F431375

General Info

Members Datasets Scaffolds Average Seq Length
389 194 389 362

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100000030|Ga0075363_1000000305
Length 414
Sequence MKQQIPWIILIVVIVGLRIVWRVFRKRHAAADEIKQNRPLGRLKPWQRKLYTVYVFAKLNTRRYFRDKTAIFFTVAFPLIFLFVFGGIFGKNSGLSFKVAVINQSDSPFATSFTRQVNSSKLFKVSSGVNTLDQAHDKMNHDQIDAAIVLPADFGKTQDHNHYPSGQAVVYYTQNNQQAAQTLTSVMDTQFKSMNAKYVNTAAPFTVTSKQLGGQGLRQFDYTFAGLLGFSILGLGIFGPVNVFPELKKQGILRRYHTTPIRVWQYFMANLVSQALIGLMTMAIMFAVAIDVFHLNIVGNYAELALFLALSIAVIFGIGLAVGGWAKNERQAAPLANITTFPMMFLSGTFFPRYLMPEWLQHATNYLPLTPIIDGVRLIAVEGKGLLDLGPQLAVMAVWLVIIYFIAFRVFRWE

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
172 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
173 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
174 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
175 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
180 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
181 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
188 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
189 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
190 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
193 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
194 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.91
Nodule 0
Rhizoplane 0
Rhizosphere 73.26
Stem 0
Stem Tuber 0
Unclassified 2.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000955 3300001915 Bacteria 8699
2 JGI24740J21852_10007351 3300001979 Bacteria 4482
3 JGI24740J21852_10043961 3300001979 Unclassified 1329
4 JGI24739J22299_10000569 3300001989 Bacteria 13308
5 JGI24737J22298_10000065 3300001990 Bacteria 31150
6 JGI24735J21928_10000023 3300002067 Bacteria 96124
7 JGI24738J21930_10000484 3300002075 Bacteria 11270
8 JGI24742J22300_10000174 3300002244 Bacteria 9518
9 rootH2_10000311 3300003320 Bacteria 277677
10 rootH2_10045046 3300003320 Bacteria 3126
11 rootH2_10097681 3300003320 Bacteria 2766
12 rootH2_10179933 3300003320 Unclassified 3725
13 rootL2_10155895 3300003322 Bacteria 3550
14 rootL2_10347677 3300003322 Bacteria 2795
15 rootH1_10170368 3300003323 Bacteria 1755
16 rootH1_10187075 3300003323 Bacteria 2909
17 JGI25405J52794_10011544 3300003911 Unclassified 1691
18 Ga0070658_10000009 3300005327 Bacteria 319868
19 Ga0070658_10000051 3300005327 Bacteria 118657
20 Ga0070658_10000339 3300005327 Bacteria 40406
21 Ga0070658_10000867 3300005327 Bacteria 25848
22 Ga0070658_10072577 3300005327 Bacteria 2821
23 Ga0070676_10000888 3300005328 Bacteria 14766
24 Ga0070683_100000120 3300005329 Bacteria 51000
25 Ga0070683_100010289 3300005329 Bacteria 8043
26 Ga0070690_100000608 3300005330 Bacteria 18106
27 Ga0068869_100248568 3300005334 Bacteria 1419
28 Ga0070666_10049316 3300005335 Bacteria 2829
29 Ga0070680_100003242 3300005336 Bacteria 12109
30 Ga0070680_100079020 3300005336 Bacteria 2711
31 Ga0070680_100145805 3300005336 Unclassified 1986
32 Ga0070680_100148935 3300005336 Bacteria 1965
33 Ga0070682_100000500 3300005337 Bacteria 24620
34 Ga0070682_100001230 3300005337 Bacteria 14583
35 Ga0070660_100000054 3300005339 Bacteria 67207
36 Ga0070660_100000078 3300005339 Bacteria 58990
37 Ga0070660_100005803 3300005339 Bacteria 8554
38 Ga0070660_100141645 3300005339 Bacteria 1929
39 Ga0070661_100003151 3300005344 Bacteria 11347
40 Ga0070661_100039515 3300005344 Bacteria 3438
41 Ga0070668_100148766 3300005347 Bacteria 1892
42 Ga0070671_100004200 3300005355 Bacteria 11392
43 Ga0070674_100006252 3300005356 Bacteria 6932
44 Ga0070673_100326564 3300005364 Bacteria 1356
45 Ga0070659_100011497 3300005366 Bacteria 6548
46 Ga0070659_100046120 3300005366 Bacteria 3416
47 Ga0070714_100000084 3300005435 Bacteria 80459
48 Ga0070681_10044073 3300005458 Bacteria 4465
49 Ga0070681_10093587 3300005458 Bacteria 2954
50 Ga0070685_10000637 3300005466 Bacteria 19172
51 Ga0070679_100000522 3300005530 Bacteria 32678
52 Ga0070679_100035184 3300005530 Bacteria 4968
53 Ga0070679_100035879 3300005530 Bacteria 4920
54 Ga0070679_100097888 3300005530 Bacteria 2921
55 Ga0070684_100005479 3300005535 Bacteria 9723
56 Ga0070684_100011900 3300005535 Bacteria 6948
57 Ga0070686_100054896 3300005544 Unclassified 2550
58 Ga0070686_100095709 3300005544 Unclassified 1995
59 Ga0070696_100036133 3300005546 Bacteria 3405
60 Ga0070665_100168580 3300005548 Bacteria 2191
61 Ga0068855_100000001 3300005563 Bacteria 818777
62 Ga0068855_100005226 3300005563 Bacteria 15838
63 Ga0068855_100014336 3300005563 Bacteria 9544
64 Ga0068855_100135311 3300005563 Unclassified 2812
65 Ga0068855_100136619 3300005563 Bacteria 2797
66 Ga0068855_100219248 3300005563 Bacteria 2134
67 Ga0068855_100469602 3300005563 Unclassified 1371
68 Ga0070664_100000188 3300005564 Bacteria 43726
69 Ga0068857_100000147 3300005577 Bacteria 43506
70 Ga0068857_100000871 3300005577 Bacteria 22711
71 Ga0068857_100295603 3300005577 Unclassified 1492
72 Ga0068856_100000002 3300005614 Bacteria 372816
73 Ga0068856_100000344 3300005614 Bacteria 50628
74 Ga0068856_100000404 3300005614 Bacteria 47354
75 Ga0068856_100026815 3300005614 Bacteria 5619
76 Ga0068856_100119193 3300005614 Bacteria 2640
77 Ga0068852_100000011 3300005616 Bacteria 141147
78 Ga0068860_100086677 3300005843 Bacteria 2980
79 Ga0068860_100270639 3300005843 Bacteria 1658
80 Ga0081455_10000001 3300005937 Bacteria 603871
81 Ga0081455_10000008 3300005937 Bacteria 256558
82 Ga0075365_10000002 3300006038 Bacteria 226306
83 Ga0075365_10000016 3300006038 Bacteria 71640
84 Ga0075365_10000053 3300006038 Bacteria 35982
85 Ga0075365_10037130 3300006038 Bacteria 3161
86 Ga0075368_10000352 3300006042 Bacteria 13514
87 Ga0075368_10051599 3300006042 Bacteria 1635
88 Ga0075363_100000030 3300006048 Bacteria 27731
89 Ga0075363_100001268 3300006048 Bacteria 9386
90 Ga0075364_10000286 3300006051 Bacteria 24801
91 Ga0075364_10000534 3300006051 Bacteria 19359
92 Ga0075364_10003004 3300006051 Bacteria 9531
93 Ga0075364_10003735 3300006051 Bacteria 8692
94 Ga0075364_10003758 3300006051 Bacteria 8674
95 Ga0075364_10012320 3300006051 Bacteria 5227
96 Ga0075364_10013388 3300006051 Bacteria 5040
97 Ga0075367_10000130 3300006178 Bacteria 22171
98 Ga0075369_10000006 3300006186 Bacteria 132271
99 Ga0075369_10000142 3300006186 Bacteria 19967
100 Ga0075369_10001135 3300006186 Bacteria 8973
101 Ga0075366_10000002 3300006195 Bacteria 153795
102 Ga0075366_10000004 3300006195 Bacteria 111331
103 Ga0075366_10000146 3300006195 Bacteria 29802
104 Ga0075366_10000158 3300006195 Bacteria 28657
105 Ga0075366_10000299 3300006195 Bacteria 22373
106 Ga0075366_10001091 3300006195 Bacteria 13331
107 Ga0097621_100000001 3300006237 Bacteria 632268
108 Ga0097621_100000005 3300006237 Bacteria 143888
109 Ga0097621_100049283 3300006237 Bacteria 3421
110 Ga0075370_10000364 3300006353 Bacteria 16609
111 Ga0075370_10033788 3300006353 Bacteria 2865
112 Ga0068871_100000003 3300006358 Bacteria 141580
113 Ga0068871_100001673 3300006358 Bacteria 14907
114 Ga0105240_10000004 3300009093 Bacteria 708156
115 Ga0105240_10011527 3300009093 Bacteria 12304
116 Ga0111539_10002649 3300009094 Bacteria 23725
117 Ga0105245_10000007 3300009098 Bacteria 312285
118 Ga0105245_10048317 3300009098 Bacteria 3806
119 Ga0105245_10135444 3300009098 Bacteria 2314
120 Ga0105243_10018019 3300009148 Bacteria 5343
121 Ga0105241_10000009 3300009174 Bacteria 258876
122 Ga0105241_10000372 3300009174 Bacteria 34165
123 Ga0105241_10118009 3300009174 Bacteria 2133
124 Ga0105242_10052009 3300009176 Bacteria 3341
125 Ga0105237_10000001 3300009545 Bacteria 1009213
126 Ga0105238_10324007 3300009551 Bacteria 1527
127 Ga0105249_10006007 3300009553 Bacteria 10521
128 Ga0105239_10000599 3300010375 Bacteria 51463
129 Ga0105246_10035692 3300011119 Bacteria 3325
130 Ga0105246_10062182 3300011119 Bacteria 2600
131 Ga0157373_10000059 3300013100 Bacteria 95794
132 Ga0157373_10000422 3300013100 Bacteria 33946
133 Ga0157373_10057628 3300013100 Bacteria 2755
134 Ga0157373_10067085 3300013100 Bacteria 2537
135 Ga0157371_10000181 3300013102 Bacteria 92599
136 Ga0157371_10005542 3300013102 Bacteria 10622
137 Ga0157371_10108932 3300013102 Unclassified 1966
138 Ga0157370_10000115 3300013104 Bacteria 92585
139 Ga0157370_10000167 3300013104 Bacteria 81012
140 Ga0157370_10004353 3300013104 Bacteria 16259
141 Ga0157370_10064844 3300013104 Bacteria 3457
142 Ga0157370_10070039 3300013104 Unclassified 3311
143 Ga0157370_10073429 3300013104 Bacteria 3227
144 Ga0157369_10000026 3300013105 Bacteria 216023
145 Ga0157369_10000054 3300013105 Bacteria 162631
146 Ga0157369_10001342 3300013105 Bacteria 30380
147 Ga0157369_10010005 3300013105 Bacteria 10831
148 Ga0157374_10000014 3300013296 Bacteria 396846
149 Ga0157374_10038491 3300013296 Bacteria 4396
150 Ga0157374_10357848 3300013296 Unclassified 1451
151 Ga0157372_10000002 3300013307 Bacteria 687862
152 Ga0157372_10000143 3300013307 Bacteria 78295
153 Ga0157372_10007714 3300013307 Bacteria 11442
154 Ga0157372_10011421 3300013307 Bacteria 9446
155 Ga0157372_10089141 3300013307 Bacteria 3504
156 Ga0163163_10012972 3300014325 Bacteria 7612
157 Ga0163163_10084428 3300014325 Bacteria 3181
158 Ga0157377_10001069 3300014745 Bacteria 11577
159 Ga0157377_10003148 3300014745 Bacteria 7436
160 Ga0157376_10000085 3300014969 Bacteria 70910
161 Ga0157376_10223834 3300014969 Bacteria 1744
162 Ga0207688_10106281 3300025901 Bacteria 1625
163 Ga0207680_10044600 3300025903 Bacteria 2609
164 Ga0207647_10000398 3300025904 Bacteria 35740
165 Ga0207645_10028194 3300025907 Bacteria 3626
166 Ga0207705_10000010 3300025909 Bacteria 518023
167 Ga0207705_10000019 3300025909 Bacteria 317770
168 Ga0207705_10000057 3300025909 Bacteria 157369
169 Ga0207705_10003206 3300025909 Bacteria 12460
170 Ga0207654_10000002 3300025911 Bacteria 1460142
171 Ga0207654_10001347 3300025911 Bacteria 13029
172 Ga0207654_10141212 3300025911 Unclassified 1536
173 Ga0207695_10000009 3300025913 Bacteria 1034276
174 Ga0207695_10011210 3300025913 Bacteria 10873
175 Ga0207671_10000003 3300025914 Bacteria 1065461
176 Ga0207660_10016449 3300025917 Bacteria 4897
177 Ga0207660_10067608 3300025917 Unclassified 2589
178 Ga0207657_10001171 3300025919 Bacteria 27817
179 Ga0207657_10003406 3300025919 Bacteria 16987
180 Ga0207657_10059051 3300025919 Bacteria 3298
181 Ga0207657_10123875 3300025919 Bacteria 2124
182 Ga0207649_10026499 3300025920 Bacteria 3391
183 Ga0207652_10001055 3300025921 Bacteria 25081
184 Ga0207652_10023053 3300025921 Bacteria 5156
185 Ga0207652_10079550 3300025921 Bacteria 2864
186 Ga0207694_10254746 3300025924 Bacteria 1437
187 Ga0207687_10000008 3300025927 Bacteria 497738
188 Ga0207687_10154080 3300025927 Unclassified 1756
189 Ga0207690_10008060 3300025932 Bacteria 6254
190 Ga0207690_10021197 3300025932 Bacteria 4026
191 Ga0207706_10000004 3300025933 Bacteria 280765
192 Ga0207669_10003223 3300025937 Bacteria 7052
193 Ga0207689_10171238 3300025942 Bacteria 1790
194 Ga0207661_10001570 3300025944 Bacteria 15557
195 Ga0207661_10033266 3300025944 Bacteria 4000
196 Ga0207679_10000074 3300025945 Bacteria 89341
197 Ga0207679_10078708 3300025945 Bacteria 2512
198 Ga0207667_10000003 3300025949 Bacteria 822935
199 Ga0207667_10013421 3300025949 Bacteria 9373
200 Ga0207667_10017600 3300025949 Bacteria 8037
201 Ga0207667_10099645 3300025949 Unclassified 2998
202 Ga0207712_10006698 3300025961 Bacteria 7263
203 Ga0207658_10008443 3300025986 Bacteria 7010
204 Ga0207702_10000001 3300026078 Bacteria 895738
205 Ga0207702_10000051 3300026078 Bacteria 139040
206 Ga0207702_10000234 3300026078 Bacteria 64274
207 Ga0207641_10023426 3300026088 Bacteria 5087
208 Ga0207674_10000032 3300026116 Bacteria 142389
209 Ga0207674_10011293 3300026116 Bacteria 10038
210 Ga0207674_10365619 3300026116 Unclassified 1394
211 Ga0207698_10000024 3300026142 Bacteria 123946
212 Ga0209813_10000003 3300027866 Bacteria 207060
213 Ga0209813_10000262 3300027866 Bacteria 15137
214 Ga0207428_10011293 3300027907 Bacteria 7909
215 Ga0268266_10000942 3300028379 Bacteria 37115
216 Ga0268264_10367758 3300028381 Bacteria 1373
217 Ga0265337_1000055 3300028556 Bacteria 51887
218 Ga0265337_1000070 3300028556 Bacteria 47431
219 Ga0265337_1019285 3300028556 Bacteria 2152
220 Ga0265326_10002012 3300028558 Bacteria 6952
221 Ga0265319_1001770 3300028563 Bacteria 12386
222 Ga0265334_10000004 3300028573 Bacteria 243436
223 Ga0265334_10003916 3300028573 Bacteria 6704
224 Ga0265334_10017300 3300028573 Bacteria 2979
225 Ga0265318_10012252 3300028577 Bacteria 3657
226 Ga0265323_10004651 3300028653 Bacteria 5895
227 Ga0265322_10006842 3300028654 Bacteria 3344
228 Ga0265338_10000003 3300028800 Bacteria 733923
229 Ga0265338_10000074 3300028800 Bacteria 181183
230 Ga0265338_10000666 3300028800 Bacteria 59320
231 Ga0265338_10000807 3300028800 Bacteria 52873
232 Ga0265338_10007669 3300028800 Bacteria 13303
233 Ga0265338_10009517 3300028800 Bacteria 11571
234 Ga0265338_10010610 3300028800 Bacteria 10770
235 Ga0265338_10013973 3300028800 Bacteria 9003
236 Ga0265338_10018548 3300028800 Bacteria 7442
237 Ga0265338_10032415 3300028800 Bacteria 5098
238 Ga0265338_10034040 3300028800 Bacteria 4933
239 Ga0265338_10037196 3300028800 Bacteria 4639
240 Ga0265338_10044997 3300028800 Archaea 4065
241 Ga0265338_10062821 3300028800 Bacteria 3243
242 Ga0265338_10167608 3300028800 Bacteria 1689
243 Ga0265338_10174426 3300028800 Unclassified 1645
244 Ga0265324_10001620 3300029957 Bacteria 12510
245 Ga0316182_1025350 3300030745 Bacteria 7772
246 Ga0265330_10008808 3300031235 Bacteria 4830
247 Ga0265332_10004508 3300031238 Bacteria 6528
248 Ga0265328_10005094 3300031239 Bacteria 5656
249 Ga0265320_10008734 3300031240 Bacteria 6171
250 Ga0265320_10009376 3300031240 Bacteria 5910
251 Ga0265320_10021518 3300031240 Bacteria 3465
252 Ga0265325_10020822 3300031241 Bacteria 3610
253 Ga0265339_10008247 3300031249 Bacteria 6642
254 Ga0265339_10024058 3300031249 Bacteria 3514
255 Ga0265331_10006425 3300031250 Bacteria 6947
256 Ga0265327_10000025 3300031251 Bacteria 380054
257 Ga0265327_10001779 3300031251 Bacteria 25400
258 Ga0265327_10006451 3300031251 Bacteria 9374
259 Ga0265327_10012242 3300031251 Bacteria 5812
260 Ga0265327_10021622 3300031251 Bacteria 3876
261 Ga0265316_10059648 3300031344 Bacteria 2967
262 Ga0307509_10032155 3300031507 Bacteria 5785
263 Ga0265313_10006589 3300031595 Bacteria 8172
264 Ga0265342_10005169 3300031712 Bacteria 10045
265 Ga0307516_10000827 3300031730 Bacteria 42353
266 Ga0307406_10000001 3300031901 Bacteria 638191
267 Ga0307406_10008016 3300031901 Bacteria 5882
268 Ga0373959_0000009 3300034820 Bacteria 52345
269 Ga0395899_0007798 3300037312 Bacteria 8256
270 Ga0395899_0021185 3300037312 Bacteria 4931
271 Ga0395899_0146674 3300037312 Unclassified 1675
272 Ga0395900_0000001 3300037418 Bacteria 931146
273 Ga0395900_0000245 3300037418 Bacteria 85245
274 Ga0395900_0002550 3300037418 Bacteria 19962
275 Ga0395900_0076134 3300037418 Bacteria 3449
276 Ga0395900_0139037 3300037418 Bacteria 2487
277 Ga0395900_0189317 3300037418 Bacteria 2088
278 Ga0395898_0000002 3300037466 Bacteria 931013
279 Ga0395898_0004914 3300037466 Bacteria 14512
280 Ga0395898_0011251 3300037466 Bacteria 9311
281 Ga0395898_0018801 3300037466 Bacteria 7040
282 Ga0395905_0001808 3300037471 Bacteria 24746
283 Ga0395905_0004287 3300037471 Bacteria 14873
284 Ga0395905_0015195 3300037471 Bacteria 7323
285 Ga0395901_0000006 3300038443 Bacteria 514112
286 Ga0395901_0001706 3300038443 Bacteria 22691
287 Ga0395901_0009928 3300038443 Bacteria 9650
288 Ga0395901_0206750 3300038443 Bacteria 2056
289 Ga0395901_0333807 3300038443 Bacteria 1567
290 Ga0439438_007034 3300041405 Bacteria 3890
291 Ga0439461_0000540 3300041410 Bacteria 5474
292 Ga0439466_0045626 3300041411 Bacteria 1449
293 Ga0439452_038266 3300042010 Bacteria 1140
294 Ga0439434_0000652 3300042435 Bacteria 9950
295 Ga0466963_0050523 3300044694 Bacteria 2752
296 Ga0495629_0013921 3300046459 Bacteria 5798
297 Ga0495638_0000227 3300046460 Bacteria 77425
298 Ga0495641_0085480 3300046461 Bacteria 1412
299 Ga0495597_0014795 3300046542 Bacteria 3709
300 Ga0495622_0000008 3300046557 Bacteria 232461
301 Ga0495588_0000277 3300046674 Bacteria 38749
302 Ga0495658_0003002 3300046683 Bacteria 8444
303 Ga0495649_0002460 3300046694 Bacteria 13029
304 Ga0495600_0007993 3300046809 Bacteria 6481
305 Ga0495672_0000010 3300047320 Bacteria 545038
306 Ga0495676_0223550 3300047321 Bacteria 1296
307 Ga0495602_0120527 3300048088 Bacteria 2111
308 Ga0496118_0064167 3300048921 Unclassified 2697
309 Ga0501033_0020240 3300049570 Bacteria 5030
310 Ga0501033_0169764 3300049570 Unclassified 1567
311 Ga0501034_0000024 3300049571 Bacteria 263735
312 Ga0501034_0002390 3300049571 Bacteria 22779
313 Ga0501034_0003938 3300049571 Bacteria 16687
314 Ga0501037_0188775 3300049573 Bacteria 1460
315 Ga0501038_0076238 3300049574 Bacteria 2833
316 Ga0501047_0000024 3300049581 Bacteria 230397
317 Ga0501073_0009757 3300049589 Bacteria 7069
318 Ga0501073_0058152 3300049589 Bacteria 2703
319 Ga0501080_0000016 3300049742 Bacteria 96392
320 Ga0501080_0079990 3300049742 Bacteria 3038
321 Ga0501083_0024971 3300049744 Bacteria 4139
322 Ga0501083_0234007 3300049744 Bacteria 1196
323 Ga0501035_0000005 3300049822 Bacteria 392980
324 Ga0501044_0001150 3300049823 Bacteria 31351
325 nmdc:mga03n38_42_c2 3300050490 Bacteria 23810
326 nmdc:mga00v17_1926_c1 3300050491 Bacteria 10725
327 nmdc:mga00v17_20322_c1 3300050491 Bacteria 3802
328 nmdc:mga00v17_209855_c1 3300050491 Bacteria 1260
329 nmdc:mga00v17_2318_c1 3300050491 Bacteria 9755
330 nmdc:mga00v17_245_c1 3300050491 Bacteria 31982
331 nmdc:mga00v17_27448_c1 3300050491 Bacteria 3323
332 nmdc:mga00v17_386_c1 3300050491 Bacteria 24801
333 nmdc:mga00v17_4839_c1 3300050491 Bacteria 7054
334 nmdc:mga00v17_603_c1 3300050491 Bacteria 19885
335 nmdc:mga0yw44_16162_c1 3300050492 Bacteria 4024
336 nmdc:mga0yw44_21608_c1 3300050492 Bacteria 3593
337 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
338 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
339 nmdc:mga0yw44_715_c1 3300050492 Bacteria 12169
340 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
341 nmdc:mga0k408_11_c1 3300050493 Bacteria 130371
342 nmdc:mga0k408_16167_c1 3300050493 Bacteria 4137
343 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
344 nmdc:mga0k408_47_c1 3300050493 Bacteria 61154
345 nmdc:mga0k408_5738_c1 3300050493 Bacteria 6603
346 nmdc:mga0k408_89_c1 3300050493 Bacteria 24952
347 nmdc:mga06z11_21_c1 3300050494 Bacteria 69936
348 nmdc:mga06z11_2_c1 3300050494 Bacteria 169056
349 nmdc:mga06z11_40408_c1 3300050494 Bacteria 2328
350 nmdc:mga04h51_1186_c1 3300050495 Bacteria 6013
351 nmdc:mga04h51_3_c1 3300050495 Bacteria 207078
352 nmdc:mga07m45_2299_c1 3300050496 Bacteria 8943
353 nmdc:mga07m45_52637_c1 3300050496 Bacteria 2298
354 nmdc:mga08y16_2389_c1 3300050511 Bacteria 19267
355 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
356 nmdc:mga0sz30_3592_c2 3300050516 Bacteria 3393
357 nmdc:mga0sz30_3_c2 3300050516 Bacteria 66048
358 nmdc:mga0sz30_4488_c1 3300050516 Bacteria 5048
359 Ga0500610_0000027 3300053079 Bacteria 53458
360 Ga0500610_0024417 3300053079 Bacteria 3005
361 Ga0500643_000009 3300053087 Bacteria 444150
362 Ga0500643_001010 3300053087 Bacteria 17186
363 Ga0500644_0000052 3300053088 Bacteria 69890
364 Ga0500644_0004522 3300053088 Bacteria 3484
365 Ga0500583_0000105 3300053092 Bacteria 44085
366 Ga0500583_0111721 3300053092 Bacteria 1346
367 Ga0500651_0000260 3300053093 Bacteria 31486
368 Ga0500566_0000001 3300053094 Bacteria 1101031
369 Ga0500555_000001 3300053103 Bacteria 1353713
370 Ga0500555_000002 3300053103 Bacteria 1314346
371 Ga0500556_0000369 3300053104 Bacteria 32993
372 Ga0500562_000002 3300053108 Bacteria 977234
373 Ga0500569_000006 3300053109 Bacteria 77425
374 Ga0500593_000001 3300053117 Bacteria 784404
375 Ga0500594_0022154 3300053118 Unclassified 1600
376 Ga0500614_000001 3300053123 Bacteria 1274484
377 Ga0500614_005311 3300053123 Bacteria 2705
378 Ga0500652_000009 3300053131 Bacteria 163737
379 Ga0500655_000328 3300053133 Bacteria 10461
380 Ga0500568_0004437 3300053139 Bacteria 7500
381 Ga0500577_0003168 3300053142 Bacteria 4258
382 Ga0500588_0000011 3300053146 Bacteria 48690
383 Ga0500589_000003 3300053147 Bacteria 220717
384 Ga0500603_004544 3300053150 Bacteria 2971
385 Ga0500616_0000005 3300053153 Bacteria 961725
386 Ga0500616_0039249 3300053153 Bacteria 2554
387 Ga0500649_000003 3300053722 Bacteria 140482
388 Ga0500570_001430 3300053724 Bacteria 11008
389 Ga0500611_000732 3300053727 Bacteria 3378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042010 Ga0439452_038266 Ga0439452_038266_10_1011 313
2 3300046542 Ga0495597_0014795 Ga0495597_0014795_2743_3696 316
3 3300053092 Ga0500583_0111721 Ga0500583_0111721_25_1047 320
4 3300047321 Ga0495676_0223550 Ga0495676_0223550_20_1042 326
5 3300049744 Ga0501083_0234007 Ga0501083_0234007_166_1164 331
6 3300006186 Ga0075369_10000006 Ga0075369_1000000632 332
7 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_301271_302374 332
8 3300005329 Ga0070683_100000120 Ga0070683_10000012016 333
9 3300005535 Ga0070684_100011900 Ga0070684_1000119007 333
10 3300005577 Ga0068857_100295603 Ga0068857_1002956032 333
11 3300005614 Ga0068856_100026815 Ga0068856_1000268152 333
12 3300009093 Ga0105240_10011527 Ga0105240_100115276 333
13 3300013100 Ga0157373_10000059 Ga0157373_1000005954 333
14 3300013104 Ga0157370_10064844 Ga0157370_100648442 333
15 3300025911 Ga0207654_10141212 Ga0207654_101412121 333
16 3300025913 Ga0207695_10011210 Ga0207695_100112108 333
17 3300025944 Ga0207661_10001570 Ga0207661_1000157015 333
18 3300026116 Ga0207674_10365619 Ga0207674_103656192 333
19 3300046674 Ga0495588_0000277 Ga0495588_0000277_2438_3547 333
20 3300053087 Ga0500643_001010 Ga0500643_001010_2737_3843 333
21 3300053123 Ga0500614_000001 Ga0500614_000001_825356_826465 333
22 3300053722 Ga0500649_000003 Ga0500649_000003_79646_80755 333
23 3300025921 Ga0207652_10079550 Ga0207652_100795503 334
24 3300005435 Ga0070714_100000084 Ga0070714_10000008487 336
25 3300028800 Ga0265338_10037196 Ga0265338_100371966 336
26 3300005330 Ga0070690_100000608 Ga0070690_10000060814 337
27 3300005544 Ga0070686_100054896 Ga0070686_1000548963 337
28 3300005563 Ga0068855_100005226 Ga0068855_1000052268 338
29 3300025949 Ga0207667_10017600 Ga0207667_100176004 338
30 3300053104 Ga0500556_0000369 Ga0500556_0000369_16252_17355 338
31 3300013307 Ga0157372_10000143 Ga0157372_1000014382 340
32 3300047320 Ga0495672_0000010 Ga0495672_0000010_112821_113936 340
33 3300014325 Ga0163163_10012972 Ga0163163_100129724 342
34 3300053727 Ga0500611_000732 Ga0500611_000732_1346_2449 343
35 3300014745 Ga0157377_10003148 Ga0157377_100031485 345
36 3300049742 Ga0501080_0079990 Ga0501080_0079990_1250_2362 345
37 3300053088 Ga0500644_0004522 Ga0500644_0004522_2034_3137 345
38 3300053093 Ga0500651_0000260 Ga0500651_0000260_7396_8508 345
39 3300053103 Ga0500555_000001 Ga0500555_000001_221981_223084 345
40 3300053142 Ga0500577_0003168 Ga0500577_0003168_2334_3437 345
41 3300013307 Ga0157372_10007714 Ga0157372_100077144 346
42 3300006195 Ga0075366_10000146 Ga0075366_1000014626 347
43 3300050493 nmdc:mga0k408_16167_c1 nmdc:mga0k408_16167_c1_291_1394 347
44 3300050494 nmdc:mga06z11_21_c1 nmdc:mga06z11_21_c1_40090_41193 347
45 3300005327 Ga0070658_10072577 Ga0070658_100725773 349
46 3300005339 Ga0070660_100000078 Ga0070660_10000007822 349
47 3300005563 Ga0068855_100000001 Ga0068855_100000001632 349
48 3300005563 Ga0068855_100219248 Ga0068855_1002192482 349
49 3300005614 Ga0068856_100119193 Ga0068856_1001191932 349
50 3300006038 Ga0075365_10037130 Ga0075365_100371303 349
51 3300006042 Ga0075368_10000352 Ga0075368_100003524 349
52 3300006048 Ga0075363_100001268 Ga0075363_1000012687 349
53 3300006051 Ga0075364_10012320 Ga0075364_100123205 349
54 3300006178 Ga0075367_10000130 Ga0075367_1000013019 349
55 3300006186 Ga0075369_10000142 Ga0075369_1000014219 349
56 3300009093 Ga0105240_10000004 Ga0105240_10000004259 349
57 3300009174 Ga0105241_10000009 Ga0105241_1000000921 349
58 3300009545 Ga0105237_10000001 Ga0105237_10000001692 349
59 3300013104 Ga0157370_10000115 Ga0157370_1000011574 349
60 3300013105 Ga0157369_10000054 Ga0157369_10000054158 349
61 3300013307 Ga0157372_10000002 Ga0157372_10000002237 349
62 3300025911 Ga0207654_10000002 Ga0207654_10000002255 349
63 3300025913 Ga0207695_10000009 Ga0207695_10000009639 349
64 3300025914 Ga0207671_10000003 Ga0207671_10000003695 349
65 3300025949 Ga0207667_10000003 Ga0207667_10000003620 349
66 3300027866 Ga0209813_10000262 Ga0209813_1000026210 349
67 3300030745 Ga0316182_1025350 Ga0316182_10253502 349
68 3300041405 Ga0439438_007034 Ga0439438_007034_26_1135 349
69 3300041410 Ga0439461_0000540 Ga0439461_0000540_1228_2337 349
70 3300041411 Ga0439466_0045626 Ga0439466_0045626_25_1134 349
71 3300042435 Ga0439434_0000652 Ga0439434_0000652_345_1454 349
72 3300049571 Ga0501034_0000024 Ga0501034_0000024_127294_128403 349
73 3300050491 nmdc:mga00v17_245_c1 nmdc:mga00v17_245_c1_24083_25192 349
74 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_371456_372565 349
75 3300050494 nmdc:mga06z11_40408_c1 nmdc:mga06z11_40408_c1_125_1234 349
76 3300050495 nmdc:mga04h51_1186_c1 nmdc:mga04h51_1186_c1_1893_3002 349
77 3300050516 nmdc:mga0sz30_3592_c2 nmdc:mga0sz30_3592_c2_1466_2575 349
78 3300053079 Ga0500610_0000027 Ga0500610_0000027_21812_22921 349
79 3300053088 Ga0500644_0000052 Ga0500644_0000052_740_1849 349
80 3300053153 Ga0500616_0039249 Ga0500616_0039249_818_1939 349
81 3300006038 Ga0075365_10000002 Ga0075365_10000002145 351
82 3300006051 Ga0075364_10000534 Ga0075364_1000053418 351
83 3300006051 Ga0075364_10003735 Ga0075364_100037358 351
84 3300009148 Ga0105243_10018019 Ga0105243_100180197 351
85 3300013102 Ga0157371_10000181 Ga0157371_1000018117 351
86 3300050491 nmdc:mga00v17_4839_c1 nmdc:mga00v17_4839_c1_4773_5882 351
87 3300050491 nmdc:mga00v17_603_c1 nmdc:mga00v17_603_c1_10305_11411 351
88 3300050492 nmdc:mga0yw44_3_c1 nmdc:mga0yw44_3_c1_324012_325118 351
89 3300050496 nmdc:mga07m45_52637_c1 nmdc:mga07m45_52637_c1_966_2084 351
90 3300001979 JGI24740J21852_10043961 JGI24740J21852_100439612 352
91 3300001989 JGI24739J22299_10000569 JGI24739J22299_1000056918 352
92 3300002067 JGI24735J21928_10000023 JGI24735J21928_1000002362 352
93 3300002075 JGI24738J21930_10000484 JGI24738J21930_1000048413 352
94 3300003320 rootH2_10045046 rootH2_100450463 352
95 3300003320 rootH2_10097681 rootH2_100976813 352
96 3300003322 rootL2_10155895 rootL2_101558954 352
97 3300005327 Ga0070658_10000009 Ga0070658_1000000995 352
98 3300005327 Ga0070658_10000867 Ga0070658_1000086726 352
99 3300005329 Ga0070683_100010289 Ga0070683_1000102897 352
100 3300005336 Ga0070680_100003242 Ga0070680_1000032426 352
101 3300005339 Ga0070660_100005803 Ga0070660_1000058033 352
102 3300005339 Ga0070660_100141645 Ga0070660_1001416452 352
103 3300005344 Ga0070661_100003151 Ga0070661_10000315113 352
104 3300005344 Ga0070661_100039515 Ga0070661_1000395152 352
105 3300005356 Ga0070674_100006252 Ga0070674_1000062527 352
106 3300005364 Ga0070673_100326564 Ga0070673_1003265641 352
107 3300005366 Ga0070659_100011497 Ga0070659_1000114972 352
108 3300005366 Ga0070659_100046120 Ga0070659_1000461205 352
109 3300005466 Ga0070685_10000637 Ga0070685_1000063718 352
110 3300005530 Ga0070679_100035184 Ga0070679_1000351843 352
111 3300005544 Ga0070686_100095709 Ga0070686_1000957092 352
112 3300005548 Ga0070665_100168580 Ga0070665_1001685801 352
113 3300005564 Ga0070664_100000188 Ga0070664_1000001885 352
114 3300005577 Ga0068857_100000147 Ga0068857_10000014720 352
115 3300005614 Ga0068856_100000344 Ga0068856_10000034427 352
116 3300005614 Ga0068856_100000404 Ga0068856_10000040431 352
117 3300005616 Ga0068852_100000011 Ga0068852_100000011122 352
118 3300005843 Ga0068860_100086677 Ga0068860_1000866772 352
119 3300006051 Ga0075364_10013388 Ga0075364_100133886 352
120 3300006186 Ga0075369_10001135 Ga0075369_100011357 352
121 3300006195 Ga0075366_10000002 Ga0075366_10000002101 352
122 3300006195 Ga0075366_10000004 Ga0075366_1000000461 352
123 3300006195 Ga0075366_10001091 Ga0075366_100010916 352
124 3300006237 Ga0097621_100000001 Ga0097621_100000001393 352
125 3300006237 Ga0097621_100049283 Ga0097621_1000492831 352
126 3300006358 Ga0068871_100001673 Ga0068871_10000167315 352
127 3300009174 Ga0105241_10118009 Ga0105241_101180093 352
128 3300010375 Ga0105239_10000599 Ga0105239_1000059911 352
129 3300011119 Ga0105246_10035692 Ga0105246_100356922 352
130 3300011119 Ga0105246_10062182 Ga0105246_100621822 352
131 3300013100 Ga0157373_10000422 Ga0157373_1000042227 352
132 3300013100 Ga0157373_10057628 Ga0157373_100576284 352
133 3300013100 Ga0157373_10067085 Ga0157373_100670852 352
134 3300013102 Ga0157371_10005542 Ga0157371_100055422 352
135 3300013102 Ga0157371_10108932 Ga0157371_101089322 352
136 3300013104 Ga0157370_10000167 Ga0157370_1000016715 352
137 3300013104 Ga0157370_10004353 Ga0157370_100043532 352
138 3300013105 Ga0157369_10000026 Ga0157369_10000026140 352
139 3300013105 Ga0157369_10001342 Ga0157369_1000134234 352
140 3300014745 Ga0157377_10001069 Ga0157377_1000106911 352
141 3300014969 Ga0157376_10000085 Ga0157376_100000853 352
142 3300014969 Ga0157376_10223834 Ga0157376_102238342 352
143 3300025901 Ga0207688_10106281 Ga0207688_101062812 352
144 3300025904 Ga0207647_10000398 Ga0207647_1000039814 352
145 3300025909 Ga0207705_10000010 Ga0207705_10000010431 352
146 3300025909 Ga0207705_10003206 Ga0207705_100032066 352
147 3300025917 Ga0207660_10016449 Ga0207660_100164496 352
148 3300025919 Ga0207657_10001171 Ga0207657_1000117113 352
149 3300025919 Ga0207657_10059051 Ga0207657_100590512 352
150 3300025919 Ga0207657_10123875 Ga0207657_101238752 352
151 3300025920 Ga0207649_10026499 Ga0207649_100264995 352
152 3300025921 Ga0207652_10023053 Ga0207652_100230533 352
153 3300025932 Ga0207690_10008060 Ga0207690_100080602 352
154 3300025932 Ga0207690_10021197 Ga0207690_100211972 352
155 3300025933 Ga0207706_10000004 Ga0207706_10000004104 352
156 3300025937 Ga0207669_10003223 Ga0207669_100032233 352
157 3300025944 Ga0207661_10033266 Ga0207661_100332666 352
158 3300025945 Ga0207679_10000074 Ga0207679_1000007450 352
159 3300025945 Ga0207679_10078708 Ga0207679_100787083 352
160 3300025986 Ga0207658_10008443 Ga0207658_100084439 352
161 3300026078 Ga0207702_10000051 Ga0207702_10000051126 352
162 3300026078 Ga0207702_10000234 Ga0207702_1000023445 352
163 3300026116 Ga0207674_10000032 Ga0207674_10000032120 352
164 3300026142 Ga0207698_10000024 Ga0207698_1000002450 352
165 3300028379 Ga0268266_10000942 Ga0268266_1000094226 352
166 3300028381 Ga0268264_10367758 Ga0268264_103677582 352
167 3300037418 Ga0395900_0000001 Ga0395900_0000001_461420_462526 352
168 3300037418 Ga0395900_0189317 Ga0395900_0189317_673_1782 352
169 3300037466 Ga0395898_0000002 Ga0395898_0000002_643480_644586 352
170 3300038443 Ga0395901_0000006 Ga0395901_0000006_289156_290262 352
171 3300049589 Ga0501073_0058152 Ga0501073_0058152_790_1905 352
172 3300050491 nmdc:mga00v17_209855_c1 nmdc:mga00v17_209855_c1_75_1181 352
173 3300050493 nmdc:mga0k408_11_c1 nmdc:mga0k408_11_c1_30272_31381 352
174 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_223889_225007 352
175 3300050493 nmdc:mga0k408_5738_c1 nmdc:mga0k408_5738_c1_5210_6316 352
176 3300050516 nmdc:mga0sz30_3_c2 nmdc:mga0sz30_3_c2_14230_15348 352
177 3300050516 nmdc:mga0sz30_4488_c1 nmdc:mga0sz30_4488_c1_390_1496 352
178 3300053108 Ga0500562_000002 Ga0500562_000002_467373_468482 352
179 3300005535 Ga0070684_100005479 Ga0070684_10000547910 353
180 3300013296 Ga0157374_10038491 Ga0157374_100384914 353
181 3300014325 Ga0163163_10084428 Ga0163163_100844282 353
182 3300028800 Ga0265338_10013973 Ga0265338_100139733 353
183 3300031240 Ga0265320_10009376 Ga0265320_100093763 353
184 3300034820 Ga0373959_0000009 Ga0373959_0000009_37781_38893 353
185 3300046694 Ga0495649_0002460 Ga0495649_0002460_9901_11010 353
186 3300048921 Ga0496118_0064167 Ga0496118_0064167_1241_2356 353
187 3300003323 rootH1_10187075 rootH1_101870753 354
188 3300005458 Ga0070681_10044073 Ga0070681_100440733 354
189 3300006038 Ga0075365_10000016 Ga0075365_100000165 354
190 3300013307 Ga0157372_10089141 Ga0157372_100891413 354
191 3300028556 Ga0265337_1000070 Ga0265337_100007038 354
192 3300028558 Ga0265326_10002012 Ga0265326_100020122 354
193 3300028573 Ga0265334_10000004 Ga0265334_10000004168 354
194 3300028800 Ga0265338_10000003 Ga0265338_10000003140 354
195 3300028800 Ga0265338_10000807 Ga0265338_100008076 354
196 3300028800 Ga0265338_10044997 Ga0265338_100449974 354
197 3300031595 Ga0265313_10006589 Ga0265313_100065894 354
198 3300050492 nmdc:mga0yw44_7_c1 nmdc:mga0yw44_7_c1_37791_38903 354
199 3300053724 Ga0500570_001430 Ga0500570_001430_3728_4834 354
200 3300006051 Ga0075364_10003004 Ga0075364_100030045 355
201 3300013307 Ga0157372_10011421 Ga0157372_100114216 355
202 3300031507 Ga0307509_10032155 Ga0307509_100321556 355
203 3300050491 nmdc:mga00v17_2318_c1 nmdc:mga00v17_2318_c1_6303_7415 355
204 3300006195 Ga0075366_10000158 Ga0075366_1000015825 356
205 3300050492 nmdc:mga0yw44_16162_c1 nmdc:mga0yw44_16162_c1_697_1824 356
206 3300050493 nmdc:mga0k408_47_c1 nmdc:mga0k408_47_c1_1309_2436 356
207 3300053139 Ga0500568_0004437 Ga0500568_0004437_3537_4643 356
208 3300005347 Ga0070668_100148766 Ga0070668_1001487662 357
209 3300006038 Ga0075365_10000053 Ga0075365_1000005332 357
210 3300006051 Ga0075364_10000286 Ga0075364_1000028622 357
211 3300006195 Ga0075366_10000299 Ga0075366_1000029910 357
212 3300049571 Ga0501034_0003938 Ga0501034_0003938_14068_15195 357
213 3300050491 nmdc:mga00v17_386_c1 nmdc:mga00v17_386_c1_7925_9037 357
214 3300050492 nmdc:mga0yw44_715_c1 nmdc:mga0yw44_715_c1_1029_2141 357
215 3300050493 nmdc:mga0k408_89_c1 nmdc:mga0k408_89_c1_17260_18372 357
216 3300006051 Ga0075364_10003758 Ga0075364_100037586 358
217 3300006353 Ga0075370_10033788 Ga0075370_100337882 358
218 3300009098 Ga0105245_10048317 Ga0105245_100483173 358
219 3300009174 Ga0105241_10000372 Ga0105241_100003727 358
220 3300025911 Ga0207654_10001347 Ga0207654_1000134714 358
221 3300050491 nmdc:mga00v17_1926_c1 nmdc:mga00v17_1926_c1_3926_5035 358
222 3300031901 Ga0307406_10008016 Ga0307406_100080166 359
223 3300050491 nmdc:mga00v17_20322_c1 nmdc:mga00v17_20322_c1_2090_3199 359
224 3300053150 Ga0500603_004544 Ga0500603_004544_1307_2419 359
225 3300009176 Ga0105242_10052009 Ga0105242_100520094 360
226 3300038443 Ga0395901_0206750 Ga0395901_0206750_307_1416 360
227 3300028800 Ga0265338_10010610 Ga0265338_1001061014 361
228 3300028800 Ga0265338_10034040 Ga0265338_100340404 361
229 3300028800 Ga0265338_10000074 Ga0265338_1000007485 362
230 3300028800 Ga0265338_10062821 Ga0265338_100628212 362
231 3300005335 Ga0070666_10049316 Ga0070666_100493162 363
232 3300025903 Ga0207680_10044600 Ga0207680_100446002 363
233 3300053133 Ga0500655_000328 Ga0500655_000328_284_1402 363
234 3300001990 JGI24737J22298_10000065 JGI24737J22298_1000006512 364
235 3300005337 Ga0070682_100000500 Ga0070682_1000005003 366
236 3300005546 Ga0070696_100036133 Ga0070696_1000361334 366
237 3300005563 Ga0068855_100135311 Ga0068855_1001353112 366
238 3300005563 Ga0068855_100469602 Ga0068855_1004696022 366
239 3300009098 Ga0105245_10135444 Ga0105245_101354442 366
240 3300009551 Ga0105238_10324007 Ga0105238_103240071 366
241 3300013104 Ga0157370_10070039 Ga0157370_100700391 366
242 3300013105 Ga0157369_10010005 Ga0157369_1001000511 366
243 3300025924 Ga0207694_10254746 Ga0207694_102547462 366
244 3300025927 Ga0207687_10154080 Ga0207687_101540802 366
245 3300025949 Ga0207667_10099645 Ga0207667_100996452 366
246 3300037471 Ga0395905_0001808 Ga0395905_0001808_23359_24465 366
247 3300049589 Ga0501073_0009757 Ga0501073_0009757_1636_2745 366
248 3300049742 Ga0501080_0000016 Ga0501080_0000016_44522_45631 366
249 3300053087 Ga0500643_000009 Ga0500643_000009_354649_355758 366
250 3300053153 Ga0500616_0000005 Ga0500616_0000005_15931_17040 366
251 3300005334 Ga0068869_100248568 Ga0068869_1002485681 367
252 3300005337 Ga0070682_100001230 Ga0070682_10000123020 367
253 3300005355 Ga0070671_100004200 Ga0070671_10000420014 367
254 3300005843 Ga0068860_100270639 Ga0068860_1002706392 367
255 3300006042 Ga0075368_10051599 Ga0075368_100515992 367
256 3300009553 Ga0105249_10006007 Ga0105249_100060077 367
257 3300025942 Ga0207689_10171238 Ga0207689_101712382 367
258 3300025961 Ga0207712_10006698 Ga0207712_1000669810 367
259 3300026088 Ga0207641_10023426 Ga0207641_100234263 367
260 3300028556 Ga0265337_1000055 Ga0265337_100005557 367
261 3300028563 Ga0265319_1001770 Ga0265319_100177013 367
262 3300028573 Ga0265334_10003916 Ga0265334_100039165 367
263 3300028800 Ga0265338_10000666 Ga0265338_1000066621 367
264 3300028800 Ga0265338_10007669 Ga0265338_1000766911 367
265 3300028800 Ga0265338_10018548 Ga0265338_100185488 367
266 3300028800 Ga0265338_10167608 Ga0265338_101676081 367
267 3300028800 Ga0265338_10174426 Ga0265338_101744262 367
268 3300029957 Ga0265324_10001620 Ga0265324_100016206 367
269 3300031240 Ga0265320_10008734 Ga0265320_100087346 367
270 3300031249 Ga0265339_10024058 Ga0265339_100240582 367
271 3300031251 Ga0265327_10012242 Ga0265327_100122425 367
272 3300031251 Ga0265327_10021622 Ga0265327_100216224 367
273 3300053079 Ga0500610_0024417 Ga0500610_0024417_888_1991 367
274 3300053092 Ga0500583_0000105 Ga0500583_0000105_38502_39605 367
275 3300053118 Ga0500594_0022154 Ga0500594_0022154_389_1492 367
276 3300053147 Ga0500589_000003 Ga0500589_000003_215124_216227 367
277 3300003322 rootL2_10347677 rootL2_103476772 368
278 3300005327 Ga0070658_10000051 Ga0070658_1000005172 368
279 3300005327 Ga0070658_10000339 Ga0070658_1000033928 368
280 3300005336 Ga0070680_100145805 Ga0070680_1001458052 368
281 3300005339 Ga0070660_100000054 Ga0070660_10000005440 368
282 3300005530 Ga0070679_100000522 Ga0070679_10000052224 368
283 3300005530 Ga0070679_100035879 Ga0070679_1000358797 368
284 3300005577 Ga0068857_100000871 Ga0068857_10000087110 368
285 3300025909 Ga0207705_10000019 Ga0207705_10000019110 368
286 3300025909 Ga0207705_10000057 Ga0207705_10000057157 368
287 3300025917 Ga0207660_10067608 Ga0207660_100676082 368
288 3300025919 Ga0207657_10003406 Ga0207657_1000340611 368
289 3300025921 Ga0207652_10001055 Ga0207652_1000105516 368
290 3300026116 Ga0207674_10011293 Ga0207674_1001129311 368
291 3300028573 Ga0265334_10017300 Ga0265334_100173004 368
292 3300028577 Ga0265318_10012252 Ga0265318_100122522 368
293 3300028653 Ga0265323_10004651 Ga0265323_100046511 368
294 3300028654 Ga0265322_10006842 Ga0265322_100068422 368
295 3300028800 Ga0265338_10009517 Ga0265338_100095172 368
296 3300028800 Ga0265338_10032415 Ga0265338_100324153 368
297 3300031235 Ga0265330_10008808 Ga0265330_100088081 368
298 3300031238 Ga0265332_10004508 Ga0265332_100045088 368
299 3300031239 Ga0265328_10005094 Ga0265328_100050943 368
300 3300031240 Ga0265320_10021518 Ga0265320_100215182 368
301 3300031241 Ga0265325_10020822 Ga0265325_100208222 368
302 3300031249 Ga0265339_10008247 Ga0265339_100082472 368
303 3300031250 Ga0265331_10006425 Ga0265331_100064251 368
304 3300031251 Ga0265327_10006451 Ga0265327_100064514 368
305 3300031344 Ga0265316_10059648 Ga0265316_100596482 368
306 3300031712 Ga0265342_10005169 Ga0265342_100051694 368
307 3300037312 Ga0395899_0007798 Ga0395899_0007798_6071_7183 368
308 3300037312 Ga0395899_0021185 Ga0395899_0021185_1995_3110 368
309 3300037418 Ga0395900_0000245 Ga0395900_0000245_4514_5626 368
310 3300037418 Ga0395900_0002550 Ga0395900_0002550_18101_19207 368
311 3300037418 Ga0395900_0139037 Ga0395900_0139037_95_1210 368
312 3300037466 Ga0395898_0004914 Ga0395898_0004914_11794_12909 368
313 3300037466 Ga0395898_0011251 Ga0395898_0011251_2934_4046 368
314 3300037471 Ga0395905_0004287 Ga0395905_0004287_1846_2961 368
315 3300037471 Ga0395905_0015195 Ga0395905_0015195_5474_6586 368
316 3300038443 Ga0395901_0009928 Ga0395901_0009928_2140_3252 368
317 3300038443 Ga0395901_0333807 Ga0395901_0333807_203_1309 368
318 3300049570 Ga0501033_0169764 Ga0501033_0169764_234_1346 368
319 3300049573 Ga0501037_0188775 Ga0501037_0188775_297_1415 368
320 3300053117 Ga0500593_000001 Ga0500593_000001_75949_77067 368
321 3300002244 JGI24742J22300_10000174 JGI24742J22300_1000017410 369
322 3300003320 rootH2_10000311 rootH2_10000311110 369
323 3300003320 rootH2_10179933 rootH2_101799332 369
324 3300003323 rootH1_10170368 rootH1_101703682 369
325 3300003911 JGI25405J52794_10011544 JGI25405J52794_100115442 369
326 3300005328 Ga0070676_10000888 Ga0070676_100008884 369
327 3300005336 Ga0070680_100148935 Ga0070680_1001489352 369
328 3300005458 Ga0070681_10093587 Ga0070681_100935874 369
329 3300005530 Ga0070679_100097888 Ga0070679_1000978882 369
330 3300005563 Ga0068855_100014336 Ga0068855_1000143365 369
331 3300005563 Ga0068855_100136619 Ga0068855_1001366193 369
332 3300005614 Ga0068856_100000002 Ga0068856_100000002157 369
333 3300005937 Ga0081455_10000001 Ga0081455_10000001242 369
334 3300005937 Ga0081455_10000008 Ga0081455_10000008284 369
335 3300006048 Ga0075363_100000030 Ga0075363_1000000305 369
336 3300006237 Ga0097621_100000005 Ga0097621_100000005102 369
337 3300006353 Ga0075370_10000364 Ga0075370_1000036414 369
338 3300006358 Ga0068871_100000003 Ga0068871_10000000370 369
339 3300009094 Ga0111539_10002649 Ga0111539_1000264912 369
340 3300009098 Ga0105245_10000007 Ga0105245_10000007208 369
341 3300013104 Ga0157370_10073429 Ga0157370_100734294 369
342 3300013296 Ga0157374_10000014 Ga0157374_10000014208 369
343 3300025907 Ga0207645_10028194 Ga0207645_100281944 369
344 3300025927 Ga0207687_10000008 Ga0207687_10000008208 369
345 3300025949 Ga0207667_10013421 Ga0207667_100134219 369
346 3300026078 Ga0207702_10000001 Ga0207702_10000001274 369
347 3300027866 Ga0209813_10000003 Ga0209813_1000000332 369
348 3300027907 Ga0207428_10011293 Ga0207428_100112939 369
349 3300028556 Ga0265337_1019285 Ga0265337_10192852 369
350 3300031251 Ga0265327_10000025 Ga0265327_10000025180 369
351 3300031251 Ga0265327_10001779 Ga0265327_1000177911 369
352 3300031730 Ga0307516_10000827 Ga0307516_1000082735 369
353 3300031901 Ga0307406_10000001 Ga0307406_10000001414 369
354 3300037312 Ga0395899_0146674 Ga0395899_0146674_487_1605 369
355 3300037418 Ga0395900_0076134 Ga0395900_0076134_1098_2216 369
356 3300037466 Ga0395898_0018801 Ga0395898_0018801_990_2108 369
357 3300038443 Ga0395901_0001706 Ga0395901_0001706_19629_20747 369
358 3300044694 Ga0466963_0050523 Ga0466963_0050523_1415_2647 369
359 3300046459 Ga0495629_0013921 Ga0495629_0013921_4109_5224 369
360 3300046460 Ga0495638_0000227 Ga0495638_0000227_64239_65351 369
361 3300046461 Ga0495641_0085480 Ga0495641_0085480_170_1285 369
362 3300046557 Ga0495622_0000008 Ga0495622_0000008_105642_106757 369
363 3300046683 Ga0495658_0003002 Ga0495658_0003002_2027_3142 369
364 3300046809 Ga0495600_0007993 Ga0495600_0007993_1637_2752 369
365 3300048088 Ga0495602_0120527 Ga0495602_0120527_119_1234 369
366 3300049570 Ga0501033_0020240 Ga0501033_0020240_1367_2485 369
367 3300049571 Ga0501034_0002390 Ga0501034_0002390_10360_11478 369
368 3300049574 Ga0501038_0076238 Ga0501038_0076238_388_1506 369
369 3300049581 Ga0501047_0000024 Ga0501047_0000024_219213_220331 369
370 3300049744 Ga0501083_0024971 Ga0501083_0024971_1028_2149 369
371 3300049822 Ga0501035_0000005 Ga0501035_0000005_219298_220416 369
372 3300049823 Ga0501044_0001150 Ga0501044_0001150_23890_25008 369
373 3300050490 nmdc:mga03n38_42_c2 nmdc:mga03n38_42_c2_18600_19844 369
374 3300050491 nmdc:mga00v17_27448_c1 nmdc:mga00v17_27448_c1_1504_2643 369
375 3300050492 nmdc:mga0yw44_21608_c1 nmdc:mga0yw44_21608_c1_2260_3399 369
376 3300050494 nmdc:mga06z11_2_c1 nmdc:mga06z11_2_c1_143758_145002 369
377 3300050495 nmdc:mga04h51_3_c1 nmdc:mga04h51_3_c1_181778_183022 369
378 3300050496 nmdc:mga07m45_2299_c1 nmdc:mga07m45_2299_c1_5034_6278 369
379 3300050511 nmdc:mga08y16_2389_c1 nmdc:mga08y16_2389_c1_12881_13990 369
380 3300053094 Ga0500566_0000001 Ga0500566_0000001_189257_190372 369
381 3300053103 Ga0500555_000002 Ga0500555_000002_1065327_1066436 369
382 3300053109 Ga0500569_000006 Ga0500569_000006_64239_65351 369
383 3300053123 Ga0500614_005311 Ga0500614_005311_565_1680 369
384 3300053131 Ga0500652_000009 Ga0500652_000009_76126_77235 369
385 3300053146 Ga0500588_0000011 Ga0500588_0000011_44121_45233 369
386 3300001915 JGI24741J21665_1000955 JGI24741J21665_10009553 370
387 3300001979 JGI24740J21852_10007351 JGI24740J21852_100073511 370
388 3300005336 Ga0070680_100079020 Ga0070680_1000790201 370
389 3300013296 Ga0157374_10357848 Ga0157374_103578482 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

172

381

0.88

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

68

409

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p05-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g 0.7113 178 370
7fdv-assembly1.cif.gz_D cryo-em structure of the human cholesterol transporter abcg1 in complex with cholesterol 0.6937 179 369
7r8d-assembly1.cif.gz_B the structure of human abcg1 e242q with cholesterol 0.6919 179 369
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.6891 176 368
3cni-assembly1.cif.gz_A-2 crystal structure of a domain of a putative abc type-2 transporter from thermotoga maritima msb8 0.6843 53 168
ID Description Score Start End Superfamily
af_P37624_579_712_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7359 51 156 3.40.1710.10
af_Q8T674_383_525_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7178 51 160 3.40.1710.10
af_P0AFP9_40_168_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6929 51 173 3.40.1710.10
af_P0AFQ2_47_201_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6894 46 158 3.40.1710.10
3cniA00 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6625 53 168 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A0A8EBT9-F1-model_v4 ABC-2 type transporter 0.9316 176 370 GO:0043190
GO:0140359
AF-A0A4U3MJJ2-F1-model_v4 ABC transporter permease 0.9237 173 370 GO:0016020
GO:0140359
AF-J0XE15-F1-model_v4 ABC-2 type transporter 0.9223 176 370 GO:0016020
GO:0140359
AF-A0A501UHT8-F1-model_v4 deleted 0.9213 179 370
AF-A0A846PH14-F1-model_v4 ABC transporter permease 0.9183 177 370 GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
79.24 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map