F431396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 389 | 250 | 389 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10001794|Ga0105240_1000179413 |
| Length | 172 |
| Sequence | LQVIAYQVNHCAHPQLLIGGWTMKPVPEGWARVCPAVFYEDASKAIDWLCRAFGFEVQLKIEGEGGRIEHSELRFGEGLVMVSQAGGSSERKKPLPTRSPRAVGGVNTQMLALFVDDADSHCARARAAGGKIHDEPTTNDYGDDYWADRTYRVEDPEGHHWWFMQRVRTGGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 183 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 184 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 191 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 192 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 193 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 194 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 195 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 196 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 197 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 242 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 243 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 244 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 245 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 246 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 247 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 248 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.8 |
| Nodule | 0 |
| Rhizoplane | 4.63 |
| Rhizosphere | 90.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10163043 | 3300001990 | Bacteria | 658 |
| 2 | JGI24749J21850_1017216 | 3300002076 | Bacteria | 1017 |
| 3 | rootH2_10231588 | 3300003320 | Unclassified | 1801 |
| 4 | rootH1_10207350 | 3300003323 | Unclassified | 3261 |
| 5 | JGI25404J52841_10072195 | 3300003659 | Bacteria | 721 |
| 6 | Ga0058860_10732615 | 3300004801 | Unclassified | 625 |
| 7 | Ga0065704_10072298 | 3300005289 | Bacteria | 8785 |
| 8 | Ga0065715_10101557 | 3300005293 | Bacteria | 3156 |
| 9 | Ga0070658_10001909 | 3300005327 | Bacteria | 17592 |
| 10 | Ga0070676_10613670 | 3300005328 | Bacteria | 786 |
| 11 | Ga0070683_100042023 | 3300005329 | Bacteria | 4209 |
| 12 | Ga0070690_100000245 | 3300005330 | Bacteria | 27972 |
| 13 | Ga0070670_100056960 | 3300005331 | Bacteria | 3355 |
| 14 | Ga0070670_101003682 | 3300005331 | Bacteria | 759 |
| 15 | Ga0070670_101113632 | 3300005331 | Unclassified | 720 |
| 16 | Ga0070677_10000065 | 3300005333 | Bacteria | 33290 |
| 17 | Ga0070677_10078721 | 3300005333 | Bacteria | 1405 |
| 18 | Ga0068869_100028014 | 3300005334 | Bacteria | 3932 |
| 19 | Ga0068869_101434183 | 3300005334 | Bacteria | 612 |
| 20 | Ga0068869_101705378 | 3300005334 | Unclassified | 562 |
| 21 | Ga0070680_100297676 | 3300005336 | Bacteria | 1368 |
| 22 | Ga0070682_100004766 | 3300005337 | Bacteria | 7542 |
| 23 | Ga0070682_100159544 | 3300005337 | Bacteria | 1556 |
| 24 | Ga0070682_100250120 | 3300005337 | Unclassified | 1277 |
| 25 | Ga0070682_100614798 | 3300005337 | Unclassified | 860 |
| 26 | Ga0068868_100033933 | 3300005338 | Bacteria | 3936 |
| 27 | Ga0068868_100346969 | 3300005338 | Unclassified | 1271 |
| 28 | Ga0070660_100001727 | 3300005339 | Bacteria | 14984 |
| 29 | Ga0070689_100022099 | 3300005340 | Bacteria | 4747 |
| 30 | Ga0070689_100275480 | 3300005340 | Bacteria | 1394 |
| 31 | Ga0070689_100327951 | 3300005340 | Bacteria | 1280 |
| 32 | Ga0070689_102246637 | 3300005340 | Bacteria | 500 |
| 33 | Ga0070691_10159708 | 3300005341 | Bacteria | 1161 |
| 34 | Ga0070687_100000121 | 3300005343 | Bacteria | 26702 |
| 35 | Ga0070687_100550754 | 3300005343 | Bacteria | 785 |
| 36 | Ga0070668_100015566 | 3300005347 | Bacteria | 5685 |
| 37 | Ga0070669_100005655 | 3300005353 | Bacteria | 9030 |
| 38 | Ga0070669_100329750 | 3300005353 | Bacteria | 1234 |
| 39 | Ga0070669_101077175 | 3300005353 | Bacteria | 692 |
| 40 | Ga0070675_100026385 | 3300005354 | Bacteria | 4662 |
| 41 | Ga0070671_100138883 | 3300005355 | Bacteria | 2050 |
| 42 | Ga0070671_100393453 | 3300005355 | Bacteria | 1185 |
| 43 | Ga0070671_100474435 | 3300005355 | Unclassified | 1074 |
| 44 | Ga0070674_100009991 | 3300005356 | Bacteria | 5715 |
| 45 | Ga0070673_100651451 | 3300005364 | Bacteria | 964 |
| 46 | Ga0070688_100000751 | 3300005365 | Bacteria | 15988 |
| 47 | Ga0070688_100264201 | 3300005365 | Unclassified | 1230 |
| 48 | Ga0070688_100554929 | 3300005365 | Bacteria | 874 |
| 49 | Ga0070659_100002473 | 3300005366 | Bacteria | 13117 |
| 50 | Ga0070659_100494431 | 3300005366 | Bacteria | 1042 |
| 51 | Ga0070667_100053694 | 3300005367 | Bacteria | 3401 |
| 52 | Ga0070667_100450014 | 3300005367 | Bacteria | 1177 |
| 53 | Ga0070701_10009212 | 3300005438 | Bacteria | 4317 |
| 54 | Ga0070711_100348731 | 3300005439 | Bacteria | 1190 |
| 55 | Ga0070705_100001864 | 3300005440 | Bacteria | 10866 |
| 56 | Ga0070705_100130374 | 3300005440 | Bacteria | 1639 |
| 57 | Ga0070700_100005808 | 3300005441 | Bacteria | 6550 |
| 58 | Ga0070694_100027778 | 3300005444 | Bacteria | 3678 |
| 59 | Ga0070663_100023501 | 3300005455 | Bacteria | 4132 |
| 60 | Ga0070678_100005934 | 3300005456 | Bacteria | 7106 |
| 61 | Ga0070678_100726742 | 3300005456 | Unclassified | 896 |
| 62 | Ga0070681_11481107 | 3300005458 | Bacteria | 603 |
| 63 | Ga0068867_100001116 | 3300005459 | Bacteria | 18372 |
| 64 | Ga0068867_100198969 | 3300005459 | Bacteria | 1603 |
| 65 | Ga0068867_100896658 | 3300005459 | Bacteria | 798 |
| 66 | Ga0070685_10000339 | 3300005466 | Bacteria | 28730 |
| 67 | Ga0070706_100279155 | 3300005467 | Bacteria | 1559 |
| 68 | Ga0070698_100055793 | 3300005471 | Bacteria | 4004 |
| 69 | Ga0070698_101212089 | 3300005471 | Unclassified | 704 |
| 70 | Ga0070699_100658828 | 3300005518 | Unclassified | 956 |
| 71 | Ga0070679_100144306 | 3300005530 | Bacteria | 2359 |
| 72 | Ga0070684_100029696 | 3300005535 | Bacteria | 4636 |
| 73 | Ga0070697_100817103 | 3300005536 | Unclassified | 825 |
| 74 | Ga0068853_100005141 | 3300005539 | Bacteria | 10231 |
| 75 | Ga0070672_100021954 | 3300005543 | Bacteria | 4679 |
| 76 | Ga0070672_100514752 | 3300005543 | Bacteria | 1036 |
| 77 | Ga0070672_101350777 | 3300005543 | Unclassified | 637 |
| 78 | Ga0070686_100000321 | 3300005544 | Bacteria | 31535 |
| 79 | Ga0070696_100043282 | 3300005546 | Bacteria | 3115 |
| 80 | Ga0070693_100000957 | 3300005547 | Bacteria | 12805 |
| 81 | Ga0070665_100164676 | 3300005548 | Bacteria | 2220 |
| 82 | Ga0070665_100287662 | 3300005548 | Bacteria | 1646 |
| 83 | Ga0070665_100421527 | 3300005548 | Bacteria | 1343 |
| 84 | Ga0070704_100309924 | 3300005549 | Bacteria | 1318 |
| 85 | Ga0068855_100004620 | 3300005563 | Bacteria | 16802 |
| 86 | Ga0068855_100199207 | 3300005563 | Bacteria | 2255 |
| 87 | Ga0070664_100011858 | 3300005564 | Bacteria | 7074 |
| 88 | Ga0070664_100117325 | 3300005564 | Bacteria | 2328 |
| 89 | Ga0068857_100249077 | 3300005577 | Bacteria | 1628 |
| 90 | Ga0068854_100000649 | 3300005578 | Bacteria | 20632 |
| 91 | Ga0068854_100718928 | 3300005578 | Unclassified | 864 |
| 92 | Ga0070702_100199885 | 3300005615 | Bacteria | 1322 |
| 93 | Ga0068852_100004965 | 3300005616 | Bacteria | 9455 |
| 94 | Ga0068852_100108581 | 3300005616 | Bacteria | 2518 |
| 95 | Ga0068859_100004936 | 3300005617 | Bacteria | 13556 |
| 96 | Ga0068859_100231726 | 3300005617 | Bacteria | 1935 |
| 97 | Ga0068859_100606410 | 3300005617 | Bacteria | 1188 |
| 98 | Ga0068859_100979972 | 3300005617 | Bacteria | 928 |
| 99 | Ga0068859_101014881 | 3300005617 | Bacteria | 911 |
| 100 | Ga0068864_100105452 | 3300005618 | Bacteria | 2505 |
| 101 | Ga0068866_10000626 | 3300005718 | Bacteria | 16065 |
| 102 | Ga0068861_100001208 | 3300005719 | Bacteria | 16084 |
| 103 | Ga0068861_100377508 | 3300005719 | Unclassified | 1251 |
| 104 | Ga0068851_10000607 | 3300005834 | Bacteria | 15426 |
| 105 | Ga0068870_10000035 | 3300005840 | Bacteria | 43532 |
| 106 | Ga0068870_10528420 | 3300005840 | Bacteria | 791 |
| 107 | Ga0068863_100003321 | 3300005841 | Bacteria | 15886 |
| 108 | Ga0068863_101560618 | 3300005841 | Unclassified | 669 |
| 109 | Ga0068860_100107714 | 3300005843 | Bacteria | 2663 |
| 110 | Ga0068860_100898315 | 3300005843 | Bacteria | 902 |
| 111 | Ga0068862_100001652 | 3300005844 | Bacteria | 20286 |
| 112 | Ga0068862_100275479 | 3300005844 | Bacteria | 1540 |
| 113 | Ga0068862_101016333 | 3300005844 | Unclassified | 821 |
| 114 | Ga0081540_1000052 | 3300005983 | Bacteria | 124880 |
| 115 | Ga0081540_1000426 | 3300005983 | Bacteria | 41613 |
| 116 | Ga0081540_1000788 | 3300005983 | Bacteria | 29095 |
| 117 | Ga0097621_100092224 | 3300006237 | Bacteria | 2536 |
| 118 | Ga0097621_100319425 | 3300006237 | Bacteria | 1375 |
| 119 | Ga0097621_100443336 | 3300006237 | Bacteria | 1169 |
| 120 | Ga0068871_100000529 | 3300006358 | Bacteria | 26128 |
| 121 | Ga0068871_100032928 | 3300006358 | Bacteria | 4099 |
| 122 | Ga0075428_100064223 | 3300006844 | Bacteria | 4020 |
| 123 | Ga0075430_100030282 | 3300006846 | Bacteria | 4595 |
| 124 | Ga0075430_100144916 | 3300006846 | Unclassified | 1978 |
| 125 | Ga0075431_100017661 | 3300006847 | Bacteria | 7253 |
| 126 | Ga0075431_100073146 | 3300006847 | Bacteria | 3537 |
| 127 | Ga0075431_100522266 | 3300006847 | Bacteria | 1177 |
| 128 | Ga0075431_100553910 | 3300006847 | Bacteria | 1137 |
| 129 | Ga0075433_10578235 | 3300006852 | Bacteria | 987 |
| 130 | Ga0075434_100629328 | 3300006871 | Bacteria | 1092 |
| 131 | Ga0075434_100767805 | 3300006871 | Bacteria | 981 |
| 132 | Ga0075434_100863700 | 3300006871 | Unclassified | 920 |
| 133 | Ga0075429_100043972 | 3300006880 | Bacteria | 3885 |
| 134 | Ga0068865_100000955 | 3300006881 | Bacteria | 16461 |
| 135 | Ga0068865_100469375 | 3300006881 | Bacteria | 1044 |
| 136 | Ga0097620_100004935 | 3300006931 | Bacteria | 13556 |
| 137 | Ga0097620_100231726 | 3300006931 | Bacteria | 1935 |
| 138 | Ga0097620_100606383 | 3300006931 | Bacteria | 1188 |
| 139 | Ga0097620_101014640 | 3300006931 | Bacteria | 911 |
| 140 | Ga0075435_100165890 | 3300007076 | Bacteria | 1862 |
| 141 | Ga0105240_10001794 | 3300009093 | Bacteria | 36131 |
| 142 | Ga0111539_10003645 | 3300009094 | Bacteria | 20294 |
| 143 | Ga0105245_10002417 | 3300009098 | Bacteria | 16904 |
| 144 | Ga0105245_10006833 | 3300009098 | Bacteria | 10009 |
| 145 | Ga0105247_10000495 | 3300009101 | Bacteria | 32681 |
| 146 | Ga0105247_10000863 | 3300009101 | Bacteria | 22935 |
| 147 | Ga0114129_10238687 | 3300009147 | Bacteria | 2444 |
| 148 | Ga0114129_12088526 | 3300009147 | Bacteria | 684 |
| 149 | Ga0105241_10000244 | 3300009174 | Bacteria | 41239 |
| 150 | Ga0105242_10003018 | 3300009176 | Bacteria | 13157 |
| 151 | Ga0105242_10078037 | 3300009176 | Bacteria | 2764 |
| 152 | Ga0105248_11417190 | 3300009177 | Bacteria | 786 |
| 153 | Ga0105248_12036452 | 3300009177 | Unclassified | 652 |
| 154 | Ga0105237_10001821 | 3300009545 | Bacteria | 27502 |
| 155 | Ga0105238_10000705 | 3300009551 | Bacteria | 34903 |
| 156 | Ga0105249_10000549 | 3300009553 | Bacteria | 34738 |
| 157 | Ga0105239_10034279 | 3300010375 | Bacteria | 5574 |
| 158 | Ga0105246_10004199 | 3300011119 | Bacteria | 8754 |
| 159 | Ga0105246_10399900 | 3300011119 | Unclassified | 1140 |
| 160 | Ga0157373_10008204 | 3300013100 | Bacteria | 7767 |
| 161 | Ga0157371_10002774 | 3300013102 | Bacteria | 16440 |
| 162 | Ga0157369_10001108 | 3300013105 | Bacteria | 33690 |
| 163 | Ga0157369_11496140 | 3300013105 | Bacteria | 687 |
| 164 | Ga0157374_10001654 | 3300013296 | Bacteria | 18651 |
| 165 | Ga0157374_11339307 | 3300013296 | Bacteria | 738 |
| 166 | Ga0157378_10001798 | 3300013297 | Bacteria | 19261 |
| 167 | Ga0157378_11093750 | 3300013297 | Bacteria | 834 |
| 168 | Ga0163162_10002320 | 3300013306 | Bacteria | 17852 |
| 169 | Ga0157372_10016419 | 3300013307 | Bacteria | 7943 |
| 170 | Ga0157375_10003855 | 3300013308 | Bacteria | 13018 |
| 171 | Ga0157375_10207367 | 3300013308 | Bacteria | 2117 |
| 172 | Ga0157375_10505231 | 3300013308 | Bacteria | 1373 |
| 173 | Ga0163163_10009683 | 3300014325 | Bacteria | 8621 |
| 174 | Ga0157380_10234992 | 3300014326 | Unclassified | 1649 |
| 175 | Ga0157377_10001667 | 3300014745 | Bacteria | 9677 |
| 176 | Ga0157379_10001549 | 3300014968 | Bacteria | 18909 |
| 177 | Ga0157376_10002532 | 3300014969 | Bacteria | 12387 |
| 178 | Ga0157376_10133677 | 3300014969 | Bacteria | 2217 |
| 179 | Ga0157376_10153562 | 3300014969 | Bacteria | 2079 |
| 180 | Ga0157376_11167810 | 3300014969 | Bacteria | 797 |
| 181 | Ga0157376_11478171 | 3300014969 | Bacteria | 712 |
| 182 | Ga0163161_10085000 | 3300017792 | Bacteria | 2334 |
| 183 | Ga0213872_10058032 | 3300021361 | Bacteria | 1752 |
| 184 | Ga0207697_10000520 | 3300025315 | Bacteria | 21713 |
| 185 | Ga0207656_10000802 | 3300025321 | Bacteria | 10265 |
| 186 | Ga0207656_10049060 | 3300025321 | Bacteria | 1819 |
| 187 | Ga0207653_10113884 | 3300025885 | Bacteria | 968 |
| 188 | Ga0207642_10056802 | 3300025899 | Bacteria | 1797 |
| 189 | Ga0207710_10000993 | 3300025900 | Bacteria | 14831 |
| 190 | Ga0207710_10026345 | 3300025900 | Bacteria | 2512 |
| 191 | Ga0207688_10000098 | 3300025901 | Bacteria | 34240 |
| 192 | Ga0207688_10233895 | 3300025901 | Bacteria | 1110 |
| 193 | Ga0207647_10011704 | 3300025904 | Bacteria | 6141 |
| 194 | Ga0207645_10000055 | 3300025907 | Bacteria | 83041 |
| 195 | Ga0207645_10685299 | 3300025907 | Bacteria | 696 |
| 196 | Ga0207643_10000054 | 3300025908 | Bacteria | 74219 |
| 197 | Ga0207643_10704853 | 3300025908 | Unclassified | 652 |
| 198 | Ga0207705_10011080 | 3300025909 | Bacteria | 6537 |
| 199 | Ga0207684_10489994 | 3300025910 | Bacteria | 1054 |
| 200 | Ga0207654_10429406 | 3300025911 | Bacteria | 923 |
| 201 | Ga0207695_10041598 | 3300025913 | Bacteria | 4918 |
| 202 | Ga0207671_10031518 | 3300025914 | Bacteria | 3950 |
| 203 | Ga0207663_10267912 | 3300025916 | Bacteria | 1264 |
| 204 | Ga0207660_10294528 | 3300025917 | Bacteria | 1291 |
| 205 | Ga0207662_10000418 | 3300025918 | Bacteria | 18784 |
| 206 | Ga0207662_10600705 | 3300025918 | Unclassified | 766 |
| 207 | Ga0207657_10000070 | 3300025919 | Bacteria | 94634 |
| 208 | Ga0207649_10257630 | 3300025920 | Bacteria | 1259 |
| 209 | Ga0207652_10110827 | 3300025921 | Bacteria | 2434 |
| 210 | Ga0207681_10054525 | 3300025923 | Bacteria | 2718 |
| 211 | Ga0207681_10167648 | 3300025923 | Bacteria | 1662 |
| 212 | Ga0207681_11116790 | 3300025923 | Bacteria | 662 |
| 213 | Ga0207650_10053702 | 3300025925 | Bacteria | 2987 |
| 214 | Ga0207650_10876684 | 3300025925 | Unclassified | 762 |
| 215 | Ga0207659_10000136 | 3300025926 | Bacteria | 43133 |
| 216 | Ga0207659_10121589 | 3300025926 | Bacteria | 2001 |
| 217 | Ga0207687_10056692 | 3300025927 | Bacteria | 2749 |
| 218 | Ga0207706_10000094 | 3300025933 | Bacteria | 92942 |
| 219 | Ga0207686_10028703 | 3300025934 | Bacteria | 3274 |
| 220 | Ga0207709_10507411 | 3300025935 | Bacteria | 942 |
| 221 | Ga0207670_10000420 | 3300025936 | Bacteria | 24017 |
| 222 | Ga0207670_10001606 | 3300025936 | Bacteria | 11781 |
| 223 | Ga0207670_10043487 | 3300025936 | Unclassified | 2967 |
| 224 | Ga0207669_10000303 | 3300025937 | Bacteria | 22654 |
| 225 | Ga0207704_10002966 | 3300025938 | Bacteria | 7668 |
| 226 | Ga0207691_10000173 | 3300025940 | Bacteria | 60288 |
| 227 | Ga0207691_10003696 | 3300025940 | Bacteria | 14837 |
| 228 | Ga0207711_10007180 | 3300025941 | Bacteria | 9335 |
| 229 | Ga0207711_11014350 | 3300025941 | Bacteria | 770 |
| 230 | Ga0207689_10000287 | 3300025942 | Bacteria | 45869 |
| 231 | Ga0207679_10421907 | 3300025945 | Unclassified | 1177 |
| 232 | Ga0207667_10018498 | 3300025949 | Bacteria | 7812 |
| 233 | Ga0207667_10132835 | 3300025949 | Bacteria | 2564 |
| 234 | Ga0207712_10001006 | 3300025961 | Bacteria | 20086 |
| 235 | Ga0207668_10001718 | 3300025972 | Bacteria | 12822 |
| 236 | Ga0207668_10270854 | 3300025972 | Bacteria | 1388 |
| 237 | Ga0207658_10045597 | 3300025986 | Bacteria | 3196 |
| 238 | Ga0207658_10325298 | 3300025986 | Bacteria | 1332 |
| 239 | Ga0207677_10001271 | 3300026023 | Bacteria | 13555 |
| 240 | Ga0207677_10021183 | 3300026023 | Bacteria | 3966 |
| 241 | Ga0207677_10234091 | 3300026023 | Bacteria | 1481 |
| 242 | Ga0207703_11577192 | 3300026035 | Viruses | 632 |
| 243 | Ga0207639_10081070 | 3300026041 | Bacteria | 2569 |
| 244 | Ga0207678_10008975 | 3300026067 | Bacteria | 8798 |
| 245 | Ga0207678_10220740 | 3300026067 | Unclassified | 1622 |
| 246 | Ga0207708_10020333 | 3300026075 | Bacteria | 5007 |
| 247 | Ga0207708_11153465 | 3300026075 | Bacteria | 677 |
| 248 | Ga0207702_11514440 | 3300026078 | Bacteria | 664 |
| 249 | Ga0207641_10057288 | 3300026088 | Bacteria | 3313 |
| 250 | Ga0207641_10361807 | 3300026088 | Unclassified | 1385 |
| 251 | Ga0207641_11408291 | 3300026088 | Unclassified | 698 |
| 252 | Ga0207648_10000247 | 3300026089 | Bacteria | 58338 |
| 253 | Ga0207648_10432282 | 3300026089 | Bacteria | 1197 |
| 254 | Ga0207648_10815722 | 3300026089 | Unclassified | 869 |
| 255 | Ga0207676_10002084 | 3300026095 | Bacteria | 14509 |
| 256 | Ga0207674_10000426 | 3300026116 | Bacteria | 54953 |
| 257 | Ga0207674_11084390 | 3300026116 | Unclassified | 770 |
| 258 | Ga0207675_100000063 | 3300026118 | Bacteria | 80198 |
| 259 | Ga0207675_100066699 | 3300026118 | Bacteria | 3364 |
| 260 | Ga0207683_10000053 | 3300026121 | Bacteria | 85332 |
| 261 | Ga0207683_10197995 | 3300026121 | Unclassified | 1826 |
| 262 | Ga0207698_10191736 | 3300026142 | Bacteria | 1821 |
| 263 | Ga0207698_10215808 | 3300026142 | Bacteria | 1730 |
| 264 | Ga0207428_10008546 | 3300027907 | Bacteria | 9237 |
| 265 | Ga0268266_10001038 | 3300028379 | Bacteria | 34907 |
| 266 | Ga0268266_10014270 | 3300028379 | Bacteria | 6833 |
| 267 | Ga0268266_10155639 | 3300028379 | Bacteria | 2064 |
| 268 | Ga0268266_11300442 | 3300028379 | Bacteria | 702 |
| 269 | Ga0268265_10002440 | 3300028380 | Bacteria | 14023 |
| 270 | Ga0268265_10340575 | 3300028380 | Bacteria | 1365 |
| 271 | Ga0268265_10382537 | 3300028380 | Bacteria | 1295 |
| 272 | Ga0268264_10000986 | 3300028381 | Bacteria | 29112 |
| 273 | Ga0268264_10422132 | 3300028381 | Bacteria | 1286 |
| 274 | Ga0265337_1006553 | 3300028556 | Bacteria | 4472 |
| 275 | Ga0265338_10462293 | 3300028800 | Bacteria | 897 |
| 276 | Ga0265332_10078102 | 3300031238 | Unclassified | 1405 |
| 277 | Ga0265320_10026140 | 3300031240 | Bacteria | 3059 |
| 278 | Ga0307513_10186928 | 3300031456 | Unclassified | 1928 |
| 279 | Ga0307509_10209612 | 3300031507 | Bacteria | 1775 |
| 280 | Ga0307508_10625674 | 3300031616 | Bacteria | 680 |
| 281 | Ga0307416_101407988 | 3300032002 | Unclassified | 803 |
| 282 | Ga0307414_10865970 | 3300032004 | Unclassified | 827 |
| 283 | Ga0373928_0122101 | 3300035084 | Bacteria | 699 |
| 284 | Ga0373954_0370655 | 3300035118 | Bacteria | 707 |
| 285 | Ga0373943_0223431 | 3300035170 | Bacteria | 1050 |
| 286 | Ga0373955_0097355 | 3300035172 | Bacteria | 1685 |
| 287 | Ga0373942_0050634 | 3300035207 | Bacteria | 1164 |
| 288 | Ga0373931_0219248 | 3300035691 | Bacteria | 1145 |
| 289 | Ga0373935_0560954 | 3300035692 | Bacteria | 833 |
| 290 | Ga0373937_0025263 | 3300036401 | Bacteria | 5363 |
| 291 | Ga0373937_0145579 | 3300036401 | Bacteria | 2218 |
| 292 | Ga0373937_0877639 | 3300036401 | Bacteria | 846 |
| 293 | Ga0436361_0762727 | 3300039447 | Bacteria | 2909 |
| 294 | Ga0436363_0557477 | 3300039450 | Bacteria | 806 |
| 295 | Ga0436363_1644309 | 3300039450 | Bacteria | 3908 |
| 296 | Ga0451793_0230728 | 3300041452 | Unclassified | 1255 |
| 297 | Ga0451797_1281718 | 3300041453 | Bacteria | 573 |
| 298 | Ga0451797_1426412 | 3300041453 | Bacteria | 1138 |
| 299 | Ga0451795_1253713 | 3300041456 | Bacteria | 633 |
| 300 | Ga0451802_1599663 | 3300041460 | Bacteria | 866 |
| 301 | Ga0451804_0597469 | 3300041463 | Unclassified | 606 |
| 302 | Ga0451807_0323219 | 3300041486 | Unclassified | 647 |
| 303 | Ga0451807_0973877 | 3300041486 | Bacteria | 8476 |
| 304 | Ga0451807_2228592 | 3300041486 | Bacteria | 975 |
| 305 | Ga0451839_0610579 | 3300041496 | Bacteria | 639 |
| 306 | Ga0451841_0134688 | 3300041498 | Bacteria | 558 |
| 307 | Ga0451849_1563670 | 3300041505 | Bacteria | 824 |
| 308 | Ga0451853_3720402 | 3300041512 | Bacteria | 727 |
| 309 | Ga0439448_0015039 | 3300042005 | Bacteria | 2341 |
| 310 | Ga0439450_172642 | 3300042008 | Bacteria | 572 |
| 311 | Ga0439455_0007368 | 3300042012 | Bacteria | 2324 |
| 312 | Ga0450896_036063 | 3300042133 | Bacteria | 761 |
| 313 | Ga0466959_0583288 | 3300045049 | Bacteria | 753 |
| 314 | Ga0451576_1046052 | 3300045051 | Bacteria | 855 |
| 315 | Ga0495662_0107882 | 3300046476 | Bacteria | 1364 |
| 316 | Ga0495628_0001524 | 3300046516 | Bacteria | 21223 |
| 317 | Ga0495613_0861305 | 3300046689 | Unclassified | 588 |
| 318 | Ga0495600_0427869 | 3300046809 | Unclassified | 821 |
| 319 | Ga0495684_0028093 | 3300047471 | Bacteria | 4320 |
| 320 | Ga0496102_0049731 | 3300048905 | Bacteria | 3814 |
| 321 | Ga0496104_0279400 | 3300048907 | Bacteria | 1583 |
| 322 | Ga0496106_0014970 | 3300048909 | Bacteria | 5738 |
| 323 | Ga0496107_0004956 | 3300048910 | Bacteria | 9062 |
| 324 | Ga0496108_0037698 | 3300048911 | Bacteria | 4028 |
| 325 | Ga0496109_0009793 | 3300048912 | Bacteria | 8181 |
| 326 | Ga0496110_1036935 | 3300048913 | Bacteria | 728 |
| 327 | Ga0496112_0003038 | 3300048915 | Bacteria | 13727 |
| 328 | Ga0496114_0339763 | 3300048917 | Bacteria | 1328 |
| 329 | Ga0501032_0048053 | 3300049569 | Bacteria | 2881 |
| 330 | Ga0501032_0726977 | 3300049569 | Unclassified | 629 |
| 331 | Ga0501033_0842101 | 3300049570 | Unclassified | 618 |
| 332 | Ga0501034_0009350 | 3300049571 | Bacteria | 10270 |
| 333 | Ga0501034_0071472 | 3300049571 | Unclassified | 3480 |
| 334 | Ga0501038_0195177 | 3300049574 | Bacteria | 1627 |
| 335 | Ga0501038_0776032 | 3300049574 | Bacteria | 714 |
| 336 | Ga0501043_0009569 | 3300049579 | Bacteria | 7598 |
| 337 | Ga0501043_0154335 | 3300049579 | Bacteria | 1796 |
| 338 | Ga0501043_0542149 | 3300049579 | Bacteria | 865 |
| 339 | Ga0501046_0062571 | 3300049580 | Bacteria | 2907 |
| 340 | Ga0501046_0133271 | 3300049580 | Bacteria | 1883 |
| 341 | Ga0501047_0004201 | 3300049581 | Bacteria | 13563 |
| 342 | Ga0501047_0032486 | 3300049581 | Bacteria | 5038 |
| 343 | Ga0501047_0066619 | 3300049581 | Unclassified | 3471 |
| 344 | Ga0501048_0479839 | 3300049582 | Unclassified | 891 |
| 345 | Ga0501048_0616559 | 3300049582 | Bacteria | 779 |
| 346 | Ga0501067_0016751 | 3300049583 | Bacteria | 4049 |
| 347 | Ga0501068_0000163 | 3300049584 | Bacteria | 30860 |
| 348 | Ga0501069_0022084 | 3300049585 | Bacteria | 3458 |
| 349 | Ga0501070_0000705 | 3300049586 | Bacteria | 30678 |
| 350 | Ga0501072_0000004 | 3300049588 | Bacteria | 282897 |
| 351 | Ga0501073_0065046 | 3300049589 | Bacteria | 2543 |
| 352 | Ga0501073_0120952 | 3300049589 | Bacteria | 1814 |
| 353 | Ga0501076_0104274 | 3300049592 | Bacteria | 2288 |
| 354 | Ga0501077_0012019 | 3300049593 | Bacteria | 5419 |
| 355 | Ga0501077_0468588 | 3300049593 | Bacteria | 807 |
| 356 | Ga0501079_0021414 | 3300049741 | Bacteria | 4945 |
| 357 | Ga0501080_0034224 | 3300049742 | Bacteria | 4741 |
| 358 | Ga0501080_0729166 | 3300049742 | Bacteria | 873 |
| 359 | Ga0501080_0895132 | 3300049742 | Bacteria | 774 |
| 360 | Ga0501083_0020261 | 3300049744 | Bacteria | 4628 |
| 361 | Ga0501083_0700954 | 3300049744 | Bacteria | 658 |
| 362 | Ga0501044_0093493 | 3300049823 | Unclassified | 3032 |
| 363 | Ga0501044_0139764 | 3300049823 | Unclassified | 2411 |
| 364 | nmdc:mga05p37_1885280_c1 | 3300050507 | Bacteria | 572 |
| 365 | nmdc:mga05p37_277708_c1 | 3300050507 | Bacteria | 1999 |
| 366 | nmdc:mga09592_4432_c1 | 3300050508 | Bacteria | 11367 |
| 367 | nmdc:mga0qj67_108338_c1 | 3300050509 | Unclassified | 2241 |
| 368 | nmdc:mga0qj67_33850_c1 | 3300050509 | Bacteria | 3988 |
| 369 | nmdc:mga06r32_12442_c1 | 3300050510 | Bacteria | 7679 |
| 370 | nmdc:mga06r32_223254_c1 | 3300050510 | Bacteria | 1872 |
| 371 | nmdc:mga06r32_301590_c1 | 3300050510 | Bacteria | 1588 |
| 372 | nmdc:mga06r32_455031_c1 | 3300050510 | Bacteria | 1259 |
| 373 | nmdc:mga0n895_357448_c1 | 3300050512 | Unclassified | 1479 |
| 374 | nmdc:mga0n895_918154_c1 | 3300050512 | Bacteria | 860 |
| 375 | nmdc:mga0n895_95753_c1 | 3300050512 | Bacteria | 2973 |
| 376 | nmdc:mga0rr50_134503_c1 | 3300050513 | Bacteria | 1983 |
| 377 | nmdc:mga0a205_1041883_c1 | 3300050515 | Bacteria | 665 |
| 378 | nmdc:mga0a205_495126_c1 | 3300050515 | Bacteria | 1079 |
| 379 | Ga0500641_0323332 | 3300053096 | Bacteria | 627 |
| 380 | Ga0500556_0231214 | 3300053104 | Bacteria | 729 |
| 381 | Ga0500617_128151 | 3300053124 | Bacteria | 1037 |
| 382 | Ga0500642_0228113 | 3300053130 | Bacteria | 861 |
| 383 | Ga0500559_0429658 | 3300053136 | Bacteria | 612 |
| 384 | Ga0500568_0007526 | 3300053139 | Bacteria | 5334 |
| 385 | Ga0500588_0004045 | 3300053146 | Bacteria | 3145 |
| 386 | Ga0501084_0000308 | 3300054114 | Bacteria | 37148 |
| 387 | Ga0501084_0415913 | 3300054114 | Bacteria | 1136 |
| 388 | Ga0501082_0012038 | 3300060353 | Bacteria | 7434 |
| 389 | Ga0530510_0034553 | 3300061734 | Bacteria | 3643 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0048053 | Ga0501032_0048053_2472_2870 | 118 |
| 2 | 3300041486 | Ga0451807_2228592 | Ga0451807_2228592_64_450 | 122 |
| 3 | 3300013105 | Ga0157369_11496140 | Ga0157369_114961402 | 128 |
| 4 | 3300035118 | Ga0373954_0370655 | Ga0373954_0370655_80_484 | 131 |
| 5 | 3300035172 | Ga0373955_0097355 | Ga0373955_0097355_343_747 | 131 |
| 6 | 3300036401 | Ga0373937_0025263 | Ga0373937_0025263_3619_4023 | 131 |
| 7 | 3300046809 | Ga0495600_0427869 | Ga0495600_0427869_206_610 | 131 |
| 8 | 3300049570 | Ga0501033_0842101 | Ga0501033_0842101_36_440 | 133 |
| 9 | 3300049582 | Ga0501048_0479839 | Ga0501048_0479839_140_544 | 133 |
| 10 | 3300036401 | Ga0373937_0877639 | Ga0373937_0877639_159_593 | 134 |
| 11 | 3300041460 | Ga0451802_1599663 | Ga0451802_1599663_173_580 | 135 |
| 12 | 3300041498 | Ga0451841_0134688 | Ga0451841_0134688_95_502 | 135 |
| 13 | 3300046476 | Ga0495662_0107882 | Ga0495662_0107882_562_990 | 139 |
| 14 | 3300005444 | Ga0070694_100027778 | Ga0070694_1000277784 | 140 |
| 15 | 3300005471 | Ga0070698_100055793 | Ga0070698_1000557931 | 140 |
| 16 | 3300005549 | Ga0070704_100309924 | Ga0070704_1003099242 | 140 |
| 17 | 3300005331 | Ga0070670_101113632 | Ga0070670_1011136321 | 141 |
| 18 | 3300005340 | Ga0070689_100022099 | Ga0070689_1000220993 | 141 |
| 19 | 3300005365 | Ga0070688_100264201 | Ga0070688_1002642013 | 141 |
| 20 | 3300025925 | Ga0207650_10876684 | Ga0207650_108766842 | 141 |
| 21 | 3300025936 | Ga0207670_10043487 | Ga0207670_100434874 | 141 |
| 22 | 3300004801 | Ga0058860_10732615 | Ga0058860_107326151 | 142 |
| 23 | 3300005340 | Ga0070689_100327951 | Ga0070689_1003279512 | 142 |
| 24 | 3300009101 | Ga0105247_10000495 | Ga0105247_1000049522 | 142 |
| 25 | 3300014969 | Ga0157376_11167810 | Ga0157376_111678102 | 142 |
| 26 | 3300025900 | Ga0207710_10000993 | Ga0207710_1000099311 | 142 |
| 27 | 3300025936 | Ga0207670_10001606 | Ga0207670_1000160610 | 142 |
| 28 | 3300045049 | Ga0466959_0583288 | Ga0466959_0583288_131_625 | 142 |
| 29 | 3300005548 | Ga0070665_100421527 | Ga0070665_1004215272 | 143 |
| 30 | 3300005563 | Ga0068855_100199207 | Ga0068855_1001992074 | 143 |
| 31 | 3300014969 | Ga0157376_10153562 | Ga0157376_101535622 | 143 |
| 32 | 3300025949 | Ga0207667_10132835 | Ga0207667_101328355 | 143 |
| 33 | 3300028379 | Ga0268266_10014270 | Ga0268266_100142703 | 143 |
| 34 | 3300028800 | Ga0265338_10462293 | Ga0265338_104622932 | 143 |
| 35 | 3300005337 | Ga0070682_100004766 | Ga0070682_1000047668 | 144 |
| 36 | 3300005341 | Ga0070691_10159708 | Ga0070691_101597082 | 144 |
| 37 | 3300005577 | Ga0068857_100249077 | Ga0068857_1002490771 | 144 |
| 38 | 3300006846 | Ga0075430_100030282 | Ga0075430_1000302826 | 144 |
| 39 | 3300006847 | Ga0075431_100073146 | Ga0075431_1000731464 | 144 |
| 40 | 3300006880 | Ga0075429_100043972 | Ga0075429_1000439722 | 144 |
| 41 | 3300009094 | Ga0111539_10003645 | Ga0111539_100036453 | 144 |
| 42 | 3300026116 | Ga0207674_11084390 | Ga0207674_110843902 | 144 |
| 43 | 3300027907 | Ga0207428_10008546 | Ga0207428_100085464 | 144 |
| 44 | 3300035692 | Ga0373935_0560954 | Ga0373935_0560954_48_491 | 144 |
| 45 | 3300041486 | Ga0451807_0323219 | Ga0451807_0323219_152_595 | 144 |
| 46 | 3300046516 | Ga0495628_0001524 | Ga0495628_0001524_3216_3659 | 144 |
| 47 | 3300046689 | Ga0495613_0861305 | Ga0495613_0861305_52_495 | 144 |
| 48 | 3300047471 | Ga0495684_0028093 | Ga0495684_0028093_2824_3267 | 144 |
| 49 | 3300048907 | Ga0496104_0279400 | Ga0496104_0279400_1075_1518 | 144 |
| 50 | 3300049574 | Ga0501038_0195177 | Ga0501038_0195177_470_946 | 144 |
| 51 | 3300049579 | Ga0501043_0154335 | Ga0501043_0154335_466_942 | 144 |
| 52 | 3300049581 | Ga0501047_0004201 | Ga0501047_0004201_12514_12990 | 144 |
| 53 | 3300049582 | Ga0501048_0616559 | Ga0501048_0616559_113_589 | 144 |
| 54 | 3300049583 | Ga0501067_0016751 | Ga0501067_0016751_3398_3874 | 144 |
| 55 | 3300049584 | Ga0501068_0000163 | Ga0501068_0000163_29158_29634 | 144 |
| 56 | 3300049585 | Ga0501069_0022084 | Ga0501069_0022084_190_666 | 144 |
| 57 | 3300049588 | Ga0501072_0000004 | Ga0501072_0000004_177236_177712 | 144 |
| 58 | 3300049589 | Ga0501073_0120952 | Ga0501073_0120952_1026_1502 | 144 |
| 59 | 3300049592 | Ga0501076_0104274 | Ga0501076_0104274_1707_2183 | 144 |
| 60 | 3300049593 | Ga0501077_0012019 | Ga0501077_0012019_4825_5301 | 144 |
| 61 | 3300049741 | Ga0501079_0021414 | Ga0501079_0021414_97_573 | 144 |
| 62 | 3300049742 | Ga0501080_0034224 | Ga0501080_0034224_1622_2098 | 144 |
| 63 | 3300049744 | Ga0501083_0700954 | Ga0501083_0700954_122_598 | 144 |
| 64 | 3300050508 | nmdc:mga09592_4432_c1 | nmdc:mga09592_4432_c1_3779_4222 | 144 |
| 65 | 3300050509 | nmdc:mga0qj67_33850_c1 | nmdc:mga0qj67_33850_c1_327_770 | 144 |
| 66 | 3300050510 | nmdc:mga06r32_301590_c1 | nmdc:mga06r32_301590_c1_662_1105 | 144 |
| 67 | 3300054114 | Ga0501084_0000308 | Ga0501084_0000308_36491_36967 | 144 |
| 68 | 3300060353 | Ga0501082_0012038 | Ga0501082_0012038_6923_7399 | 144 |
| 69 | 3300003320 | rootH2_10231588 | rootH2_102315883 | 145 |
| 70 | 3300003323 | rootH1_10207350 | rootH1_102073504 | 145 |
| 71 | 3300005337 | Ga0070682_100250120 | Ga0070682_1002501201 | 145 |
| 72 | 3300005338 | Ga0068868_100033933 | Ga0068868_1000339335 | 145 |
| 73 | 3300005355 | Ga0070671_100393453 | Ga0070671_1003934532 | 145 |
| 74 | 3300005366 | Ga0070659_100494431 | Ga0070659_1004944311 | 145 |
| 75 | 3300005458 | Ga0070681_11481107 | Ga0070681_114811071 | 145 |
| 76 | 3300005459 | Ga0068867_100896658 | Ga0068867_1008966581 | 145 |
| 77 | 3300005467 | Ga0070706_100279155 | Ga0070706_1002791552 | 145 |
| 78 | 3300005471 | Ga0070698_101212089 | Ga0070698_1012120892 | 145 |
| 79 | 3300005617 | Ga0068859_100979972 | Ga0068859_1009799722 | 145 |
| 80 | 3300006237 | Ga0097621_100092224 | Ga0097621_1000922243 | 145 |
| 81 | 3300006358 | Ga0068871_100032928 | Ga0068871_1000329286 | 145 |
| 82 | 3300006871 | Ga0075434_100863700 | Ga0075434_1008637002 | 145 |
| 83 | 3300007076 | Ga0075435_100165890 | Ga0075435_1001658902 | 145 |
| 84 | 3300009147 | Ga0114129_10238687 | Ga0114129_102386872 | 145 |
| 85 | 3300009176 | Ga0105242_10078037 | Ga0105242_100780373 | 145 |
| 86 | 3300025910 | Ga0207684_10489994 | Ga0207684_104899942 | 145 |
| 87 | 3300026023 | Ga0207677_10021183 | Ga0207677_100211835 | 145 |
| 88 | 3300026089 | Ga0207648_10432282 | Ga0207648_104322822 | 145 |
| 89 | 3300041452 | Ga0451793_0230728 | Ga0451793_0230728_161_598 | 145 |
| 90 | 3300041453 | Ga0451797_1281718 | Ga0451797_1281718_95_532 | 145 |
| 91 | 3300041453 | Ga0451797_1426412 | Ga0451797_1426412_510_947 | 145 |
| 92 | 3300041456 | Ga0451795_1253713 | Ga0451795_1253713_16_453 | 145 |
| 93 | 3300041463 | Ga0451804_0597469 | Ga0451804_0597469_125_562 | 145 |
| 94 | 3300041486 | Ga0451807_0973877 | Ga0451807_0973877_4555_4992 | 145 |
| 95 | 3300048917 | Ga0496114_0339763 | Ga0496114_0339763_193_630 | 145 |
| 96 | 3300049589 | Ga0501073_0065046 | Ga0501073_0065046_1498_1935 | 145 |
| 97 | 3300049742 | Ga0501080_0895132 | Ga0501080_0895132_118_561 | 145 |
| 98 | 3300049744 | Ga0501083_0020261 | Ga0501083_0020261_2273_2716 | 145 |
| 99 | 3300050507 | nmdc:mga05p37_277708_c1 | nmdc:mga05p37_277708_c1_1463_1909 | 145 |
| 100 | 3300050512 | nmdc:mga0n895_357448_c1 | nmdc:mga0n895_357448_c1_256_717 | 145 |
| 101 | 3300050513 | nmdc:mga0rr50_134503_c1 | nmdc:mga0rr50_134503_c1_504_965 | 145 |
| 102 | 3300050515 | nmdc:mga0a205_1041883_c1 | nmdc:mga0a205_1041883_c1_13_459 | 145 |
| 103 | 3300053139 | Ga0500568_0007526 | Ga0500568_0007526_2146_2616 | 145 |
| 104 | 3300054114 | Ga0501084_0415913 | Ga0501084_0415913_58_501 | 145 |
| 105 | 3300005337 | Ga0070682_100614798 | Ga0070682_1006147981 | 146 |
| 106 | 3300005340 | Ga0070689_100275480 | Ga0070689_1002754802 | 146 |
| 107 | 3300035691 | Ga0373931_0219248 | Ga0373931_0219248_353_802 | 146 |
| 108 | 3300041512 | Ga0451853_3720402 | Ga0451853_3720402_135_611 | 146 |
| 109 | 3300049571 | Ga0501034_0071472 | Ga0501034_0071472_1150_1593 | 146 |
| 110 | 3300049579 | Ga0501043_0009569 | Ga0501043_0009569_5179_5622 | 146 |
| 111 | 3300049580 | Ga0501046_0133271 | Ga0501046_0133271_1185_1628 | 146 |
| 112 | 3300049581 | Ga0501047_0032486 | Ga0501047_0032486_311_754 | 146 |
| 113 | 3300049586 | Ga0501070_0000705 | Ga0501070_0000705_12929_13372 | 146 |
| 114 | 3300049742 | Ga0501080_0729166 | Ga0501080_0729166_351_794 | 146 |
| 115 | 3300049823 | Ga0501044_0093493 | Ga0501044_0093493_2573_3016 | 146 |
| 116 | 3300053136 | Ga0500559_0429658 | Ga0500559_0429658_135_578 | 146 |
| 117 | 3300005289 | Ga0065704_10072298 | Ga0065704_100722986 | 147 |
| 118 | 3300005328 | Ga0070676_10613670 | Ga0070676_106136701 | 147 |
| 119 | 3300005548 | Ga0070665_100287662 | Ga0070665_1002876622 | 147 |
| 120 | 3300006844 | Ga0075428_100064223 | Ga0075428_1000642234 | 147 |
| 121 | 3300006847 | Ga0075431_100522266 | Ga0075431_1005222663 | 147 |
| 122 | 3300021361 | Ga0213872_10058032 | Ga0213872_100580322 | 147 |
| 123 | 3300028379 | Ga0268266_10155639 | Ga0268266_101556393 | 147 |
| 124 | 3300039447 | Ga0436361_0762727 | Ga0436361_0762727_2187_2657 | 147 |
| 125 | 3300042133 | Ga0450896_036063 | Ga0450896_036063_272_727 | 147 |
| 126 | 3300049569 | Ga0501032_0726977 | Ga0501032_0726977_161_607 | 147 |
| 127 | 3300049571 | Ga0501034_0009350 | Ga0501034_0009350_9141_9587 | 147 |
| 128 | 3300049579 | Ga0501043_0542149 | Ga0501043_0542149_145_591 | 147 |
| 129 | 3300049580 | Ga0501046_0062571 | Ga0501046_0062571_1375_1821 | 147 |
| 130 | 3300049581 | Ga0501047_0066619 | Ga0501047_0066619_1527_1973 | 147 |
| 131 | 3300049823 | Ga0501044_0139764 | Ga0501044_0139764_404_850 | 147 |
| 132 | 3300050510 | nmdc:mga06r32_223254_c1 | nmdc:mga06r32_223254_c1_1399_1848 | 147 |
| 133 | 3300061734 | Ga0530510_0034553 | Ga0530510_0034553_1355_1798 | 147 |
| 134 | 3300005331 | Ga0070670_101003682 | Ga0070670_1010036822 | 148 |
| 135 | 3300005333 | Ga0070677_10078721 | Ga0070677_100787213 | 148 |
| 136 | 3300005334 | Ga0068869_101434183 | Ga0068869_1014341831 | 148 |
| 137 | 3300005338 | Ga0068868_100346969 | Ga0068868_1003469692 | 148 |
| 138 | 3300005347 | Ga0070668_100015566 | Ga0070668_1000155667 | 148 |
| 139 | 3300005353 | Ga0070669_100329750 | Ga0070669_1003297501 | 148 |
| 140 | 3300005353 | Ga0070669_101077175 | Ga0070669_1010771751 | 148 |
| 141 | 3300005354 | Ga0070675_100026385 | Ga0070675_1000263853 | 148 |
| 142 | 3300005355 | Ga0070671_100474435 | Ga0070671_1004744351 | 148 |
| 143 | 3300005364 | Ga0070673_100651451 | Ga0070673_1006514511 | 148 |
| 144 | 3300005367 | Ga0070667_100450014 | Ga0070667_1004500141 | 148 |
| 145 | 3300005518 | Ga0070699_100658828 | Ga0070699_1006588282 | 148 |
| 146 | 3300005536 | Ga0070697_100817103 | Ga0070697_1008171031 | 148 |
| 147 | 3300005543 | Ga0070672_100021954 | Ga0070672_1000219544 | 148 |
| 148 | 3300005543 | Ga0070672_101350777 | Ga0070672_1013507771 | 148 |
| 149 | 3300005548 | Ga0070665_100164676 | Ga0070665_1001646763 | 148 |
| 150 | 3300005564 | Ga0070664_100117325 | Ga0070664_1001173252 | 148 |
| 151 | 3300005578 | Ga0068854_100718928 | Ga0068854_1007189282 | 148 |
| 152 | 3300005616 | Ga0068852_100108581 | Ga0068852_1001085812 | 148 |
| 153 | 3300005617 | Ga0068859_100231726 | Ga0068859_1002317262 | 148 |
| 154 | 3300005840 | Ga0068870_10528420 | Ga0068870_105284202 | 148 |
| 155 | 3300005843 | Ga0068860_100898315 | Ga0068860_1008983152 | 148 |
| 156 | 3300005844 | Ga0068862_101016333 | Ga0068862_1010163332 | 148 |
| 157 | 3300006237 | Ga0097621_100443336 | Ga0097621_1004433362 | 148 |
| 158 | 3300006852 | Ga0075433_10578235 | Ga0075433_105782351 | 148 |
| 159 | 3300006871 | Ga0075434_100629328 | Ga0075434_1006293282 | 148 |
| 160 | 3300006881 | Ga0068865_100469375 | Ga0068865_1004693753 | 148 |
| 161 | 3300006931 | Ga0097620_100231726 | Ga0097620_1002317262 | 148 |
| 162 | 3300009098 | Ga0105245_10002417 | Ga0105245_100024172 | 148 |
| 163 | 3300009177 | Ga0105248_12036452 | Ga0105248_120364522 | 148 |
| 164 | 3300011119 | Ga0105246_10399900 | Ga0105246_103999002 | 148 |
| 165 | 3300013296 | Ga0157374_11339307 | Ga0157374_113393072 | 148 |
| 166 | 3300013297 | Ga0157378_11093750 | Ga0157378_110937502 | 148 |
| 167 | 3300013308 | Ga0157375_10505231 | Ga0157375_105052312 | 148 |
| 168 | 3300014326 | Ga0157380_10234992 | Ga0157380_102349922 | 148 |
| 169 | 3300014969 | Ga0157376_11478171 | Ga0157376_114781712 | 148 |
| 170 | 3300025321 | Ga0207656_10049060 | Ga0207656_100490603 | 148 |
| 171 | 3300025901 | Ga0207688_10233895 | Ga0207688_102338951 | 148 |
| 172 | 3300025907 | Ga0207645_10685299 | Ga0207645_106852992 | 148 |
| 173 | 3300025908 | Ga0207643_10704853 | Ga0207643_107048532 | 148 |
| 174 | 3300025923 | Ga0207681_10167648 | Ga0207681_101676481 | 148 |
| 175 | 3300025923 | Ga0207681_11116790 | Ga0207681_111167901 | 148 |
| 176 | 3300025926 | Ga0207659_10121589 | Ga0207659_101215892 | 148 |
| 177 | 3300025940 | Ga0207691_10003696 | Ga0207691_1000369610 | 148 |
| 178 | 3300025945 | Ga0207679_10421907 | Ga0207679_104219072 | 148 |
| 179 | 3300025972 | Ga0207668_10270854 | Ga0207668_102708543 | 148 |
| 180 | 3300025986 | Ga0207658_10325298 | Ga0207658_103252982 | 148 |
| 181 | 3300026023 | Ga0207677_10234091 | Ga0207677_102340912 | 148 |
| 182 | 3300026035 | Ga0207703_11577192 | Ga0207703_115771922 | 148 |
| 183 | 3300026067 | Ga0207678_10220740 | Ga0207678_102207402 | 148 |
| 184 | 3300026118 | Ga0207675_100066699 | Ga0207675_1000666991 | 148 |
| 185 | 3300026142 | Ga0207698_10215808 | Ga0207698_102158082 | 148 |
| 186 | 3300028379 | Ga0268266_11300442 | Ga0268266_113004422 | 148 |
| 187 | 3300028380 | Ga0268265_10382537 | Ga0268265_103825371 | 148 |
| 188 | 3300028381 | Ga0268264_10422132 | Ga0268264_104221322 | 148 |
| 189 | 3300031456 | Ga0307513_10186928 | Ga0307513_101869283 | 148 |
| 190 | 3300031507 | Ga0307509_10209612 | Ga0307509_102096121 | 148 |
| 191 | 3300032002 | Ga0307416_101407988 | Ga0307416_1014079882 | 148 |
| 192 | 3300032004 | Ga0307414_10865970 | Ga0307414_108659701 | 148 |
| 193 | 3300041496 | Ga0451839_0610579 | Ga0451839_0610579_152_613 | 148 |
| 194 | 3300041505 | Ga0451849_1563670 | Ga0451849_1563670_209_670 | 148 |
| 195 | 3300049593 | Ga0501077_0468588 | Ga0501077_0468588_68_529 | 148 |
| 196 | 3300050512 | nmdc:mga0n895_95753_c1 | nmdc:mga0n895_95753_c1_2422_2883 | 148 |
| 197 | 3300050515 | nmdc:mga0a205_495126_c1 | nmdc:mga0a205_495126_c1_153_614 | 148 |
| 198 | 3300053096 | Ga0500641_0323332 | Ga0500641_0323332_58_513 | 148 |
| 199 | 3300053104 | Ga0500556_0231214 | Ga0500556_0231214_215_670 | 148 |
| 200 | 3300053124 | Ga0500617_128151 | Ga0500617_128151_109_564 | 148 |
| 201 | 3300053130 | Ga0500642_0228113 | Ga0500642_0228113_221_676 | 148 |
| 202 | 3300053146 | Ga0500588_0004045 | Ga0500588_0004045_647_1102 | 148 |
| 203 | 3300005334 | Ga0068869_101705378 | Ga0068869_1017053781 | 149 |
| 204 | 3300005343 | Ga0070687_100550754 | Ga0070687_1005507541 | 149 |
| 205 | 3300005440 | Ga0070705_100130374 | Ga0070705_1001303743 | 149 |
| 206 | 3300005456 | Ga0070678_100726742 | Ga0070678_1007267422 | 149 |
| 207 | 3300005459 | Ga0068867_100198969 | Ga0068867_1001989691 | 149 |
| 208 | 3300005617 | Ga0068859_101014881 | Ga0068859_1010148812 | 149 |
| 209 | 3300005719 | Ga0068861_100377508 | Ga0068861_1003775082 | 149 |
| 210 | 3300006847 | Ga0075431_100553910 | Ga0075431_1005539103 | 149 |
| 211 | 3300006931 | Ga0097620_101014640 | Ga0097620_1010146402 | 149 |
| 212 | 3300009147 | Ga0114129_12088526 | Ga0114129_120885262 | 149 |
| 213 | 3300025918 | Ga0207662_10600705 | Ga0207662_106007051 | 149 |
| 214 | 3300026088 | Ga0207641_10361807 | Ga0207641_103618073 | 149 |
| 215 | 3300026089 | Ga0207648_10815722 | Ga0207648_108157221 | 149 |
| 216 | 3300026121 | Ga0207683_10197995 | Ga0207683_101979951 | 149 |
| 217 | 3300042005 | Ga0439448_0015039 | Ga0439448_0015039_1509_1961 | 149 |
| 218 | 3300042008 | Ga0439450_172642 | Ga0439450_172642_68_520 | 149 |
| 219 | 3300042012 | Ga0439455_0007368 | Ga0439455_0007368_1649_2101 | 149 |
| 220 | 3300050507 | nmdc:mga05p37_1885280_c1 | nmdc:mga05p37_1885280_c1_19_477 | 149 |
| 221 | 3300050510 | nmdc:mga06r32_455031_c1 | nmdc:mga06r32_455031_c1_777_1235 | 149 |
| 222 | 3300001990 | JGI24737J22298_10163043 | JGI24737J22298_101630432 | 150 |
| 223 | 3300002076 | JGI24749J21850_1017216 | JGI24749J21850_10172162 | 150 |
| 224 | 3300003659 | JGI25404J52841_10072195 | JGI25404J52841_100721951 | 150 |
| 225 | 3300005293 | Ga0065715_10101557 | Ga0065715_101015572 | 150 |
| 226 | 3300005327 | Ga0070658_10001909 | Ga0070658_1000190915 | 150 |
| 227 | 3300005329 | Ga0070683_100042023 | Ga0070683_1000420234 | 150 |
| 228 | 3300005330 | Ga0070690_100000245 | Ga0070690_1000002452 | 150 |
| 229 | 3300005331 | Ga0070670_100056960 | Ga0070670_1000569603 | 150 |
| 230 | 3300005333 | Ga0070677_10000065 | Ga0070677_1000006516 | 150 |
| 231 | 3300005334 | Ga0068869_100028014 | Ga0068869_1000280145 | 150 |
| 232 | 3300005336 | Ga0070680_100297676 | Ga0070680_1002976763 | 150 |
| 233 | 3300005337 | Ga0070682_100159544 | Ga0070682_1001595443 | 150 |
| 234 | 3300005339 | Ga0070660_100001727 | Ga0070660_1000017277 | 150 |
| 235 | 3300005340 | Ga0070689_102246637 | Ga0070689_1022466371 | 150 |
| 236 | 3300005343 | Ga0070687_100000121 | Ga0070687_1000001213 | 150 |
| 237 | 3300005353 | Ga0070669_100005655 | Ga0070669_1000056554 | 150 |
| 238 | 3300005355 | Ga0070671_100138883 | Ga0070671_1001388834 | 150 |
| 239 | 3300005356 | Ga0070674_100009991 | Ga0070674_1000099919 | 150 |
| 240 | 3300005365 | Ga0070688_100000751 | Ga0070688_1000007517 | 150 |
| 241 | 3300005365 | Ga0070688_100554929 | Ga0070688_1005549291 | 150 |
| 242 | 3300005366 | Ga0070659_100002473 | Ga0070659_10000247315 | 150 |
| 243 | 3300005367 | Ga0070667_100053694 | Ga0070667_1000536944 | 150 |
| 244 | 3300005438 | Ga0070701_10009212 | Ga0070701_100092123 | 150 |
| 245 | 3300005439 | Ga0070711_100348731 | Ga0070711_1003487312 | 150 |
| 246 | 3300005440 | Ga0070705_100001864 | Ga0070705_1000018644 | 150 |
| 247 | 3300005441 | Ga0070700_100005808 | Ga0070700_1000058084 | 150 |
| 248 | 3300005455 | Ga0070663_100023501 | Ga0070663_1000235014 | 150 |
| 249 | 3300005456 | Ga0070678_100005934 | Ga0070678_1000059347 | 150 |
| 250 | 3300005459 | Ga0068867_100001116 | Ga0068867_1000011168 | 150 |
| 251 | 3300005466 | Ga0070685_10000339 | Ga0070685_1000033930 | 150 |
| 252 | 3300005530 | Ga0070679_100144306 | Ga0070679_1001443062 | 150 |
| 253 | 3300005535 | Ga0070684_100029696 | Ga0070684_1000296963 | 150 |
| 254 | 3300005539 | Ga0068853_100005141 | Ga0068853_10000514113 | 150 |
| 255 | 3300005543 | Ga0070672_100514752 | Ga0070672_1005147521 | 150 |
| 256 | 3300005544 | Ga0070686_100000321 | Ga0070686_10000032113 | 150 |
| 257 | 3300005546 | Ga0070696_100043282 | Ga0070696_1000432823 | 150 |
| 258 | 3300005547 | Ga0070693_100000957 | Ga0070693_10000095711 | 150 |
| 259 | 3300005563 | Ga0068855_100004620 | Ga0068855_10000462018 | 150 |
| 260 | 3300005564 | Ga0070664_100011858 | Ga0070664_1000118589 | 150 |
| 261 | 3300005578 | Ga0068854_100000649 | Ga0068854_10000064915 | 150 |
| 262 | 3300005615 | Ga0070702_100199885 | Ga0070702_1001998853 | 150 |
| 263 | 3300005616 | Ga0068852_100004965 | Ga0068852_1000049653 | 150 |
| 264 | 3300005617 | Ga0068859_100004936 | Ga0068859_10000493616 | 150 |
| 265 | 3300005617 | Ga0068859_100606410 | Ga0068859_1006064102 | 150 |
| 266 | 3300005618 | Ga0068864_100105452 | Ga0068864_1001054522 | 150 |
| 267 | 3300005718 | Ga0068866_10000626 | Ga0068866_1000062614 | 150 |
| 268 | 3300005719 | Ga0068861_100001208 | Ga0068861_10000120815 | 150 |
| 269 | 3300005834 | Ga0068851_10000607 | Ga0068851_100006075 | 150 |
| 270 | 3300005840 | Ga0068870_10000035 | Ga0068870_1000003511 | 150 |
| 271 | 3300005841 | Ga0068863_100003321 | Ga0068863_1000033219 | 150 |
| 272 | 3300005841 | Ga0068863_101560618 | Ga0068863_1015606181 | 150 |
| 273 | 3300005843 | Ga0068860_100107714 | Ga0068860_1001077142 | 150 |
| 274 | 3300005844 | Ga0068862_100001652 | Ga0068862_1000016524 | 150 |
| 275 | 3300005844 | Ga0068862_100275479 | Ga0068862_1002754793 | 150 |
| 276 | 3300005983 | Ga0081540_1000052 | Ga0081540_100005298 | 150 |
| 277 | 3300005983 | Ga0081540_1000426 | Ga0081540_100042612 | 150 |
| 278 | 3300005983 | Ga0081540_1000788 | Ga0081540_100078834 | 150 |
| 279 | 3300006237 | Ga0097621_100319425 | Ga0097621_1003194252 | 150 |
| 280 | 3300006358 | Ga0068871_100000529 | Ga0068871_1000005292 | 150 |
| 281 | 3300006846 | Ga0075430_100144916 | Ga0075430_1001449162 | 150 |
| 282 | 3300006847 | Ga0075431_100017661 | Ga0075431_1000176617 | 150 |
| 283 | 3300006871 | Ga0075434_100767805 | Ga0075434_1007678052 | 150 |
| 284 | 3300006881 | Ga0068865_100000955 | Ga0068865_10000095520 | 150 |
| 285 | 3300006931 | Ga0097620_100004935 | Ga0097620_1000049352 | 150 |
| 286 | 3300006931 | Ga0097620_100606383 | Ga0097620_1006063832 | 150 |
| 287 | 3300009093 | Ga0105240_10001794 | Ga0105240_1000179413 | 150 |
| 288 | 3300009098 | Ga0105245_10006833 | Ga0105245_1000683310 | 150 |
| 289 | 3300009101 | Ga0105247_10000863 | Ga0105247_1000086318 | 150 |
| 290 | 3300009174 | Ga0105241_10000244 | Ga0105241_1000024434 | 150 |
| 291 | 3300009176 | Ga0105242_10003018 | Ga0105242_1000301813 | 150 |
| 292 | 3300009177 | Ga0105248_11417190 | Ga0105248_114171902 | 150 |
| 293 | 3300009545 | Ga0105237_10001821 | Ga0105237_1000182111 | 150 |
| 294 | 3300009551 | Ga0105238_10000705 | Ga0105238_1000070511 | 150 |
| 295 | 3300009553 | Ga0105249_10000549 | Ga0105249_1000054910 | 150 |
| 296 | 3300010375 | Ga0105239_10034279 | Ga0105239_1003427910 | 150 |
| 297 | 3300011119 | Ga0105246_10004199 | Ga0105246_100041997 | 150 |
| 298 | 3300013100 | Ga0157373_10008204 | Ga0157373_100082044 | 150 |
| 299 | 3300013102 | Ga0157371_10002774 | Ga0157371_1000277416 | 150 |
| 300 | 3300013105 | Ga0157369_10001108 | Ga0157369_1000110815 | 150 |
| 301 | 3300013296 | Ga0157374_10001654 | Ga0157374_1000165415 | 150 |
| 302 | 3300013297 | Ga0157378_10001798 | Ga0157378_1000179814 | 150 |
| 303 | 3300013306 | Ga0163162_10002320 | Ga0163162_1000232015 | 150 |
| 304 | 3300013307 | Ga0157372_10016419 | Ga0157372_1001641910 | 150 |
| 305 | 3300013308 | Ga0157375_10003855 | Ga0157375_100038553 | 150 |
| 306 | 3300013308 | Ga0157375_10207367 | Ga0157375_102073672 | 150 |
| 307 | 3300014325 | Ga0163163_10009683 | Ga0163163_1000968310 | 150 |
| 308 | 3300014745 | Ga0157377_10001667 | Ga0157377_100016675 | 150 |
| 309 | 3300014968 | Ga0157379_10001549 | Ga0157379_1000154916 | 150 |
| 310 | 3300014969 | Ga0157376_10002532 | Ga0157376_1000253210 | 150 |
| 311 | 3300014969 | Ga0157376_10133677 | Ga0157376_101336772 | 150 |
| 312 | 3300017792 | Ga0163161_10085000 | Ga0163161_100850005 | 150 |
| 313 | 3300025315 | Ga0207697_10000520 | Ga0207697_1000052020 | 150 |
| 314 | 3300025321 | Ga0207656_10000802 | Ga0207656_1000080216 | 150 |
| 315 | 3300025885 | Ga0207653_10113884 | Ga0207653_101138843 | 150 |
| 316 | 3300025899 | Ga0207642_10056802 | Ga0207642_100568022 | 150 |
| 317 | 3300025900 | Ga0207710_10026345 | Ga0207710_100263453 | 150 |
| 318 | 3300025901 | Ga0207688_10000098 | Ga0207688_1000009819 | 150 |
| 319 | 3300025904 | Ga0207647_10011704 | Ga0207647_100117042 | 150 |
| 320 | 3300025907 | Ga0207645_10000055 | Ga0207645_1000005545 | 150 |
| 321 | 3300025908 | Ga0207643_10000054 | Ga0207643_1000005439 | 150 |
| 322 | 3300025909 | Ga0207705_10011080 | Ga0207705_100110803 | 150 |
| 323 | 3300025911 | Ga0207654_10429406 | Ga0207654_104294063 | 150 |
| 324 | 3300025913 | Ga0207695_10041598 | Ga0207695_100415983 | 150 |
| 325 | 3300025914 | Ga0207671_10031518 | Ga0207671_100315181 | 150 |
| 326 | 3300025916 | Ga0207663_10267912 | Ga0207663_102679121 | 150 |
| 327 | 3300025917 | Ga0207660_10294528 | Ga0207660_102945282 | 150 |
| 328 | 3300025918 | Ga0207662_10000418 | Ga0207662_1000041816 | 150 |
| 329 | 3300025919 | Ga0207657_10000070 | Ga0207657_1000007058 | 150 |
| 330 | 3300025920 | Ga0207649_10257630 | Ga0207649_102576302 | 150 |
| 331 | 3300025921 | Ga0207652_10110827 | Ga0207652_101108273 | 150 |
| 332 | 3300025923 | Ga0207681_10054525 | Ga0207681_100545252 | 150 |
| 333 | 3300025925 | Ga0207650_10053702 | Ga0207650_100537022 | 150 |
| 334 | 3300025926 | Ga0207659_10000136 | Ga0207659_1000013611 | 150 |
| 335 | 3300025927 | Ga0207687_10056692 | Ga0207687_100566924 | 150 |
| 336 | 3300025933 | Ga0207706_10000094 | Ga0207706_1000009457 | 150 |
| 337 | 3300025934 | Ga0207686_10028703 | Ga0207686_100287034 | 150 |
| 338 | 3300025935 | Ga0207709_10507411 | Ga0207709_105074112 | 150 |
| 339 | 3300025936 | Ga0207670_10000420 | Ga0207670_1000042022 | 150 |
| 340 | 3300025937 | Ga0207669_10000303 | Ga0207669_100003033 | 150 |
| 341 | 3300025938 | Ga0207704_10002966 | Ga0207704_1000296611 | 150 |
| 342 | 3300025940 | Ga0207691_10000173 | Ga0207691_1000017357 | 150 |
| 343 | 3300025941 | Ga0207711_10007180 | Ga0207711_100071804 | 150 |
| 344 | 3300025941 | Ga0207711_11014350 | Ga0207711_110143501 | 150 |
| 345 | 3300025942 | Ga0207689_10000287 | Ga0207689_1000028716 | 150 |
| 346 | 3300025949 | Ga0207667_10018498 | Ga0207667_1001849811 | 150 |
| 347 | 3300025961 | Ga0207712_10001006 | Ga0207712_1000100615 | 150 |
| 348 | 3300025972 | Ga0207668_10001718 | Ga0207668_1000171815 | 150 |
| 349 | 3300025986 | Ga0207658_10045597 | Ga0207658_100455974 | 150 |
| 350 | 3300026023 | Ga0207677_10001271 | Ga0207677_100012713 | 150 |
| 351 | 3300026041 | Ga0207639_10081070 | Ga0207639_100810706 | 150 |
| 352 | 3300026067 | Ga0207678_10008975 | Ga0207678_1000897510 | 150 |
| 353 | 3300026075 | Ga0207708_10020333 | Ga0207708_100203334 | 150 |
| 354 | 3300026075 | Ga0207708_11153465 | Ga0207708_111534652 | 150 |
| 355 | 3300026078 | Ga0207702_11514440 | Ga0207702_115144402 | 150 |
| 356 | 3300026088 | Ga0207641_10057288 | Ga0207641_100572884 | 150 |
| 357 | 3300026088 | Ga0207641_11408291 | Ga0207641_114082911 | 150 |
| 358 | 3300026089 | Ga0207648_10000247 | Ga0207648_1000024747 | 150 |
| 359 | 3300026095 | Ga0207676_10002084 | Ga0207676_1000208418 | 150 |
| 360 | 3300026116 | Ga0207674_10000426 | Ga0207674_1000042642 | 150 |
| 361 | 3300026118 | Ga0207675_100000063 | Ga0207675_10000006357 | 150 |
| 362 | 3300026121 | Ga0207683_10000053 | Ga0207683_1000005342 | 150 |
| 363 | 3300026142 | Ga0207698_10191736 | Ga0207698_101917364 | 150 |
| 364 | 3300028379 | Ga0268266_10001038 | Ga0268266_1000103811 | 150 |
| 365 | 3300028380 | Ga0268265_10002440 | Ga0268265_1000244016 | 150 |
| 366 | 3300028380 | Ga0268265_10340575 | Ga0268265_103405752 | 150 |
| 367 | 3300028381 | Ga0268264_10000986 | Ga0268264_1000098629 | 150 |
| 368 | 3300028556 | Ga0265337_1006553 | Ga0265337_10065533 | 150 |
| 369 | 3300031238 | Ga0265332_10078102 | Ga0265332_100781021 | 150 |
| 370 | 3300031240 | Ga0265320_10026140 | Ga0265320_100261404 | 150 |
| 371 | 3300031616 | Ga0307508_10625674 | Ga0307508_106256741 | 150 |
| 372 | 3300035084 | Ga0373928_0122101 | Ga0373928_0122101_220_681 | 150 |
| 373 | 3300035170 | Ga0373943_0223431 | Ga0373943_0223431_469_930 | 150 |
| 374 | 3300035207 | Ga0373942_0050634 | Ga0373942_0050634_619_1080 | 150 |
| 375 | 3300036401 | Ga0373937_0145579 | Ga0373937_0145579_1126_1587 | 150 |
| 376 | 3300039450 | Ga0436363_0557477 | Ga0436363_0557477_31_492 | 150 |
| 377 | 3300039450 | Ga0436363_1644309 | Ga0436363_1644309_695_1222 | 150 |
| 378 | 3300045051 | Ga0451576_1046052 | Ga0451576_1046052_69_521 | 150 |
| 379 | 3300048905 | Ga0496102_0049731 | Ga0496102_0049731_2034_2552 | 150 |
| 380 | 3300048909 | Ga0496106_0014970 | Ga0496106_0014970_292_744 | 150 |
| 381 | 3300048910 | Ga0496107_0004956 | Ga0496107_0004956_7611_8129 | 150 |
| 382 | 3300048911 | Ga0496108_0037698 | Ga0496108_0037698_2502_2954 | 150 |
| 383 | 3300048912 | Ga0496109_0009793 | Ga0496109_0009793_1937_2455 | 150 |
| 384 | 3300048913 | Ga0496110_1036935 | Ga0496110_1036935_83_535 | 150 |
| 385 | 3300048915 | Ga0496112_0003038 | Ga0496112_0003038_11946_12464 | 150 |
| 386 | 3300049574 | Ga0501038_0776032 | Ga0501038_0776032_13_474 | 150 |
| 387 | 3300050509 | nmdc:mga0qj67_108338_c1 | nmdc:mga0qj67_108338_c1_736_1200 | 150 |
| 388 | 3300050510 | nmdc:mga06r32_12442_c1 | nmdc:mga06r32_12442_c1_1191_1655 | 150 |
| 389 | 3300050512 | nmdc:mga0n895_918154_c1 | nmdc:mga0n895_918154_c1_87_605 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3itw-assembly1.cif.gz_A-2 | crystal structure of tiox from micromonospora sp. ml1 | 0.842 | 8 | 145 |
| 3itw-assembly1.cif.gz_A-2 | crystal structure of tiox from micromonospora sp. ml1 | 0.8357 | 8 | 145 |
| 3itw-assembly1.cif.gz_B-2 | crystal structure of tiox from micromonospora sp. ml1 | 0.8323 | 9 | 143 |
| 5ujp-assembly1.cif.gz_B | the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 | 0.808 | 12 | 141 |
| 4pav-assembly4.cif.gz_D | structure of hypothetical protein sa1046 from s. aureus. | 0.8018 | 9 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8698 | 85 | 145 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8566 | 87 | 149 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.856 | 85 | 145 | 3.30.720.110 |
| 2pjsB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8254 | 89 | 142 | 3.10.180.10 |
| 5ujpB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.808 | 12 | 141 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9PIK7-F1-model_v4 | VOC domain-containing protein | 0.9484 | 1 | 145 |
GO:0003700
|
| AF-A0A7W0SZ62-F1-model_v4 | VOC family protein | 0.9386 | 9 | 143 |
|
| AF-A0A7W7ZYJ9-F1-model_v4 | Putative glyoxalase superfamily protein PhnB | 0.9378 | 8 | 143 |
|
| AF-A0A5C7JCL7-F1-model_v4 | Glyoxalase | 0.937 | 9 | 142 |
|
| AF-A0A7H8KD65-F1-model_v4 | VOC family protein | 0.937 | 9 | 143 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar