F431396

General Info

Members Datasets Scaffolds Average Seq Length
389 250 389 151

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001794|Ga0105240_1000179413
Length 172
Sequence LQVIAYQVNHCAHPQLLIGGWTMKPVPEGWARVCPAVFYEDASKAIDWLCRAFGFEVQLKIEGEGGRIEHSELRFGEGLVMVSQAGGSSERKKPLPTRSPRAVGGVNTQMLALFVDDADSHCARARAAGGKIHDEPTTNDYGDDYWADRTYRVEDPEGHHWWFMQRVRTGGR

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
192 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
196 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
197 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
243 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 4.63
Rhizosphere 90.49
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10163043 3300001990 Bacteria 658
2 JGI24749J21850_1017216 3300002076 Bacteria 1017
3 rootH2_10231588 3300003320 Unclassified 1801
4 rootH1_10207350 3300003323 Unclassified 3261
5 JGI25404J52841_10072195 3300003659 Bacteria 721
6 Ga0058860_10732615 3300004801 Unclassified 625
7 Ga0065704_10072298 3300005289 Bacteria 8785
8 Ga0065715_10101557 3300005293 Bacteria 3156
9 Ga0070658_10001909 3300005327 Bacteria 17592
10 Ga0070676_10613670 3300005328 Bacteria 786
11 Ga0070683_100042023 3300005329 Bacteria 4209
12 Ga0070690_100000245 3300005330 Bacteria 27972
13 Ga0070670_100056960 3300005331 Bacteria 3355
14 Ga0070670_101003682 3300005331 Bacteria 759
15 Ga0070670_101113632 3300005331 Unclassified 720
16 Ga0070677_10000065 3300005333 Bacteria 33290
17 Ga0070677_10078721 3300005333 Bacteria 1405
18 Ga0068869_100028014 3300005334 Bacteria 3932
19 Ga0068869_101434183 3300005334 Bacteria 612
20 Ga0068869_101705378 3300005334 Unclassified 562
21 Ga0070680_100297676 3300005336 Bacteria 1368
22 Ga0070682_100004766 3300005337 Bacteria 7542
23 Ga0070682_100159544 3300005337 Bacteria 1556
24 Ga0070682_100250120 3300005337 Unclassified 1277
25 Ga0070682_100614798 3300005337 Unclassified 860
26 Ga0068868_100033933 3300005338 Bacteria 3936
27 Ga0068868_100346969 3300005338 Unclassified 1271
28 Ga0070660_100001727 3300005339 Bacteria 14984
29 Ga0070689_100022099 3300005340 Bacteria 4747
30 Ga0070689_100275480 3300005340 Bacteria 1394
31 Ga0070689_100327951 3300005340 Bacteria 1280
32 Ga0070689_102246637 3300005340 Bacteria 500
33 Ga0070691_10159708 3300005341 Bacteria 1161
34 Ga0070687_100000121 3300005343 Bacteria 26702
35 Ga0070687_100550754 3300005343 Bacteria 785
36 Ga0070668_100015566 3300005347 Bacteria 5685
37 Ga0070669_100005655 3300005353 Bacteria 9030
38 Ga0070669_100329750 3300005353 Bacteria 1234
39 Ga0070669_101077175 3300005353 Bacteria 692
40 Ga0070675_100026385 3300005354 Bacteria 4662
41 Ga0070671_100138883 3300005355 Bacteria 2050
42 Ga0070671_100393453 3300005355 Bacteria 1185
43 Ga0070671_100474435 3300005355 Unclassified 1074
44 Ga0070674_100009991 3300005356 Bacteria 5715
45 Ga0070673_100651451 3300005364 Bacteria 964
46 Ga0070688_100000751 3300005365 Bacteria 15988
47 Ga0070688_100264201 3300005365 Unclassified 1230
48 Ga0070688_100554929 3300005365 Bacteria 874
49 Ga0070659_100002473 3300005366 Bacteria 13117
50 Ga0070659_100494431 3300005366 Bacteria 1042
51 Ga0070667_100053694 3300005367 Bacteria 3401
52 Ga0070667_100450014 3300005367 Bacteria 1177
53 Ga0070701_10009212 3300005438 Bacteria 4317
54 Ga0070711_100348731 3300005439 Bacteria 1190
55 Ga0070705_100001864 3300005440 Bacteria 10866
56 Ga0070705_100130374 3300005440 Bacteria 1639
57 Ga0070700_100005808 3300005441 Bacteria 6550
58 Ga0070694_100027778 3300005444 Bacteria 3678
59 Ga0070663_100023501 3300005455 Bacteria 4132
60 Ga0070678_100005934 3300005456 Bacteria 7106
61 Ga0070678_100726742 3300005456 Unclassified 896
62 Ga0070681_11481107 3300005458 Bacteria 603
63 Ga0068867_100001116 3300005459 Bacteria 18372
64 Ga0068867_100198969 3300005459 Bacteria 1603
65 Ga0068867_100896658 3300005459 Bacteria 798
66 Ga0070685_10000339 3300005466 Bacteria 28730
67 Ga0070706_100279155 3300005467 Bacteria 1559
68 Ga0070698_100055793 3300005471 Bacteria 4004
69 Ga0070698_101212089 3300005471 Unclassified 704
70 Ga0070699_100658828 3300005518 Unclassified 956
71 Ga0070679_100144306 3300005530 Bacteria 2359
72 Ga0070684_100029696 3300005535 Bacteria 4636
73 Ga0070697_100817103 3300005536 Unclassified 825
74 Ga0068853_100005141 3300005539 Bacteria 10231
75 Ga0070672_100021954 3300005543 Bacteria 4679
76 Ga0070672_100514752 3300005543 Bacteria 1036
77 Ga0070672_101350777 3300005543 Unclassified 637
78 Ga0070686_100000321 3300005544 Bacteria 31535
79 Ga0070696_100043282 3300005546 Bacteria 3115
80 Ga0070693_100000957 3300005547 Bacteria 12805
81 Ga0070665_100164676 3300005548 Bacteria 2220
82 Ga0070665_100287662 3300005548 Bacteria 1646
83 Ga0070665_100421527 3300005548 Bacteria 1343
84 Ga0070704_100309924 3300005549 Bacteria 1318
85 Ga0068855_100004620 3300005563 Bacteria 16802
86 Ga0068855_100199207 3300005563 Bacteria 2255
87 Ga0070664_100011858 3300005564 Bacteria 7074
88 Ga0070664_100117325 3300005564 Bacteria 2328
89 Ga0068857_100249077 3300005577 Bacteria 1628
90 Ga0068854_100000649 3300005578 Bacteria 20632
91 Ga0068854_100718928 3300005578 Unclassified 864
92 Ga0070702_100199885 3300005615 Bacteria 1322
93 Ga0068852_100004965 3300005616 Bacteria 9455
94 Ga0068852_100108581 3300005616 Bacteria 2518
95 Ga0068859_100004936 3300005617 Bacteria 13556
96 Ga0068859_100231726 3300005617 Bacteria 1935
97 Ga0068859_100606410 3300005617 Bacteria 1188
98 Ga0068859_100979972 3300005617 Bacteria 928
99 Ga0068859_101014881 3300005617 Bacteria 911
100 Ga0068864_100105452 3300005618 Bacteria 2505
101 Ga0068866_10000626 3300005718 Bacteria 16065
102 Ga0068861_100001208 3300005719 Bacteria 16084
103 Ga0068861_100377508 3300005719 Unclassified 1251
104 Ga0068851_10000607 3300005834 Bacteria 15426
105 Ga0068870_10000035 3300005840 Bacteria 43532
106 Ga0068870_10528420 3300005840 Bacteria 791
107 Ga0068863_100003321 3300005841 Bacteria 15886
108 Ga0068863_101560618 3300005841 Unclassified 669
109 Ga0068860_100107714 3300005843 Bacteria 2663
110 Ga0068860_100898315 3300005843 Bacteria 902
111 Ga0068862_100001652 3300005844 Bacteria 20286
112 Ga0068862_100275479 3300005844 Bacteria 1540
113 Ga0068862_101016333 3300005844 Unclassified 821
114 Ga0081540_1000052 3300005983 Bacteria 124880
115 Ga0081540_1000426 3300005983 Bacteria 41613
116 Ga0081540_1000788 3300005983 Bacteria 29095
117 Ga0097621_100092224 3300006237 Bacteria 2536
118 Ga0097621_100319425 3300006237 Bacteria 1375
119 Ga0097621_100443336 3300006237 Bacteria 1169
120 Ga0068871_100000529 3300006358 Bacteria 26128
121 Ga0068871_100032928 3300006358 Bacteria 4099
122 Ga0075428_100064223 3300006844 Bacteria 4020
123 Ga0075430_100030282 3300006846 Bacteria 4595
124 Ga0075430_100144916 3300006846 Unclassified 1978
125 Ga0075431_100017661 3300006847 Bacteria 7253
126 Ga0075431_100073146 3300006847 Bacteria 3537
127 Ga0075431_100522266 3300006847 Bacteria 1177
128 Ga0075431_100553910 3300006847 Bacteria 1137
129 Ga0075433_10578235 3300006852 Bacteria 987
130 Ga0075434_100629328 3300006871 Bacteria 1092
131 Ga0075434_100767805 3300006871 Bacteria 981
132 Ga0075434_100863700 3300006871 Unclassified 920
133 Ga0075429_100043972 3300006880 Bacteria 3885
134 Ga0068865_100000955 3300006881 Bacteria 16461
135 Ga0068865_100469375 3300006881 Bacteria 1044
136 Ga0097620_100004935 3300006931 Bacteria 13556
137 Ga0097620_100231726 3300006931 Bacteria 1935
138 Ga0097620_100606383 3300006931 Bacteria 1188
139 Ga0097620_101014640 3300006931 Bacteria 911
140 Ga0075435_100165890 3300007076 Bacteria 1862
141 Ga0105240_10001794 3300009093 Bacteria 36131
142 Ga0111539_10003645 3300009094 Bacteria 20294
143 Ga0105245_10002417 3300009098 Bacteria 16904
144 Ga0105245_10006833 3300009098 Bacteria 10009
145 Ga0105247_10000495 3300009101 Bacteria 32681
146 Ga0105247_10000863 3300009101 Bacteria 22935
147 Ga0114129_10238687 3300009147 Bacteria 2444
148 Ga0114129_12088526 3300009147 Bacteria 684
149 Ga0105241_10000244 3300009174 Bacteria 41239
150 Ga0105242_10003018 3300009176 Bacteria 13157
151 Ga0105242_10078037 3300009176 Bacteria 2764
152 Ga0105248_11417190 3300009177 Bacteria 786
153 Ga0105248_12036452 3300009177 Unclassified 652
154 Ga0105237_10001821 3300009545 Bacteria 27502
155 Ga0105238_10000705 3300009551 Bacteria 34903
156 Ga0105249_10000549 3300009553 Bacteria 34738
157 Ga0105239_10034279 3300010375 Bacteria 5574
158 Ga0105246_10004199 3300011119 Bacteria 8754
159 Ga0105246_10399900 3300011119 Unclassified 1140
160 Ga0157373_10008204 3300013100 Bacteria 7767
161 Ga0157371_10002774 3300013102 Bacteria 16440
162 Ga0157369_10001108 3300013105 Bacteria 33690
163 Ga0157369_11496140 3300013105 Bacteria 687
164 Ga0157374_10001654 3300013296 Bacteria 18651
165 Ga0157374_11339307 3300013296 Bacteria 738
166 Ga0157378_10001798 3300013297 Bacteria 19261
167 Ga0157378_11093750 3300013297 Bacteria 834
168 Ga0163162_10002320 3300013306 Bacteria 17852
169 Ga0157372_10016419 3300013307 Bacteria 7943
170 Ga0157375_10003855 3300013308 Bacteria 13018
171 Ga0157375_10207367 3300013308 Bacteria 2117
172 Ga0157375_10505231 3300013308 Bacteria 1373
173 Ga0163163_10009683 3300014325 Bacteria 8621
174 Ga0157380_10234992 3300014326 Unclassified 1649
175 Ga0157377_10001667 3300014745 Bacteria 9677
176 Ga0157379_10001549 3300014968 Bacteria 18909
177 Ga0157376_10002532 3300014969 Bacteria 12387
178 Ga0157376_10133677 3300014969 Bacteria 2217
179 Ga0157376_10153562 3300014969 Bacteria 2079
180 Ga0157376_11167810 3300014969 Bacteria 797
181 Ga0157376_11478171 3300014969 Bacteria 712
182 Ga0163161_10085000 3300017792 Bacteria 2334
183 Ga0213872_10058032 3300021361 Bacteria 1752
184 Ga0207697_10000520 3300025315 Bacteria 21713
185 Ga0207656_10000802 3300025321 Bacteria 10265
186 Ga0207656_10049060 3300025321 Bacteria 1819
187 Ga0207653_10113884 3300025885 Bacteria 968
188 Ga0207642_10056802 3300025899 Bacteria 1797
189 Ga0207710_10000993 3300025900 Bacteria 14831
190 Ga0207710_10026345 3300025900 Bacteria 2512
191 Ga0207688_10000098 3300025901 Bacteria 34240
192 Ga0207688_10233895 3300025901 Bacteria 1110
193 Ga0207647_10011704 3300025904 Bacteria 6141
194 Ga0207645_10000055 3300025907 Bacteria 83041
195 Ga0207645_10685299 3300025907 Bacteria 696
196 Ga0207643_10000054 3300025908 Bacteria 74219
197 Ga0207643_10704853 3300025908 Unclassified 652
198 Ga0207705_10011080 3300025909 Bacteria 6537
199 Ga0207684_10489994 3300025910 Bacteria 1054
200 Ga0207654_10429406 3300025911 Bacteria 923
201 Ga0207695_10041598 3300025913 Bacteria 4918
202 Ga0207671_10031518 3300025914 Bacteria 3950
203 Ga0207663_10267912 3300025916 Bacteria 1264
204 Ga0207660_10294528 3300025917 Bacteria 1291
205 Ga0207662_10000418 3300025918 Bacteria 18784
206 Ga0207662_10600705 3300025918 Unclassified 766
207 Ga0207657_10000070 3300025919 Bacteria 94634
208 Ga0207649_10257630 3300025920 Bacteria 1259
209 Ga0207652_10110827 3300025921 Bacteria 2434
210 Ga0207681_10054525 3300025923 Bacteria 2718
211 Ga0207681_10167648 3300025923 Bacteria 1662
212 Ga0207681_11116790 3300025923 Bacteria 662
213 Ga0207650_10053702 3300025925 Bacteria 2987
214 Ga0207650_10876684 3300025925 Unclassified 762
215 Ga0207659_10000136 3300025926 Bacteria 43133
216 Ga0207659_10121589 3300025926 Bacteria 2001
217 Ga0207687_10056692 3300025927 Bacteria 2749
218 Ga0207706_10000094 3300025933 Bacteria 92942
219 Ga0207686_10028703 3300025934 Bacteria 3274
220 Ga0207709_10507411 3300025935 Bacteria 942
221 Ga0207670_10000420 3300025936 Bacteria 24017
222 Ga0207670_10001606 3300025936 Bacteria 11781
223 Ga0207670_10043487 3300025936 Unclassified 2967
224 Ga0207669_10000303 3300025937 Bacteria 22654
225 Ga0207704_10002966 3300025938 Bacteria 7668
226 Ga0207691_10000173 3300025940 Bacteria 60288
227 Ga0207691_10003696 3300025940 Bacteria 14837
228 Ga0207711_10007180 3300025941 Bacteria 9335
229 Ga0207711_11014350 3300025941 Bacteria 770
230 Ga0207689_10000287 3300025942 Bacteria 45869
231 Ga0207679_10421907 3300025945 Unclassified 1177
232 Ga0207667_10018498 3300025949 Bacteria 7812
233 Ga0207667_10132835 3300025949 Bacteria 2564
234 Ga0207712_10001006 3300025961 Bacteria 20086
235 Ga0207668_10001718 3300025972 Bacteria 12822
236 Ga0207668_10270854 3300025972 Bacteria 1388
237 Ga0207658_10045597 3300025986 Bacteria 3196
238 Ga0207658_10325298 3300025986 Bacteria 1332
239 Ga0207677_10001271 3300026023 Bacteria 13555
240 Ga0207677_10021183 3300026023 Bacteria 3966
241 Ga0207677_10234091 3300026023 Bacteria 1481
242 Ga0207703_11577192 3300026035 Viruses 632
243 Ga0207639_10081070 3300026041 Bacteria 2569
244 Ga0207678_10008975 3300026067 Bacteria 8798
245 Ga0207678_10220740 3300026067 Unclassified 1622
246 Ga0207708_10020333 3300026075 Bacteria 5007
247 Ga0207708_11153465 3300026075 Bacteria 677
248 Ga0207702_11514440 3300026078 Bacteria 664
249 Ga0207641_10057288 3300026088 Bacteria 3313
250 Ga0207641_10361807 3300026088 Unclassified 1385
251 Ga0207641_11408291 3300026088 Unclassified 698
252 Ga0207648_10000247 3300026089 Bacteria 58338
253 Ga0207648_10432282 3300026089 Bacteria 1197
254 Ga0207648_10815722 3300026089 Unclassified 869
255 Ga0207676_10002084 3300026095 Bacteria 14509
256 Ga0207674_10000426 3300026116 Bacteria 54953
257 Ga0207674_11084390 3300026116 Unclassified 770
258 Ga0207675_100000063 3300026118 Bacteria 80198
259 Ga0207675_100066699 3300026118 Bacteria 3364
260 Ga0207683_10000053 3300026121 Bacteria 85332
261 Ga0207683_10197995 3300026121 Unclassified 1826
262 Ga0207698_10191736 3300026142 Bacteria 1821
263 Ga0207698_10215808 3300026142 Bacteria 1730
264 Ga0207428_10008546 3300027907 Bacteria 9237
265 Ga0268266_10001038 3300028379 Bacteria 34907
266 Ga0268266_10014270 3300028379 Bacteria 6833
267 Ga0268266_10155639 3300028379 Bacteria 2064
268 Ga0268266_11300442 3300028379 Bacteria 702
269 Ga0268265_10002440 3300028380 Bacteria 14023
270 Ga0268265_10340575 3300028380 Bacteria 1365
271 Ga0268265_10382537 3300028380 Bacteria 1295
272 Ga0268264_10000986 3300028381 Bacteria 29112
273 Ga0268264_10422132 3300028381 Bacteria 1286
274 Ga0265337_1006553 3300028556 Bacteria 4472
275 Ga0265338_10462293 3300028800 Bacteria 897
276 Ga0265332_10078102 3300031238 Unclassified 1405
277 Ga0265320_10026140 3300031240 Bacteria 3059
278 Ga0307513_10186928 3300031456 Unclassified 1928
279 Ga0307509_10209612 3300031507 Bacteria 1775
280 Ga0307508_10625674 3300031616 Bacteria 680
281 Ga0307416_101407988 3300032002 Unclassified 803
282 Ga0307414_10865970 3300032004 Unclassified 827
283 Ga0373928_0122101 3300035084 Bacteria 699
284 Ga0373954_0370655 3300035118 Bacteria 707
285 Ga0373943_0223431 3300035170 Bacteria 1050
286 Ga0373955_0097355 3300035172 Bacteria 1685
287 Ga0373942_0050634 3300035207 Bacteria 1164
288 Ga0373931_0219248 3300035691 Bacteria 1145
289 Ga0373935_0560954 3300035692 Bacteria 833
290 Ga0373937_0025263 3300036401 Bacteria 5363
291 Ga0373937_0145579 3300036401 Bacteria 2218
292 Ga0373937_0877639 3300036401 Bacteria 846
293 Ga0436361_0762727 3300039447 Bacteria 2909
294 Ga0436363_0557477 3300039450 Bacteria 806
295 Ga0436363_1644309 3300039450 Bacteria 3908
296 Ga0451793_0230728 3300041452 Unclassified 1255
297 Ga0451797_1281718 3300041453 Bacteria 573
298 Ga0451797_1426412 3300041453 Bacteria 1138
299 Ga0451795_1253713 3300041456 Bacteria 633
300 Ga0451802_1599663 3300041460 Bacteria 866
301 Ga0451804_0597469 3300041463 Unclassified 606
302 Ga0451807_0323219 3300041486 Unclassified 647
303 Ga0451807_0973877 3300041486 Bacteria 8476
304 Ga0451807_2228592 3300041486 Bacteria 975
305 Ga0451839_0610579 3300041496 Bacteria 639
306 Ga0451841_0134688 3300041498 Bacteria 558
307 Ga0451849_1563670 3300041505 Bacteria 824
308 Ga0451853_3720402 3300041512 Bacteria 727
309 Ga0439448_0015039 3300042005 Bacteria 2341
310 Ga0439450_172642 3300042008 Bacteria 572
311 Ga0439455_0007368 3300042012 Bacteria 2324
312 Ga0450896_036063 3300042133 Bacteria 761
313 Ga0466959_0583288 3300045049 Bacteria 753
314 Ga0451576_1046052 3300045051 Bacteria 855
315 Ga0495662_0107882 3300046476 Bacteria 1364
316 Ga0495628_0001524 3300046516 Bacteria 21223
317 Ga0495613_0861305 3300046689 Unclassified 588
318 Ga0495600_0427869 3300046809 Unclassified 821
319 Ga0495684_0028093 3300047471 Bacteria 4320
320 Ga0496102_0049731 3300048905 Bacteria 3814
321 Ga0496104_0279400 3300048907 Bacteria 1583
322 Ga0496106_0014970 3300048909 Bacteria 5738
323 Ga0496107_0004956 3300048910 Bacteria 9062
324 Ga0496108_0037698 3300048911 Bacteria 4028
325 Ga0496109_0009793 3300048912 Bacteria 8181
326 Ga0496110_1036935 3300048913 Bacteria 728
327 Ga0496112_0003038 3300048915 Bacteria 13727
328 Ga0496114_0339763 3300048917 Bacteria 1328
329 Ga0501032_0048053 3300049569 Bacteria 2881
330 Ga0501032_0726977 3300049569 Unclassified 629
331 Ga0501033_0842101 3300049570 Unclassified 618
332 Ga0501034_0009350 3300049571 Bacteria 10270
333 Ga0501034_0071472 3300049571 Unclassified 3480
334 Ga0501038_0195177 3300049574 Bacteria 1627
335 Ga0501038_0776032 3300049574 Bacteria 714
336 Ga0501043_0009569 3300049579 Bacteria 7598
337 Ga0501043_0154335 3300049579 Bacteria 1796
338 Ga0501043_0542149 3300049579 Bacteria 865
339 Ga0501046_0062571 3300049580 Bacteria 2907
340 Ga0501046_0133271 3300049580 Bacteria 1883
341 Ga0501047_0004201 3300049581 Bacteria 13563
342 Ga0501047_0032486 3300049581 Bacteria 5038
343 Ga0501047_0066619 3300049581 Unclassified 3471
344 Ga0501048_0479839 3300049582 Unclassified 891
345 Ga0501048_0616559 3300049582 Bacteria 779
346 Ga0501067_0016751 3300049583 Bacteria 4049
347 Ga0501068_0000163 3300049584 Bacteria 30860
348 Ga0501069_0022084 3300049585 Bacteria 3458
349 Ga0501070_0000705 3300049586 Bacteria 30678
350 Ga0501072_0000004 3300049588 Bacteria 282897
351 Ga0501073_0065046 3300049589 Bacteria 2543
352 Ga0501073_0120952 3300049589 Bacteria 1814
353 Ga0501076_0104274 3300049592 Bacteria 2288
354 Ga0501077_0012019 3300049593 Bacteria 5419
355 Ga0501077_0468588 3300049593 Bacteria 807
356 Ga0501079_0021414 3300049741 Bacteria 4945
357 Ga0501080_0034224 3300049742 Bacteria 4741
358 Ga0501080_0729166 3300049742 Bacteria 873
359 Ga0501080_0895132 3300049742 Bacteria 774
360 Ga0501083_0020261 3300049744 Bacteria 4628
361 Ga0501083_0700954 3300049744 Bacteria 658
362 Ga0501044_0093493 3300049823 Unclassified 3032
363 Ga0501044_0139764 3300049823 Unclassified 2411
364 nmdc:mga05p37_1885280_c1 3300050507 Bacteria 572
365 nmdc:mga05p37_277708_c1 3300050507 Bacteria 1999
366 nmdc:mga09592_4432_c1 3300050508 Bacteria 11367
367 nmdc:mga0qj67_108338_c1 3300050509 Unclassified 2241
368 nmdc:mga0qj67_33850_c1 3300050509 Bacteria 3988
369 nmdc:mga06r32_12442_c1 3300050510 Bacteria 7679
370 nmdc:mga06r32_223254_c1 3300050510 Bacteria 1872
371 nmdc:mga06r32_301590_c1 3300050510 Bacteria 1588
372 nmdc:mga06r32_455031_c1 3300050510 Bacteria 1259
373 nmdc:mga0n895_357448_c1 3300050512 Unclassified 1479
374 nmdc:mga0n895_918154_c1 3300050512 Bacteria 860
375 nmdc:mga0n895_95753_c1 3300050512 Bacteria 2973
376 nmdc:mga0rr50_134503_c1 3300050513 Bacteria 1983
377 nmdc:mga0a205_1041883_c1 3300050515 Bacteria 665
378 nmdc:mga0a205_495126_c1 3300050515 Bacteria 1079
379 Ga0500641_0323332 3300053096 Bacteria 627
380 Ga0500556_0231214 3300053104 Bacteria 729
381 Ga0500617_128151 3300053124 Bacteria 1037
382 Ga0500642_0228113 3300053130 Bacteria 861
383 Ga0500559_0429658 3300053136 Bacteria 612
384 Ga0500568_0007526 3300053139 Bacteria 5334
385 Ga0500588_0004045 3300053146 Bacteria 3145
386 Ga0501084_0000308 3300054114 Bacteria 37148
387 Ga0501084_0415913 3300054114 Bacteria 1136
388 Ga0501082_0012038 3300060353 Bacteria 7434
389 Ga0530510_0034553 3300061734 Bacteria 3643

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0048053 Ga0501032_0048053_2472_2870 118
2 3300041486 Ga0451807_2228592 Ga0451807_2228592_64_450 122
3 3300013105 Ga0157369_11496140 Ga0157369_114961402 128
4 3300035118 Ga0373954_0370655 Ga0373954_0370655_80_484 131
5 3300035172 Ga0373955_0097355 Ga0373955_0097355_343_747 131
6 3300036401 Ga0373937_0025263 Ga0373937_0025263_3619_4023 131
7 3300046809 Ga0495600_0427869 Ga0495600_0427869_206_610 131
8 3300049570 Ga0501033_0842101 Ga0501033_0842101_36_440 133
9 3300049582 Ga0501048_0479839 Ga0501048_0479839_140_544 133
10 3300036401 Ga0373937_0877639 Ga0373937_0877639_159_593 134
11 3300041460 Ga0451802_1599663 Ga0451802_1599663_173_580 135
12 3300041498 Ga0451841_0134688 Ga0451841_0134688_95_502 135
13 3300046476 Ga0495662_0107882 Ga0495662_0107882_562_990 139
14 3300005444 Ga0070694_100027778 Ga0070694_1000277784 140
15 3300005471 Ga0070698_100055793 Ga0070698_1000557931 140
16 3300005549 Ga0070704_100309924 Ga0070704_1003099242 140
17 3300005331 Ga0070670_101113632 Ga0070670_1011136321 141
18 3300005340 Ga0070689_100022099 Ga0070689_1000220993 141
19 3300005365 Ga0070688_100264201 Ga0070688_1002642013 141
20 3300025925 Ga0207650_10876684 Ga0207650_108766842 141
21 3300025936 Ga0207670_10043487 Ga0207670_100434874 141
22 3300004801 Ga0058860_10732615 Ga0058860_107326151 142
23 3300005340 Ga0070689_100327951 Ga0070689_1003279512 142
24 3300009101 Ga0105247_10000495 Ga0105247_1000049522 142
25 3300014969 Ga0157376_11167810 Ga0157376_111678102 142
26 3300025900 Ga0207710_10000993 Ga0207710_1000099311 142
27 3300025936 Ga0207670_10001606 Ga0207670_1000160610 142
28 3300045049 Ga0466959_0583288 Ga0466959_0583288_131_625 142
29 3300005548 Ga0070665_100421527 Ga0070665_1004215272 143
30 3300005563 Ga0068855_100199207 Ga0068855_1001992074 143
31 3300014969 Ga0157376_10153562 Ga0157376_101535622 143
32 3300025949 Ga0207667_10132835 Ga0207667_101328355 143
33 3300028379 Ga0268266_10014270 Ga0268266_100142703 143
34 3300028800 Ga0265338_10462293 Ga0265338_104622932 143
35 3300005337 Ga0070682_100004766 Ga0070682_1000047668 144
36 3300005341 Ga0070691_10159708 Ga0070691_101597082 144
37 3300005577 Ga0068857_100249077 Ga0068857_1002490771 144
38 3300006846 Ga0075430_100030282 Ga0075430_1000302826 144
39 3300006847 Ga0075431_100073146 Ga0075431_1000731464 144
40 3300006880 Ga0075429_100043972 Ga0075429_1000439722 144
41 3300009094 Ga0111539_10003645 Ga0111539_100036453 144
42 3300026116 Ga0207674_11084390 Ga0207674_110843902 144
43 3300027907 Ga0207428_10008546 Ga0207428_100085464 144
44 3300035692 Ga0373935_0560954 Ga0373935_0560954_48_491 144
45 3300041486 Ga0451807_0323219 Ga0451807_0323219_152_595 144
46 3300046516 Ga0495628_0001524 Ga0495628_0001524_3216_3659 144
47 3300046689 Ga0495613_0861305 Ga0495613_0861305_52_495 144
48 3300047471 Ga0495684_0028093 Ga0495684_0028093_2824_3267 144
49 3300048907 Ga0496104_0279400 Ga0496104_0279400_1075_1518 144
50 3300049574 Ga0501038_0195177 Ga0501038_0195177_470_946 144
51 3300049579 Ga0501043_0154335 Ga0501043_0154335_466_942 144
52 3300049581 Ga0501047_0004201 Ga0501047_0004201_12514_12990 144
53 3300049582 Ga0501048_0616559 Ga0501048_0616559_113_589 144
54 3300049583 Ga0501067_0016751 Ga0501067_0016751_3398_3874 144
55 3300049584 Ga0501068_0000163 Ga0501068_0000163_29158_29634 144
56 3300049585 Ga0501069_0022084 Ga0501069_0022084_190_666 144
57 3300049588 Ga0501072_0000004 Ga0501072_0000004_177236_177712 144
58 3300049589 Ga0501073_0120952 Ga0501073_0120952_1026_1502 144
59 3300049592 Ga0501076_0104274 Ga0501076_0104274_1707_2183 144
60 3300049593 Ga0501077_0012019 Ga0501077_0012019_4825_5301 144
61 3300049741 Ga0501079_0021414 Ga0501079_0021414_97_573 144
62 3300049742 Ga0501080_0034224 Ga0501080_0034224_1622_2098 144
63 3300049744 Ga0501083_0700954 Ga0501083_0700954_122_598 144
64 3300050508 nmdc:mga09592_4432_c1 nmdc:mga09592_4432_c1_3779_4222 144
65 3300050509 nmdc:mga0qj67_33850_c1 nmdc:mga0qj67_33850_c1_327_770 144
66 3300050510 nmdc:mga06r32_301590_c1 nmdc:mga06r32_301590_c1_662_1105 144
67 3300054114 Ga0501084_0000308 Ga0501084_0000308_36491_36967 144
68 3300060353 Ga0501082_0012038 Ga0501082_0012038_6923_7399 144
69 3300003320 rootH2_10231588 rootH2_102315883 145
70 3300003323 rootH1_10207350 rootH1_102073504 145
71 3300005337 Ga0070682_100250120 Ga0070682_1002501201 145
72 3300005338 Ga0068868_100033933 Ga0068868_1000339335 145
73 3300005355 Ga0070671_100393453 Ga0070671_1003934532 145
74 3300005366 Ga0070659_100494431 Ga0070659_1004944311 145
75 3300005458 Ga0070681_11481107 Ga0070681_114811071 145
76 3300005459 Ga0068867_100896658 Ga0068867_1008966581 145
77 3300005467 Ga0070706_100279155 Ga0070706_1002791552 145
78 3300005471 Ga0070698_101212089 Ga0070698_1012120892 145
79 3300005617 Ga0068859_100979972 Ga0068859_1009799722 145
80 3300006237 Ga0097621_100092224 Ga0097621_1000922243 145
81 3300006358 Ga0068871_100032928 Ga0068871_1000329286 145
82 3300006871 Ga0075434_100863700 Ga0075434_1008637002 145
83 3300007076 Ga0075435_100165890 Ga0075435_1001658902 145
84 3300009147 Ga0114129_10238687 Ga0114129_102386872 145
85 3300009176 Ga0105242_10078037 Ga0105242_100780373 145
86 3300025910 Ga0207684_10489994 Ga0207684_104899942 145
87 3300026023 Ga0207677_10021183 Ga0207677_100211835 145
88 3300026089 Ga0207648_10432282 Ga0207648_104322822 145
89 3300041452 Ga0451793_0230728 Ga0451793_0230728_161_598 145
90 3300041453 Ga0451797_1281718 Ga0451797_1281718_95_532 145
91 3300041453 Ga0451797_1426412 Ga0451797_1426412_510_947 145
92 3300041456 Ga0451795_1253713 Ga0451795_1253713_16_453 145
93 3300041463 Ga0451804_0597469 Ga0451804_0597469_125_562 145
94 3300041486 Ga0451807_0973877 Ga0451807_0973877_4555_4992 145
95 3300048917 Ga0496114_0339763 Ga0496114_0339763_193_630 145
96 3300049589 Ga0501073_0065046 Ga0501073_0065046_1498_1935 145
97 3300049742 Ga0501080_0895132 Ga0501080_0895132_118_561 145
98 3300049744 Ga0501083_0020261 Ga0501083_0020261_2273_2716 145
99 3300050507 nmdc:mga05p37_277708_c1 nmdc:mga05p37_277708_c1_1463_1909 145
100 3300050512 nmdc:mga0n895_357448_c1 nmdc:mga0n895_357448_c1_256_717 145
101 3300050513 nmdc:mga0rr50_134503_c1 nmdc:mga0rr50_134503_c1_504_965 145
102 3300050515 nmdc:mga0a205_1041883_c1 nmdc:mga0a205_1041883_c1_13_459 145
103 3300053139 Ga0500568_0007526 Ga0500568_0007526_2146_2616 145
104 3300054114 Ga0501084_0415913 Ga0501084_0415913_58_501 145
105 3300005337 Ga0070682_100614798 Ga0070682_1006147981 146
106 3300005340 Ga0070689_100275480 Ga0070689_1002754802 146
107 3300035691 Ga0373931_0219248 Ga0373931_0219248_353_802 146
108 3300041512 Ga0451853_3720402 Ga0451853_3720402_135_611 146
109 3300049571 Ga0501034_0071472 Ga0501034_0071472_1150_1593 146
110 3300049579 Ga0501043_0009569 Ga0501043_0009569_5179_5622 146
111 3300049580 Ga0501046_0133271 Ga0501046_0133271_1185_1628 146
112 3300049581 Ga0501047_0032486 Ga0501047_0032486_311_754 146
113 3300049586 Ga0501070_0000705 Ga0501070_0000705_12929_13372 146
114 3300049742 Ga0501080_0729166 Ga0501080_0729166_351_794 146
115 3300049823 Ga0501044_0093493 Ga0501044_0093493_2573_3016 146
116 3300053136 Ga0500559_0429658 Ga0500559_0429658_135_578 146
117 3300005289 Ga0065704_10072298 Ga0065704_100722986 147
118 3300005328 Ga0070676_10613670 Ga0070676_106136701 147
119 3300005548 Ga0070665_100287662 Ga0070665_1002876622 147
120 3300006844 Ga0075428_100064223 Ga0075428_1000642234 147
121 3300006847 Ga0075431_100522266 Ga0075431_1005222663 147
122 3300021361 Ga0213872_10058032 Ga0213872_100580322 147
123 3300028379 Ga0268266_10155639 Ga0268266_101556393 147
124 3300039447 Ga0436361_0762727 Ga0436361_0762727_2187_2657 147
125 3300042133 Ga0450896_036063 Ga0450896_036063_272_727 147
126 3300049569 Ga0501032_0726977 Ga0501032_0726977_161_607 147
127 3300049571 Ga0501034_0009350 Ga0501034_0009350_9141_9587 147
128 3300049579 Ga0501043_0542149 Ga0501043_0542149_145_591 147
129 3300049580 Ga0501046_0062571 Ga0501046_0062571_1375_1821 147
130 3300049581 Ga0501047_0066619 Ga0501047_0066619_1527_1973 147
131 3300049823 Ga0501044_0139764 Ga0501044_0139764_404_850 147
132 3300050510 nmdc:mga06r32_223254_c1 nmdc:mga06r32_223254_c1_1399_1848 147
133 3300061734 Ga0530510_0034553 Ga0530510_0034553_1355_1798 147
134 3300005331 Ga0070670_101003682 Ga0070670_1010036822 148
135 3300005333 Ga0070677_10078721 Ga0070677_100787213 148
136 3300005334 Ga0068869_101434183 Ga0068869_1014341831 148
137 3300005338 Ga0068868_100346969 Ga0068868_1003469692 148
138 3300005347 Ga0070668_100015566 Ga0070668_1000155667 148
139 3300005353 Ga0070669_100329750 Ga0070669_1003297501 148
140 3300005353 Ga0070669_101077175 Ga0070669_1010771751 148
141 3300005354 Ga0070675_100026385 Ga0070675_1000263853 148
142 3300005355 Ga0070671_100474435 Ga0070671_1004744351 148
143 3300005364 Ga0070673_100651451 Ga0070673_1006514511 148
144 3300005367 Ga0070667_100450014 Ga0070667_1004500141 148
145 3300005518 Ga0070699_100658828 Ga0070699_1006588282 148
146 3300005536 Ga0070697_100817103 Ga0070697_1008171031 148
147 3300005543 Ga0070672_100021954 Ga0070672_1000219544 148
148 3300005543 Ga0070672_101350777 Ga0070672_1013507771 148
149 3300005548 Ga0070665_100164676 Ga0070665_1001646763 148
150 3300005564 Ga0070664_100117325 Ga0070664_1001173252 148
151 3300005578 Ga0068854_100718928 Ga0068854_1007189282 148
152 3300005616 Ga0068852_100108581 Ga0068852_1001085812 148
153 3300005617 Ga0068859_100231726 Ga0068859_1002317262 148
154 3300005840 Ga0068870_10528420 Ga0068870_105284202 148
155 3300005843 Ga0068860_100898315 Ga0068860_1008983152 148
156 3300005844 Ga0068862_101016333 Ga0068862_1010163332 148
157 3300006237 Ga0097621_100443336 Ga0097621_1004433362 148
158 3300006852 Ga0075433_10578235 Ga0075433_105782351 148
159 3300006871 Ga0075434_100629328 Ga0075434_1006293282 148
160 3300006881 Ga0068865_100469375 Ga0068865_1004693753 148
161 3300006931 Ga0097620_100231726 Ga0097620_1002317262 148
162 3300009098 Ga0105245_10002417 Ga0105245_100024172 148
163 3300009177 Ga0105248_12036452 Ga0105248_120364522 148
164 3300011119 Ga0105246_10399900 Ga0105246_103999002 148
165 3300013296 Ga0157374_11339307 Ga0157374_113393072 148
166 3300013297 Ga0157378_11093750 Ga0157378_110937502 148
167 3300013308 Ga0157375_10505231 Ga0157375_105052312 148
168 3300014326 Ga0157380_10234992 Ga0157380_102349922 148
169 3300014969 Ga0157376_11478171 Ga0157376_114781712 148
170 3300025321 Ga0207656_10049060 Ga0207656_100490603 148
171 3300025901 Ga0207688_10233895 Ga0207688_102338951 148
172 3300025907 Ga0207645_10685299 Ga0207645_106852992 148
173 3300025908 Ga0207643_10704853 Ga0207643_107048532 148
174 3300025923 Ga0207681_10167648 Ga0207681_101676481 148
175 3300025923 Ga0207681_11116790 Ga0207681_111167901 148
176 3300025926 Ga0207659_10121589 Ga0207659_101215892 148
177 3300025940 Ga0207691_10003696 Ga0207691_1000369610 148
178 3300025945 Ga0207679_10421907 Ga0207679_104219072 148
179 3300025972 Ga0207668_10270854 Ga0207668_102708543 148
180 3300025986 Ga0207658_10325298 Ga0207658_103252982 148
181 3300026023 Ga0207677_10234091 Ga0207677_102340912 148
182 3300026035 Ga0207703_11577192 Ga0207703_115771922 148
183 3300026067 Ga0207678_10220740 Ga0207678_102207402 148
184 3300026118 Ga0207675_100066699 Ga0207675_1000666991 148
185 3300026142 Ga0207698_10215808 Ga0207698_102158082 148
186 3300028379 Ga0268266_11300442 Ga0268266_113004422 148
187 3300028380 Ga0268265_10382537 Ga0268265_103825371 148
188 3300028381 Ga0268264_10422132 Ga0268264_104221322 148
189 3300031456 Ga0307513_10186928 Ga0307513_101869283 148
190 3300031507 Ga0307509_10209612 Ga0307509_102096121 148
191 3300032002 Ga0307416_101407988 Ga0307416_1014079882 148
192 3300032004 Ga0307414_10865970 Ga0307414_108659701 148
193 3300041496 Ga0451839_0610579 Ga0451839_0610579_152_613 148
194 3300041505 Ga0451849_1563670 Ga0451849_1563670_209_670 148
195 3300049593 Ga0501077_0468588 Ga0501077_0468588_68_529 148
196 3300050512 nmdc:mga0n895_95753_c1 nmdc:mga0n895_95753_c1_2422_2883 148
197 3300050515 nmdc:mga0a205_495126_c1 nmdc:mga0a205_495126_c1_153_614 148
198 3300053096 Ga0500641_0323332 Ga0500641_0323332_58_513 148
199 3300053104 Ga0500556_0231214 Ga0500556_0231214_215_670 148
200 3300053124 Ga0500617_128151 Ga0500617_128151_109_564 148
201 3300053130 Ga0500642_0228113 Ga0500642_0228113_221_676 148
202 3300053146 Ga0500588_0004045 Ga0500588_0004045_647_1102 148
203 3300005334 Ga0068869_101705378 Ga0068869_1017053781 149
204 3300005343 Ga0070687_100550754 Ga0070687_1005507541 149
205 3300005440 Ga0070705_100130374 Ga0070705_1001303743 149
206 3300005456 Ga0070678_100726742 Ga0070678_1007267422 149
207 3300005459 Ga0068867_100198969 Ga0068867_1001989691 149
208 3300005617 Ga0068859_101014881 Ga0068859_1010148812 149
209 3300005719 Ga0068861_100377508 Ga0068861_1003775082 149
210 3300006847 Ga0075431_100553910 Ga0075431_1005539103 149
211 3300006931 Ga0097620_101014640 Ga0097620_1010146402 149
212 3300009147 Ga0114129_12088526 Ga0114129_120885262 149
213 3300025918 Ga0207662_10600705 Ga0207662_106007051 149
214 3300026088 Ga0207641_10361807 Ga0207641_103618073 149
215 3300026089 Ga0207648_10815722 Ga0207648_108157221 149
216 3300026121 Ga0207683_10197995 Ga0207683_101979951 149
217 3300042005 Ga0439448_0015039 Ga0439448_0015039_1509_1961 149
218 3300042008 Ga0439450_172642 Ga0439450_172642_68_520 149
219 3300042012 Ga0439455_0007368 Ga0439455_0007368_1649_2101 149
220 3300050507 nmdc:mga05p37_1885280_c1 nmdc:mga05p37_1885280_c1_19_477 149
221 3300050510 nmdc:mga06r32_455031_c1 nmdc:mga06r32_455031_c1_777_1235 149
222 3300001990 JGI24737J22298_10163043 JGI24737J22298_101630432 150
223 3300002076 JGI24749J21850_1017216 JGI24749J21850_10172162 150
224 3300003659 JGI25404J52841_10072195 JGI25404J52841_100721951 150
225 3300005293 Ga0065715_10101557 Ga0065715_101015572 150
226 3300005327 Ga0070658_10001909 Ga0070658_1000190915 150
227 3300005329 Ga0070683_100042023 Ga0070683_1000420234 150
228 3300005330 Ga0070690_100000245 Ga0070690_1000002452 150
229 3300005331 Ga0070670_100056960 Ga0070670_1000569603 150
230 3300005333 Ga0070677_10000065 Ga0070677_1000006516 150
231 3300005334 Ga0068869_100028014 Ga0068869_1000280145 150
232 3300005336 Ga0070680_100297676 Ga0070680_1002976763 150
233 3300005337 Ga0070682_100159544 Ga0070682_1001595443 150
234 3300005339 Ga0070660_100001727 Ga0070660_1000017277 150
235 3300005340 Ga0070689_102246637 Ga0070689_1022466371 150
236 3300005343 Ga0070687_100000121 Ga0070687_1000001213 150
237 3300005353 Ga0070669_100005655 Ga0070669_1000056554 150
238 3300005355 Ga0070671_100138883 Ga0070671_1001388834 150
239 3300005356 Ga0070674_100009991 Ga0070674_1000099919 150
240 3300005365 Ga0070688_100000751 Ga0070688_1000007517 150
241 3300005365 Ga0070688_100554929 Ga0070688_1005549291 150
242 3300005366 Ga0070659_100002473 Ga0070659_10000247315 150
243 3300005367 Ga0070667_100053694 Ga0070667_1000536944 150
244 3300005438 Ga0070701_10009212 Ga0070701_100092123 150
245 3300005439 Ga0070711_100348731 Ga0070711_1003487312 150
246 3300005440 Ga0070705_100001864 Ga0070705_1000018644 150
247 3300005441 Ga0070700_100005808 Ga0070700_1000058084 150
248 3300005455 Ga0070663_100023501 Ga0070663_1000235014 150
249 3300005456 Ga0070678_100005934 Ga0070678_1000059347 150
250 3300005459 Ga0068867_100001116 Ga0068867_1000011168 150
251 3300005466 Ga0070685_10000339 Ga0070685_1000033930 150
252 3300005530 Ga0070679_100144306 Ga0070679_1001443062 150
253 3300005535 Ga0070684_100029696 Ga0070684_1000296963 150
254 3300005539 Ga0068853_100005141 Ga0068853_10000514113 150
255 3300005543 Ga0070672_100514752 Ga0070672_1005147521 150
256 3300005544 Ga0070686_100000321 Ga0070686_10000032113 150
257 3300005546 Ga0070696_100043282 Ga0070696_1000432823 150
258 3300005547 Ga0070693_100000957 Ga0070693_10000095711 150
259 3300005563 Ga0068855_100004620 Ga0068855_10000462018 150
260 3300005564 Ga0070664_100011858 Ga0070664_1000118589 150
261 3300005578 Ga0068854_100000649 Ga0068854_10000064915 150
262 3300005615 Ga0070702_100199885 Ga0070702_1001998853 150
263 3300005616 Ga0068852_100004965 Ga0068852_1000049653 150
264 3300005617 Ga0068859_100004936 Ga0068859_10000493616 150
265 3300005617 Ga0068859_100606410 Ga0068859_1006064102 150
266 3300005618 Ga0068864_100105452 Ga0068864_1001054522 150
267 3300005718 Ga0068866_10000626 Ga0068866_1000062614 150
268 3300005719 Ga0068861_100001208 Ga0068861_10000120815 150
269 3300005834 Ga0068851_10000607 Ga0068851_100006075 150
270 3300005840 Ga0068870_10000035 Ga0068870_1000003511 150
271 3300005841 Ga0068863_100003321 Ga0068863_1000033219 150
272 3300005841 Ga0068863_101560618 Ga0068863_1015606181 150
273 3300005843 Ga0068860_100107714 Ga0068860_1001077142 150
274 3300005844 Ga0068862_100001652 Ga0068862_1000016524 150
275 3300005844 Ga0068862_100275479 Ga0068862_1002754793 150
276 3300005983 Ga0081540_1000052 Ga0081540_100005298 150
277 3300005983 Ga0081540_1000426 Ga0081540_100042612 150
278 3300005983 Ga0081540_1000788 Ga0081540_100078834 150
279 3300006237 Ga0097621_100319425 Ga0097621_1003194252 150
280 3300006358 Ga0068871_100000529 Ga0068871_1000005292 150
281 3300006846 Ga0075430_100144916 Ga0075430_1001449162 150
282 3300006847 Ga0075431_100017661 Ga0075431_1000176617 150
283 3300006871 Ga0075434_100767805 Ga0075434_1007678052 150
284 3300006881 Ga0068865_100000955 Ga0068865_10000095520 150
285 3300006931 Ga0097620_100004935 Ga0097620_1000049352 150
286 3300006931 Ga0097620_100606383 Ga0097620_1006063832 150
287 3300009093 Ga0105240_10001794 Ga0105240_1000179413 150
288 3300009098 Ga0105245_10006833 Ga0105245_1000683310 150
289 3300009101 Ga0105247_10000863 Ga0105247_1000086318 150
290 3300009174 Ga0105241_10000244 Ga0105241_1000024434 150
291 3300009176 Ga0105242_10003018 Ga0105242_1000301813 150
292 3300009177 Ga0105248_11417190 Ga0105248_114171902 150
293 3300009545 Ga0105237_10001821 Ga0105237_1000182111 150
294 3300009551 Ga0105238_10000705 Ga0105238_1000070511 150
295 3300009553 Ga0105249_10000549 Ga0105249_1000054910 150
296 3300010375 Ga0105239_10034279 Ga0105239_1003427910 150
297 3300011119 Ga0105246_10004199 Ga0105246_100041997 150
298 3300013100 Ga0157373_10008204 Ga0157373_100082044 150
299 3300013102 Ga0157371_10002774 Ga0157371_1000277416 150
300 3300013105 Ga0157369_10001108 Ga0157369_1000110815 150
301 3300013296 Ga0157374_10001654 Ga0157374_1000165415 150
302 3300013297 Ga0157378_10001798 Ga0157378_1000179814 150
303 3300013306 Ga0163162_10002320 Ga0163162_1000232015 150
304 3300013307 Ga0157372_10016419 Ga0157372_1001641910 150
305 3300013308 Ga0157375_10003855 Ga0157375_100038553 150
306 3300013308 Ga0157375_10207367 Ga0157375_102073672 150
307 3300014325 Ga0163163_10009683 Ga0163163_1000968310 150
308 3300014745 Ga0157377_10001667 Ga0157377_100016675 150
309 3300014968 Ga0157379_10001549 Ga0157379_1000154916 150
310 3300014969 Ga0157376_10002532 Ga0157376_1000253210 150
311 3300014969 Ga0157376_10133677 Ga0157376_101336772 150
312 3300017792 Ga0163161_10085000 Ga0163161_100850005 150
313 3300025315 Ga0207697_10000520 Ga0207697_1000052020 150
314 3300025321 Ga0207656_10000802 Ga0207656_1000080216 150
315 3300025885 Ga0207653_10113884 Ga0207653_101138843 150
316 3300025899 Ga0207642_10056802 Ga0207642_100568022 150
317 3300025900 Ga0207710_10026345 Ga0207710_100263453 150
318 3300025901 Ga0207688_10000098 Ga0207688_1000009819 150
319 3300025904 Ga0207647_10011704 Ga0207647_100117042 150
320 3300025907 Ga0207645_10000055 Ga0207645_1000005545 150
321 3300025908 Ga0207643_10000054 Ga0207643_1000005439 150
322 3300025909 Ga0207705_10011080 Ga0207705_100110803 150
323 3300025911 Ga0207654_10429406 Ga0207654_104294063 150
324 3300025913 Ga0207695_10041598 Ga0207695_100415983 150
325 3300025914 Ga0207671_10031518 Ga0207671_100315181 150
326 3300025916 Ga0207663_10267912 Ga0207663_102679121 150
327 3300025917 Ga0207660_10294528 Ga0207660_102945282 150
328 3300025918 Ga0207662_10000418 Ga0207662_1000041816 150
329 3300025919 Ga0207657_10000070 Ga0207657_1000007058 150
330 3300025920 Ga0207649_10257630 Ga0207649_102576302 150
331 3300025921 Ga0207652_10110827 Ga0207652_101108273 150
332 3300025923 Ga0207681_10054525 Ga0207681_100545252 150
333 3300025925 Ga0207650_10053702 Ga0207650_100537022 150
334 3300025926 Ga0207659_10000136 Ga0207659_1000013611 150
335 3300025927 Ga0207687_10056692 Ga0207687_100566924 150
336 3300025933 Ga0207706_10000094 Ga0207706_1000009457 150
337 3300025934 Ga0207686_10028703 Ga0207686_100287034 150
338 3300025935 Ga0207709_10507411 Ga0207709_105074112 150
339 3300025936 Ga0207670_10000420 Ga0207670_1000042022 150
340 3300025937 Ga0207669_10000303 Ga0207669_100003033 150
341 3300025938 Ga0207704_10002966 Ga0207704_1000296611 150
342 3300025940 Ga0207691_10000173 Ga0207691_1000017357 150
343 3300025941 Ga0207711_10007180 Ga0207711_100071804 150
344 3300025941 Ga0207711_11014350 Ga0207711_110143501 150
345 3300025942 Ga0207689_10000287 Ga0207689_1000028716 150
346 3300025949 Ga0207667_10018498 Ga0207667_1001849811 150
347 3300025961 Ga0207712_10001006 Ga0207712_1000100615 150
348 3300025972 Ga0207668_10001718 Ga0207668_1000171815 150
349 3300025986 Ga0207658_10045597 Ga0207658_100455974 150
350 3300026023 Ga0207677_10001271 Ga0207677_100012713 150
351 3300026041 Ga0207639_10081070 Ga0207639_100810706 150
352 3300026067 Ga0207678_10008975 Ga0207678_1000897510 150
353 3300026075 Ga0207708_10020333 Ga0207708_100203334 150
354 3300026075 Ga0207708_11153465 Ga0207708_111534652 150
355 3300026078 Ga0207702_11514440 Ga0207702_115144402 150
356 3300026088 Ga0207641_10057288 Ga0207641_100572884 150
357 3300026088 Ga0207641_11408291 Ga0207641_114082911 150
358 3300026089 Ga0207648_10000247 Ga0207648_1000024747 150
359 3300026095 Ga0207676_10002084 Ga0207676_1000208418 150
360 3300026116 Ga0207674_10000426 Ga0207674_1000042642 150
361 3300026118 Ga0207675_100000063 Ga0207675_10000006357 150
362 3300026121 Ga0207683_10000053 Ga0207683_1000005342 150
363 3300026142 Ga0207698_10191736 Ga0207698_101917364 150
364 3300028379 Ga0268266_10001038 Ga0268266_1000103811 150
365 3300028380 Ga0268265_10002440 Ga0268265_1000244016 150
366 3300028380 Ga0268265_10340575 Ga0268265_103405752 150
367 3300028381 Ga0268264_10000986 Ga0268264_1000098629 150
368 3300028556 Ga0265337_1006553 Ga0265337_10065533 150
369 3300031238 Ga0265332_10078102 Ga0265332_100781021 150
370 3300031240 Ga0265320_10026140 Ga0265320_100261404 150
371 3300031616 Ga0307508_10625674 Ga0307508_106256741 150
372 3300035084 Ga0373928_0122101 Ga0373928_0122101_220_681 150
373 3300035170 Ga0373943_0223431 Ga0373943_0223431_469_930 150
374 3300035207 Ga0373942_0050634 Ga0373942_0050634_619_1080 150
375 3300036401 Ga0373937_0145579 Ga0373937_0145579_1126_1587 150
376 3300039450 Ga0436363_0557477 Ga0436363_0557477_31_492 150
377 3300039450 Ga0436363_1644309 Ga0436363_1644309_695_1222 150
378 3300045051 Ga0451576_1046052 Ga0451576_1046052_69_521 150
379 3300048905 Ga0496102_0049731 Ga0496102_0049731_2034_2552 150
380 3300048909 Ga0496106_0014970 Ga0496106_0014970_292_744 150
381 3300048910 Ga0496107_0004956 Ga0496107_0004956_7611_8129 150
382 3300048911 Ga0496108_0037698 Ga0496108_0037698_2502_2954 150
383 3300048912 Ga0496109_0009793 Ga0496109_0009793_1937_2455 150
384 3300048913 Ga0496110_1036935 Ga0496110_1036935_83_535 150
385 3300048915 Ga0496112_0003038 Ga0496112_0003038_11946_12464 150
386 3300049574 Ga0501038_0776032 Ga0501038_0776032_13_474 150
387 3300050509 nmdc:mga0qj67_108338_c1 nmdc:mga0qj67_108338_c1_736_1200 150
388 3300050510 nmdc:mga06r32_12442_c1 nmdc:mga06r32_12442_c1_1191_1655 150
389 3300050512 nmdc:mga0n895_918154_c1 nmdc:mga0n895_918154_c1_87_605 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

163

0.92

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

36

147

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.842 8 145
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8357 8 145
3itw-assembly1.cif.gz_B-2 crystal structure of tiox from micromonospora sp. ml1 0.8323 9 143
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.808 12 141
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8018 9 143
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8698 85 145 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8566 87 149 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.856 85 145 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8254 89 142 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.808 12 141 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V9PIK7-F1-model_v4 VOC domain-containing protein 0.9484 1 145 GO:0003700
AF-A0A7W0SZ62-F1-model_v4 VOC family protein 0.9386 9 143
AF-A0A7W7ZYJ9-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9378 8 143
AF-A0A5C7JCL7-F1-model_v4 Glyoxalase 0.937 9 142
AF-A0A7H8KD65-F1-model_v4 VOC family protein 0.937 9 143

Feature Viewer

pLDDT pTM Quality
95.24 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map