256_1009441 3300025299 Bacteria 4278
117 Ga0207426_1000141 3300025302 Bacteria 194453
118 Ga0209051_1004844 3300025303 Bacteria 8094
119 Ga0209257_1000035 3300025304 Bacteria 631463
120 Ga0209257_1000046 3300025304 Bacteria 477765
121 Ga0209257_1000067 3300025304 Bacteria 342468
122 Ga0209257_1001111 3300025304 Bacteria 34963
123 Ga0209257_1001426 3300025304 Bacteria 28374
124 Ga0209257_1001475 3300025304 Bacteria 27666
125 Ga0209257_1004911 3300025304 Bacteria 9852
126 Ga0209257_1005671 3300025304 Bacteria 8608
127 Ga0207713_1001387 3300025735 Bacteria 19637
128 Ga0207713_1017967 3300025735 Bacteria 3518
129 Ga0207680_10000001 3300025903 Bacteria 1091453
130 Ga0207699_10012620 3300025906 Bacteria 4302
131 Ga0207684_10012040 3300025910 Bacteria 7534
132 Ga0207693_10002073 3300025915 Bacteria 17528
133 Ga0207663_10015069 3300025916 Bacteria 4254
134 Ga0207646_10001622 3300025922 Bacteria 27444
135 Ga0207646_10015969 3300025922 Bacteria 7059
136 Ga0207646_10031070 3300025922 Bacteria 4837
137 Ga0207681_10002164 3300025923 Bacteria 12520
138 Ga0207694_10000322 3300025924 Bacteria 45212
139 Ga0207650_10002717 3300025925 Bacteria 12212
140 Ga0207664_10002989 3300025929 Bacteria 11233
141 Ga0207709_10000732 3300025935 Bacteria 26258
142 Ga0207665_10000630 3300025939 Bacteria 23660
143 Ga0207691_10000291 3300025940 Bacteria 49560
144 Ga0207668_10005109 3300025972 Bacteria 7722
145 Ga0207668_10025414 3300025972 Bacteria 3833
146 Ga0207648_10033906 3300026089 Bacteria 4502
147 Ga0207674_10004049 3300026116 Bacteria 17790
148 Ga0209371_1000018 3300027312 Bacteria 614700
149 Ga0209371_1000025 3300027312 Bacteria 450640
150 Ga0209967_1002765 3300027364 Bacteria 2284
151 Ga0209971_1001387 3300027682 Bacteria 6021
152 Ga0209974_10004022 3300027876 Bacteria 5258
153 Ga0268266_10000148 3300028379 Bacteria 135001
154 Ga0268266_10067756 3300028379 Bacteria 3090
155 Ga0268264_10013215 3300028381 Bacteria 6795
156 Ga0268256_1000016 3300030500 Bacteria 614700
157 Ga0268256_1000027 3300030500 Bacteria 450640
158 Ga0316177_1165294 3300030731 Bacteria 10662
159 Ga0314311_1098491 3300030733 Bacteria 7848
160 Ga0316183_1170638 3300030742 Bacteria 7805
161 Ga0307513_10011438 3300031456 Bacteria 11031
162 Ga0316578_10023793 3300031728 Bacteria 3431
163 Ga0307410_10019652 3300031852 Bacteria 4114
164 Ga0307406_10002156 3300031901 Bacteria 10715
165 Ga0307412_10037568 3300031911 Bacteria 3113
166 Ga0307412_10079282 3300031911 Bacteria 2265
167 Ga0307409_100016898 3300031995 Bacteria 4845
168 Ga0307409_100026922 3300031995 Bacteria 4065
169 Ga0307414_10001239 3300032004 Bacteria 13148
170 Ga0307510_10006876 3300033180 Bacteria 13573
171 Ga0373942_0000316 3300035207 Bacteria 13118
172 Ga0373962_0002218 3300035242 Bacteria 4640
173 Ga0316574_0040687 3300035398 Bacteria 2862
174 Ga0373935_0036774 3300035692 Bacteria 3063
175 Ga0395899_0006985 3300037312 Bacteria 8747
176 Ga0395905_0004974 3300037471 Bacteria 13689
177 Ga0395901_0005541 3300038443 Bacteria 12780
178 Ga0237819_00128 3300038705 Bacteria 28583
179 Ga0400490_00793 3300038726 Bacteria 43470
180 Ga0237816_00230 3300039145 Bacteria 4664
181 Ga0439436_0008639 3300041404 Bacteria 3131
182 Ga0451800_0092611 3300041459 Bacteria 4708
183 Ga0451806_315449 3300041462 Bacteria 6095
184 Ga0451807_1312642 3300041486 Bacteria 6569
185 Ga0451843_1360598 3300041509 Bacteria 2886
186 Ga0439449_0001576 3300042007 Bacteria 8944
187 Ga0439449_0009583 3300042007 Bacteria 3667
188 Ga0439449_0013557 3300042007 Bacteria 3067
189 Ga0450898_003529 3300042134 Bacteria 2255
190 Ga0451577_0003965 3300042876 Bacteria 15963
191 Ga0453684_0002785 3300044712 Bacteria 41355
192 Ga0453684_0083749 3300044712 Bacteria 3969
193 Ga0451576_0000439 3300045051 Bacteria 94860
194 Ga0451576_0001398 3300045051 Bacteria 41476
195 Ga0495627_001432 3300046453 Bacteria 14015
196 Ga0495591_000467 3300046458 Bacteria 32328
197 Ga0495638_0000744 3300046460 Bacteria 34935
198 Ga0495638_0001133 3300046460 Bacteria 25778
199 Ga0495650_0001167 3300046471 Bacteria 28057
200 Ga0495607_0013704 3300046501 Bacteria 5299
201 Ga0495606_0002739 3300046507 Bacteria 19819
202 Ga0495606_0010276 3300046507 Bacteria 7794
203 Ga0495606_0017758 3300046507 Bacteria 5364
204 Ga0495610_0003191 3300046512 Bacteria 12991
205 Ga0495610_0004120 3300046512 Bacteria 10877
206 Ga0495610_0006208 3300046512 Bacteria 8295
207 Ga0495620_0000459 3300046515 Bacteria 26791
208 Ga0495628_0058144 3300046516 Bacteria 3040
209 Ga0495630_0057927 3300046517 Bacteria 2904
210 Ga0495631_0000804 3300046518 Bacteria 20024
211 Ga0495632_0000800 3300046519 Bacteria 27881
212 Ga0495643_0000886 3300046522 Bacteria 31881
213 Ga0495663_0001059 3300046525 Bacteria 8960
214 Ga0495598_0003446 3300046537 Bacteria 3362
215 Ga0495621_0016377 3300046539 Bacteria 2379
216 Ga0495633_0002188 3300046558 Bacteria 14012
217 Ga0495656_0000713 3300046615 Bacteria 10722
218 Ga0495625_0009844 3300046660 Bacteria 7953
219 Ga0495661_0000565 3300046665 Bacteria 38395
220 Ga0495671_0017825 3300046692 Bacteria 3777
221 Ga0495589_0000808 3300046794 Bacteria 19849
222 Ga0495672_0000411 3300047320 Bacteria 51888
223 Ga0495679_000914 3300047446 Bacteria 18496
224 Ga0495681_0001471 3300047470 Bacteria 17618
225 Ga0495686_0002063 3300047472 Bacteria 19765
226 Ga0495686_0014116 3300047472 Bacteria 5512
227 Ga0496109_0053081 3300048912 Bacteria 3696
228 Ga0496116_0025480 3300048919 Bacteria 4346
229 Ga0496117_0001004 3300048920 Bacteria 43156
230 Ga0496117_0001331 3300048920 Bacteria 36332
231 Ga0496117_0001505 3300048920 Bacteria 33389
232 Ga0496117_0001918 3300048920 Bacteria 27830
233 Ga0496117_0072951 3300048920 Bacteria 2292
234 Ga0496118_0000787 3300048921 Bacteria 50784
235 Ga0496118_0000945 3300048921 Bacteria 45446
236 Ga0496119_0000518 3300048922 Bacteria 52520
237 Ga0496119_0000719 3300048922 Bacteria 44523
238 Ga0496119_0004031 3300048922 Bacteria 14844
239 Ga0496120_0000630 3300048923 Bacteria 52559
240 Ga0496120_0001627 3300048923 Bacteria 26035
241 Ga0496120_0002849 3300048923 Bacteria 16657
242 Ga0496121_0001866 3300048924 Bacteria 33822
243 Ga0496122_0000791 3300048925 Bacteria 60779
244 Ga0496122_0001011 3300048925 Bacteria 49773
245 Ga0496122_0011698 3300048925 Bacteria 8844
246 Ga0496122_0042835 3300048925 Bacteria 3555
247 Ga0496123_0000658 3300048926 Bacteria 57055
248 Ga0496123_0001830 3300048926 Bacteria 27941
249 Ga0496124_0000034 3300048927 Bacteria 325332
250 Ga0496124_0000219 3300048927 Bacteria 111562
251 Ga0496124_0001080 3300048927 Bacteria 43080
252 Ga0496125_0000465 3300048928 Bacteria 72631
253 Ga0496125_0014267 3300048928 Bacteria 7743
254 Ga0496126_0001265 3300048929 Bacteria 40729
255 Ga0496126_0003926 3300048929 Bacteria 18218
256 Ga0496126_0006381 3300048929 Bacteria 13157
257 Ga0496126_0059464 3300048929 Bacteria 3441
258 Ga0501290_000209 3300049513 Bacteria 9673
259 Ga0501031_0016057 3300049568 Bacteria 4862
260 Ga0501033_0001118 3300049570 Bacteria 24355
261 Ga0501033_0059470 3300049570 Bacteria 2822
262 Ga0501034_0001210 3300049571 Bacteria 35418
263 Ga0501034_0002264 3300049571 Bacteria 23614
264 Ga0501034_0003371 3300049571 Bacteria 18236
265 Ga0501034_0048572 3300049571 Bacteria 4283
266 Ga0501037_0007888 3300049573 Bacteria 7799
267 Ga0501038_0006615 3300049574 Bacteria 10719
268 Ga0501038_0012792 3300049574 Bacteria 7663
269 Ga0501038_0065795 3300049574 Bacteria 3088
270 Ga0501039_0042170 3300049575 Bacteria 3526
271 Ga0501047_0010250 3300049581 Bacteria 8865
272 Ga0501068_0028293 3300049584 Bacteria 3314
273 Ga0501073_0016342 3300049589 Bacteria 5379
274 Ga0501225_0004580 3300049705 Bacteria 4112
275 Ga0501080_0016985 3300049742 Bacteria 6720
276 Ga0501265_000238 3300049762 Bacteria 5482
277 Ga0501275_000344 3300049772 Bacteria 5319
278 Ga0501035_0010134 3300049822 Bacteria 8746
279 Ga0501035_0054493 3300049822 Bacteria 3573
280 Ga0501044_0026228 3300049823 Bacteria 6170
281 Ga0501044_0028892 3300049823 Bacteria 5848
282 Ga0501044_0048436 3300049823 Bacteria 4390
283 nmdc:mga00v17_574_c1 3300050491 Bacteria 20546
284 nmdc:mga0n895_35104_c1 3300050512 Bacteria 4833
285 nmdc:mga0rr50_24148_c1 3300050513 Bacteria 4207
286 nmdc:mga0a205_140136_c1 3300050515 Bacteria 2319
287 Ga0495601_0024887 3300053077 Bacteria 3688
288 Ga0500634_0016898 3300053161 Bacteria 3901
289 2513894898 2513237141 Bacteria 8496279
290 2515853054 2515154155 Bacteria 7985436
291 2523386125 2523231044 Bacteria 6434991
292 2524463128 2524023209 Bacteria 6679728
293 2525557369 2524614729 Bacteria 3091755
294 2547501621 2547132130 Bacteria 4660562
295 2572254271 2571042365 Bacteria 3289345
296 2578456928 2576861471 Bacteria 4648976
297 2616313074 2615840626 Bacteria 7921970
298 2630648960 2627854209 Bacteria 3093011
299 2643818220 2643221559 Bacteria 4424915
300 2643880408 2643221573 Bacteria 4784121
301 2643906669 2643221579 Bacteria 4443405
302 2643913831 2643221581 Bacteria 3893603
303 2643937889 2643221586 Bacteria 4446529
304 2643973442 2643221593 Bacteria 6296053
305 2644078798 2643221612 Bacteria 4361984
306 2644083494 2643221613 Bacteria 4622396
307 2644528132 2643221695 Bacteria 3441323
308 2644660983 2643221720 Bacteria 4694283
309 2644664311 2643221721 Bacteria 4486924
310 2644693575 2643221727 Bacteria 4415595
311 2644699065 2643221728 Bacteria 4797149
312 2687577364 2687453129 Bacteria 4387428
313 2688390868 2687453341 Bacteria 6534136
314 2738697396 2738541272 Bacteria 6848551
315 2739328223 2738543027 Bacteria 6409078
316 2739609737 2739367654 Bacteria 6049412
317 2747948651 2747842428 Bacteria 4689383
318 2748018764 2747842501 Bacteria 5293829
319 2760306398 2758568522 Bacteria 5953541
320 2760625144 2758568621 Bacteria 5967089
321 2765580575 2765235840 Bacteria 4663337
322 2774393713 2773857762 Bacteria 5971770
323 2778178767 2775507266 Bacteria 7392367
324 2809030007 2808606394 Bacteria 6248540
325 2809195403 2808606439 Bacteria 5952208
326 2812350279 2811994878 Bacteria 5992952
327 2816518402 2816332141 Bacteria 4436036
328 2819661373 2818991457 Bacteria 5323295
329 2835189575 2835188231 Bacteria 3476928
330 2838035327 2838029111 Bacteria 6603031
331 2839986808 2839986021 Bacteria 3685650
332 2842394489 2842391507 Bacteria 4486072
333 2842482086 2842475841 Bacteria 6603183
334 2842488780 2842482326 Bacteria 7212537
335 2842508471 2842502639 Bacteria 6604161
336 2842758943 2842757796 Bacteria 3981385
337 2842781933 2842780639 Bacteria 4337790
338 2848551654 2848551377 Bacteria 3720646
339 2852652084 2852649853 Bacteria 4036942
340 2852687243 2852684882 Bacteria 5463342
341 2856858040 2856858025 Bacteria 7255264
342 2857444230 2857442823 Bacteria 4562550
343 2867316359 2867312974 Bacteria 7058875
344 2867321229 2867319477 Bacteria 7069771
345 2870786806 2870782633 Bacteria 9624083
346 2874223242 2874220319 Bacteria 4594709
347 2887444631 2887443736 Bacteria 4426037
348 2891972095 2891968417 Bacteria 5821697
349 2894414318 2894414249 Bacteria 4405451
350 2895502849 2895498888 Bacteria 5283788
351 2895512891 2895511927 Bacteria 6802080
352 2895522899 2895522137 Bacteria 3284416
353 2895525330 2895525241 Bacteria 3388457
354 2919092319 2919089067 Bacteria 4560942
355 2919131000 2919130084 Bacteria 5301837
356 2919137038 2919134579 Bacteria 4480386
357 2919515562 2919513703 Bacteria 3844312
358 2919678434 2919675420 Bacteria 3969095
359 2923519740 2923516293 Bacteria 3716336
360 2928499908 2928496128 Bacteria 4631123
361 2929196237 2929195423 Bacteria 5325372
362 2931383321 2931380184 Bacteria 4455911
363 2932433304 2932431166 Bacteria 4215299
364 2935892911 2935890801 Bacteria 4593001
365 2937614294 2937610967 Bacteria 4618818
366 2939589871 2939589442 Bacteria 4214238
367 2939624990 2939622612 Bacteria 4698046
368 2939629196 2939626828 Bacteria 4695272
369 2939663515 2939660829 Bacteria 3784848
370 2941478703 2941475908 Bacteria 4145589
371 2941493648 2941489479 Bacteria 6313767
372 2945962368 2945961074 Bacteria 7342064
373 2946010044 2946006987 Bacteria 6705746
374 2961050006 2961047084 Bacteria 4594415
375 2961064836 2961064222 Bacteria 4749990
376 2974307584 2974307012 Bacteria 4172388
377 2974315926 2974315732 Bacteria 4602776
378 2977248295 2977247770 Bacteria 4160543
379 2984517212 2984514374 Bacteria 4172479
380 2984524089 2984523437 Bacteria 4508481
381 2987608184 2987605356 Bacteria 4187822
382 2995949573 2995948881 Bacteria 6358104
383 2998345420 2998344455 Bacteria 4222996
384 8002870911 8002869464 Bacteria 3588529
385 8003015500 8003014200 Bacteria 4059994
386 8021625506 8021622325 Bacteria 4844743
387 8021628659 8021626552 Bacteria 4665214
388 8021650857 8021648035 Bacteria 4772378
389 8056580556 8056579771 Bacteria 5840325
390 JGI25151J46595_10000160
391 SwRhRL2b_contig_3090002
392 JGI25152J39213_1000033
393 JGI25150J39212_1000216
394 JGI25150J39212_1000522
395 JGI25150J39212_1004573
396 JGI25151J46595_10000142
397 JGI25151J46595_10016679
398 JGI25153J46596_10000107
399 Ga0055526_1000014
400 Ga0055526_1002302
401 Ga0055524_1000019
402 Ga0055524_1004153
403 Ga0055536_1003020
404 Ga0055536_1005331
405 Ga0055536_1006941
406 Ga0055536_1007122
407 Ga0055534_1000012
408 Ga0055534_1000112
409 Ga0055528_1000007
410 Ga0055528_1000305
411 Ga0055530_10001409
412 Ga0055530_10001757
413 Ga0055530_10001876
414 Ga0055531_10009010
415 Ga0055531_10009236
416 Ga0055531_10012472
417 Ga0058692_1000028
418 Ga0058692_1000053
419 Ga0065704_10080719
420 Ga0065704_10096844
421 Ga0065704_10099878
422 Ga0070658_10003170
423 Ga0070670_100004111
424 Ga0070666_10000099
425 Ga0070668_100002752
426 Ga0070668_100002795
427 Ga0070668_100007264
428 Ga0070668_100018143
429 Ga0070668_100038840
430 Ga0070669_100014104
431 Ga0070669_100058584
432 Ga0070667_100010485
433 Ga0070709_10000802
434 Ga0070714_100001005
435 Ga0070713_100000980
436 Ga0070710_10000603
437 Ga0070711_100002781
438 Ga0070681_10029330
439 Ga0070706_100004091
440 Ga0070706_100009568
441 Ga0070707_100004395
442 Ga0070698_100003069
443 Ga0070697_100011718
444 Ga0070672_100002566
445 Ga0068857_100008335
446 Ga0068860_100015097
447 Ga0081539_10047852
448 Ga0075364_10000199
449 Ga0070716_100000609
450 Ga0070712_100002034
451 Ga0075428_100066361
452 Ga0075433_10026823
453 Ga0075434_100038069
454 Ga0075435_100006218
455 Ga0105251_10000155
456 Ga0105251_10003814
457 Ga0105251_10004748
458 Ga0114129_10301532
459 Ga0105243_10001863
460 Ga0105238_10000428
461 Ga0105032_100347
462 Ga0163162_10000848
463 Ga0182008_10000204
464 Ga0182008_10004073
465 Ga0182006_1027078
466 Ga0182007_10000131
467 Ga0182005_1000437
468 Ga0182005_1006530
469 Ga0183360_10002
470 Ga0163161_10018796
471 Ga0224712_10009817
472 Ga0207425_1000064
473 Ga0209129_1000101
474 Ga0209565_1000001
475 Ga0209565_1000060
476 Ga0209565_1004089
477 Ga0209673_1000001
478 Ga0209673_1000047
479 Ga0209673_1006429
480 Ga0209130_1000907
481 Ga0209675_1000001
482 Ga0209675_1000007
483 Ga0209675_1009011
484 Ga0209676_1000018
485 Ga0209676_1000052
486 Ga0209676_1000501
487 Ga0209676_1000507
488 Ga0209676_1000620
489 Ga0209676_1002422
490 Ga0209025_1000006
491 Ga0209025_1000048
492 Ga0209025_1000467
493 Ga0209025_1001559
494 Ga0209564_1000001
495 Ga0209564_1001294
496 Ga0209758_1000056
497 Ga0209758_1010976
498 Ga0209050_1000740
499 Ga0209050_1000870
500 Ga0209050_1002028
501 Ga0209256_1000006
502 Ga0209256_1001986
503 Ga0209256_1002865
504 Ga0209256_1006371
505 Ga0209256_1009441
506 Ga0207426_1000141
507 Ga0209051_1004844
508 Ga0209257_1000035
509 Ga0209257_1000046
510 Ga0209257_1000067
511 Ga0209257_1001111
512 Ga0209257_1001426
513 Ga0209257_1001475
514 Ga0209257_1004911
515 Ga0209257_1005671
516 Ga0207713_1001387
517 Ga0207713_1017967
518 Ga0207680_10000001
519 Ga0207699_10012620
520 Ga0207684_10012040
521 Ga0207693_10002073
522 Ga0207663_10015069
523 Ga0207646_10001622
524 Ga0207646_10015969
525 Ga0207646_10031070
526 Ga0207681_10002164
527 Ga0207694_10000322
528 Ga0207650_10002717
529 Ga0207664_10002989
530 Ga0207709_10000732
531 Ga0207665_10000630
532 Ga0207691_10000291
533 Ga0207668_10005109
534 Ga0207668_10025414
535 Ga0207648_10033906
536 Ga0207674_10004049
537 Ga0209371_1000018
538 Ga0209371_1000025
539 Ga0209967_1002765
540 Ga0209971_1001387
541 Ga0209974_10004022
542 Ga0268266_10000148
543 Ga0268266_10067756
544 Ga0268264_10013215
545 Ga0268256_1000016
546 Ga0268256_1000027
547 Ga0316177_1165294
548 Ga0314311_1098491
549 Ga0316183_1170638
550 Ga0307513_10011438
551 Ga0316578_10023793
552 Ga0307410_10019652
553 Ga0307406_10002156
554 Ga0307412_10037568
555 Ga0307412_10079282
556 Ga0307409_100016898
557 Ga0307409_100026922
558 Ga0307414_10001239
559 Ga0307510_10006876
560 Ga0373942_0000316
561 Ga0373962_0002218
562 Ga0316574_0040687
563 Ga0373935_0036774
564 Ga0395899_0006985
565 Ga0395905_0004974
566 Ga0395901_0005541
567 Ga0237819_00128
568 Ga0400490_00793
569 Ga0237816_00230
570 Ga0439436_0008639
571 Ga0451800_0092611
572 Ga0451806_315449
573 Ga0451807_1312642
574 Ga0451843_1360598
575 Ga0439449_0001576
576 Ga0439449_0009583
577 Ga0439449_0013557
578 Ga0450898_003529
579 Ga0451577_0003965
580 Ga0453684_0002785
581 Ga0453684_0083749
582 Ga0451576_0000439
583 Ga0451576_0001398
584 Ga0495627_001432
585 Ga0495591_000467
586 Ga0495638_0000744
587 Ga0495638_0001133
588 Ga0495650_0001167
589 Ga0495607_0013704
590 Ga0495606_0002739
591 Ga0495606_0010276
592 Ga0495606_0017758
593 Ga0495610_0003191
594 Ga0495610_0004120
595 Ga0495610_0006208
596 Ga0495620_0000459
597 Ga0495628_0058144
598 Ga0495630_0057927
599 Ga0495631_0000804
600 Ga0495632_0000800
601 Ga0495643_0000886
602 Ga0495663_0001059
603 Ga0495598_0003446
604 Ga0495621_0016377
605 Ga0495633_0002188
606 Ga0495656_0000713
607 Ga0495625_0009844
608 Ga0495661_0000565
609 Ga0495671_0017825
610 Ga0495589_0000808
611 Ga0495672_0000411
612 Ga0495679_000914
613 Ga0495681_0001471
614 Ga0495686_0002063
615 Ga0495686_0014116
616 Ga0496109_0053081
617 Ga0496116_0025480
618 Ga0496117_0001004
619 Ga0496117_0001331
620 Ga0496117_0001505
621 Ga0496117_0001918
622 Ga0496117_0072951
623 Ga0496118_0000787
624 Ga0496118_0000945
625 Ga0496119_0000518
626 Ga0496119_0000719
627 Ga0496119_0004031
628 Ga0496120_0000630
629 Ga0496120_0001627
630 Ga0496120_0002849
631 Ga0496121_0001866
632 Ga0496122_0000791
633 Ga0496122_0001011
634 Ga0496122_0011698
635 Ga0496122_0042835
636 Ga0496123_0000658
637 Ga0496123_0001830
638 Ga0496124_0000034
639 Ga0496124_0000219
640 Ga0496124_0001080
641 Ga0496125_0000465
642 Ga0496125_0014267
643 Ga0496126_0001265
644 Ga0496126_0003926
645 Ga0496126_0006381
646 Ga0496126_0059464
647 Ga0501290_000209
648 Ga0501031_0016057
649 Ga0501033_0001118
650 Ga0501033_0059470
651 Ga0501034_0001210
652 Ga0501034_0002264
653 Ga0501034_0003371
654 Ga0501034_0048572
655 Ga0501037_0007888
656 Ga0501038_0006615
657 Ga0501038_0012792
658 Ga0501038_0065795
659 Ga0501039_0042170
660 Ga0501047_0010250
661 Ga0501068_0028293
662 Ga0501073_0016342
663 Ga0501225_0004580
664 Ga0501080_0016985
665 Ga0501265_000238
666 Ga0501275_000344
667 Ga0501035_0010134
668 Ga0501035_0054493
669 Ga0501044_0026228
670 Ga0501044_0028892
671 Ga0501044_0048436
672 nmdc:mga00v17_574_c1
673 nmdc:mga0n895_35104_c1
674 nmdc:mga0rr50_24148_c1
675 nmdc:mga0a205_140136_c1
676 Ga0495601_0024887
677 Ga0500634_0016898
678 2513894898
679 2515853054
680 2523386125
681 2524463128
682 2525557369
683 2547501621
684 2572254271
685 2578456928
686 2616313074
687 2630648960
688 2643818220
689 2643880408
690 2643906669
691 2643913831
692 2643937889
693 2643973442
694 2644078798
695 2644083494
696 2644528132
697 2644660983
698 2644664311
699 2644693575
700 2644699065
701 2687577364
702 2688390868
703 2738697396
704 2739328223
705 2739609737
706 2747948651
707 2748018764
708 2760306398
709 2760625144
710 2765580575
711 2774393713
712 2778178767
713 2809030007
714 2809195403
715 2812350279
716 2816518402
717 2819661373
718 2835189575
719 2838035327
720 2839986808
721 2842394489
722 2842482086
723 2842488780
724 2842508471
725 2842758943
726 2842781933
727 2848551654
728 2852652084
729 2852687243
730 2856858040
731 2857444230
732 2867316359
733 2867321229
734 2870786806
735 2874223242
736 2887444631
737 2891972095
738 2894414318
739 2895502849
740 2895512891
741 2895522899
742 2895525330
743 2919092319
744 2919131000
745 2919137038
746 2919515562
747 2919678434
748 2923519740
749 2928499908
750 2929196237
751 2931383321
752 2932433304
753 2935892911
754 2937614294
755 2939589871
756 2939624990
757 2939629196
758 2939663515
759 2941478703
760 2941493648
761 2945962368
762 2946010044
763 2961050006
764 2961064836
765 2974307584
766 2974315926
767 2977248295
768 2984517212
769 2984524089
770 2987608184
771 2995949573
772 2998345420
773 8002870911
774 8003015500
775 8021625506
776 8021628659
777 8021650857
778 8056580556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

557

761

0.94

PF02897

Peptidase_S9_N

Prolyl oligopeptidase, N-terminal beta-propeller domain

73

487

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hvt-assembly1.cif.gz_A structure of a post-proline cleaving enzyme from rickettsia typhi 0.9511 31 701
4hvt-assembly1.cif.gz_A structure of a post-proline cleaving enzyme from rickettsia typhi 0.9229 31 701
2bkl-assembly1.cif.gz_A structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity 0.9002 29 703
7y1x-assembly1.cif.gz_A crystal structure of prolyl oligopeptidase from microbulbifer arenaceous complex with peg400 and mes 0.8932 29 703
2bkl-assembly1.cif.gz_A structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity 0.8735 29 703
ID Description Score Start End Superfamily
af_O07178_411_672_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.988 440 701 3.40.50.1820
af_O07178_411_672_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9806 440 701 3.40.50.1820
4hvtA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9806 439 701 3.40.50.1820
af_O07178_69_406_2.130.10.120 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.9748 89 434 2.130.10.120
af_O07178_69_406_2.130.10.120 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.9663 89 434 2.130.10.120
ID Description Score Start End GO Terms
AF-A0A5D8YR29-F1-model_v4 S9 family peptidase 0.9934 26 703 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A5D8YR29-F1-model_v4 S9 family peptidase 0.9905 26 703 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A1I8AI13-F1-model_v4 Prolyl endopeptidase (EC 3.4.21.-) 0.9878 512 629 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A354EWB3-F1-model_v4 S9 family peptidase 0.9874 494 696 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A356J7E4-F1-model_v4 S9 family peptidase 0.987 498 703 GO:0004252
GO:0005829
GO:0006508
GO:0070012

Map