F431602

General Info

Members Datasets Scaffolds Average Seq Length
389 273 358 253

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2856287931|2856288040
Length 287
Sequence RSQCCARQALDRAACCIDFMIRKTYQGGGAVKSNLNMFDLSGRLALVTGSSAGIGYALAKGLAGAGARVVLNGRDTARLNAAAARLHEEGATVHFAAFDVTSSAEVEAGIAHIEQEFGPIDILVNNAGMQRRAPLDQFSREDWDTVMTTNVDSVFVVGQAVAKRMIPRGKGKIINVCSVQSELGRPNIAAYTASKGAVKMLTKGMAIDWGQHGIQVNGLGPGYFKTELTKALVDDAAFSNWLIGRTPSRRWGEVEDLVGAAIFLSSAASDFVNGHVLYVDGGITTSL

Samples

Sample ID Description Type Environment
1 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
2 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
3 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
4 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
5 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
6 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
7 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
8 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
9 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
10 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
11 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
12 2818991450 Burkholderia sp. 604 Isolate Unclassified
13 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
14 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
15 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
16 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
17 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
18 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
19 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
20 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
21 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
22 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
23 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
24 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
25 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
26 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
27 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
28 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
33 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
34 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
45 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
164 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
260 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
261 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
262 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
263 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
268 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
270 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
271 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
272 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
273 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.03
Metatranscriptomes 0
Isolates 7.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.88
Nodule 0.51
Rhizoplane 4.37
Rhizosphere 50.13
Stem 0
Stem Tuber 0
Unclassified 22.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000884 3300001989 Bacteria 11069
2 JGI24737J22298_10052676 3300001990 Bacteria 1234
3 JGI24735J21928_10034391 3300002067 Bacteria 1494
4 JGI24738J21930_10004984 3300002075 Bacteria 3214
5 JGI25156J39149_1001160 3300002705 Bacteria 11788
6 JGI25159J45721_1000587 3300002987 Bacteria 16358
7 JGI25159J45721_1003433 3300002987 Bacteria 5596
8 JGI25151J46595_10005197 3300003187 Bacteria 6750
9 JGI25151J46595_10011161 3300003187 Bacteria 4139
10 JGI25151J46595_10019106 3300003187 Bacteria 2921
11 rootL2_10205537 3300003322 Bacteria 1456
12 JGI25160J50197_1000062 3300003354 Bacteria 116417
13 JGI25160J50197_1000158 3300003354 Bacteria 58363
14 JGI25161J50226_1000040 3300003374 Bacteria 124804
15 Ga0055533_1005296 3300003756 Bacteria 2102
16 Ga0055526_1009555 3300003771 Bacteria 4644
17 Ga0055526_1009619 3300003771 Bacteria 4620
18 Ga0055526_1044902 3300003771 Bacteria 1061
19 Ga0055537_1001181 3300003773 Bacteria 11137
20 Ga0055524_1000077 3300003775 Bacteria 121584
21 Ga0055536_1003606 3300003781 Bacteria 8265
22 Ga0055534_1002147 3300003784 Bacteria 7066
23 Ga0055528_1001468 3300003790 Bacteria 14326
24 Ga0055530_10001468 3300003791 Bacteria 17168
25 Ga0055530_10019774 3300003791 Bacteria 2031
26 Ga0055530_10056504 3300003791 Bacteria 890
27 Ga0055540_1000010 3300003792 Bacteria 290865
28 Ga0055531_10000405 3300003794 Bacteria 41493
29 Ga0055543_1000167 3300004625 Bacteria 54995
30 Ga0065165_1000308 3300005262 Bacteria 80273
31 Ga0065165_1008033 3300005262 Bacteria 5041
32 Ga0065165_1050597 3300005262 Bacteria 1182
33 Ga0070670_100001182 3300005331 Bacteria 20700
34 Ga0070677_10029423 3300005333 Bacteria 2083
35 Ga0070682_100119635 3300005337 Bacteria 1766
36 Ga0070671_100050248 3300005355 Bacteria 3468
37 Ga0070713_100401201 3300005436 Bacteria 1281
38 Ga0070678_100406491 3300005456 Bacteria 1184
39 Ga0068867_100383866 3300005459 Bacteria 1181
40 Ga0068867_100486866 3300005459 Bacteria 1058
41 Ga0070685_10076438 3300005466 Bacteria 1997
42 Ga0070665_100031760 3300005548 Bacteria 5315
43 Ga0070665_100712117 3300005548 Bacteria 1017
44 Ga0068854_100350056 3300005578 Bacteria 1209
45 Ga0068859_100025328 3300005617 Bacteria 5952
46 Ga0068864_100012540 3300005618 Bacteria 7009
47 Ga0068866_10100762 3300005718 Bacteria 1593
48 Ga0068863_100208056 3300005841 Bacteria 1883
49 Ga0075365_10097113 3300006038 Bacteria 2013
50 Ga0075432_10125754 3300006058 Bacteria 967
51 Ga0070716_100269783 3300006173 Bacteria 1169
52 Ga0075362_10049341 3300006177 Bacteria 1880
53 Ga0075369_10042074 3300006186 Bacteria 1958
54 Ga0075366_10148710 3300006195 Bacteria 1418
55 Ga0075366_10350525 3300006195 Bacteria 906
56 Ga0075370_10038571 3300006353 Bacteria 2689
57 Ga0075370_10039334 3300006353 Bacteria 2664
58 Ga0068871_100314346 3300006358 Bacteria 1378
59 Ga0097620_100025328 3300006931 Bacteria 5952
60 Ga0105251_10000496 3300009011 Bacteria 37267
61 Ga0105251_10020135 3300009011 Bacteria 3510
62 Ga0105244_10001367 3300009036 Bacteria 19816
63 Ga0105250_10000304 3300009092 Bacteria 38571
64 Ga0105250_10043658 3300009092 Bacteria 1797
65 Ga0105240_10364276 3300009093 Bacteria 1636
66 Ga0105245_10479012 3300009098 Bacteria 1257
67 Ga0105241_10311724 3300009174 Bacteria 1354
68 Ga0105242_10341036 3300009176 Bacteria 1381
69 Ga0105238_11074810 3300009551 Unclassified 827
70 Ga0105239_10212185 3300010375 Bacteria 2170
71 Ga0157326_1002850 3300012513 Bacteria 1826
72 Ga0157373_10249339 3300013100 Bacteria 1256
73 Ga0157369_10143937 3300013105 Bacteria 2521
74 Ga0163162_10058998 3300013306 Bacteria 3868
75 Ga0163162_10135525 3300013306 Bacteria 2573
76 Ga0163162_10227945 3300013306 Bacteria 1993
77 Ga0157375_10000410 3300013308 Bacteria 38871
78 Ga0157375_10540874 3300013308 Bacteria 1327
79 Ga0182008_10202933 3300014497 Bacteria 1009
80 Ga0157376_10000820 3300014969 Bacteria 20336
81 Ga0182007_10002674 3300015262 Bacteria 8750
82 Ga0163161_10001580 3300017792 Bacteria 16786
83 Ga0213875_10005886 3300021388 Bacteria 6516
84 Ga0209435_101167 3300025206 Bacteria 3592
85 Ga0209674_100078 3300025226 Bacteria 206136
86 Ga0207425_1002988 3300025245 Bacteria 5642
87 Ga0207425_1005499 3300025245 Bacteria 3601
88 Ga0209759_1000087 3300025256 Bacteria 166470
89 Ga0209129_1025065 3300025258 Bacteria 1043
90 Ga0209565_1000036 3300025263 Bacteria 293334
91 Ga0209565_1000856 3300025263 Bacteria 17000
92 Ga0209673_1000008 3300025273 Bacteria 626013
93 Ga0209130_1000042 3300025284 Bacteria 257581
94 Ga0209130_1003226 3300025284 Bacteria 7167
95 Ga0209130_1006376 3300025284 Bacteria 3847
96 Ga0209675_1000106 3300025291 Bacteria 120459
97 Ga0209675_1002057 3300025291 Bacteria 10739
98 Ga0209676_1000007 3300025292 Bacteria 1029371
99 Ga0209025_1005131 3300025294 Bacteria 10861
100 Ga0209025_1005855 3300025294 Bacteria 9829
101 Ga0209025_1008997 3300025294 Bacteria 7052
102 Ga0209025_1013909 3300025294 Bacteria 5010
103 Ga0209564_1000487 3300025295 Bacteria 65983
104 Ga0209564_1002397 3300025295 Bacteria 14971
105 Ga0209564_1011381 3300025295 Bacteria 3993
106 Ga0209758_1007679 3300025297 Bacteria 7255
107 Ga0209050_1000003 3300025298 Bacteria 1609245
108 Ga0209050_1001730 3300025298 Bacteria 21724
109 Ga0209050_1008908 3300025298 Bacteria 5249
110 Ga0209256_1000001 3300025299 Bacteria 2166974
111 Ga0209256_1030916 3300025299 Bacteria 1471
112 Ga0209256_1048008 3300025299 Bacteria 1047
113 Ga0207426_1000004 3300025302 Bacteria 1047900
114 Ga0207426_1000097 3300025302 Bacteria 265930
115 Ga0207426_1005747 3300025302 Bacteria 5585
116 Ga0209051_1000003 3300025303 Bacteria 1609245
117 Ga0209257_1000020 3300025304 Bacteria 773356
118 Ga0209257_1023073 3300025304 Bacteria 2200
119 Ga0207696_1000108 3300025711 Bacteria 157445
120 Ga0207655_1004838 3300025728 Bacteria 9359
121 Ga0207713_1001113 3300025735 Bacteria 22951
122 Ga0207713_1018029 3300025735 Bacteria 3510
123 Ga0207642_10118790 3300025899 Bacteria 1360
124 Ga0207647_10004634 3300025904 Bacteria 10188
125 Ga0207671_10028601 3300025914 Bacteria 4164
126 Ga0207650_10000068 3300025925 Bacteria 139947
127 Ga0207704_10093804 3300025938 Bacteria 1980
128 Ga0207665_10514214 3300025939 Bacteria 926
129 Ga0207641_10226449 3300026088 Bacteria 1736
130 Ga0207648_10596966 3300026089 Bacteria 1017
131 Ga0207676_10190005 3300026095 Bacteria 1806
132 Ga0207683_10537608 3300026121 Bacteria 1080
133 Ga0268265_10026780 3300028380 Bacteria 4105
134 Ga0307515_10000267 3300028794 Bacteria 128554
135 Ga0307515_10000893 3300028794 Bacteria 68669
136 Ga0307515_10001137 3300028794 Bacteria 61003
137 Ga0307515_10004232 3300028794 Bacteria 29810
138 Ga0307511_10129733 3300030521 Bacteria 1523
139 Ga0307511_10171511 3300030521 Bacteria 1191
140 Ga0307512_10002119 3300030522 Bacteria 26050
141 Ga0265328_10097844 3300031239 Bacteria 1086
142 Ga0307513_10000011 3300031456 Bacteria 354929
143 Ga0307513_10000017 3300031456 Bacteria 282386
144 Ga0307513_10009748 3300031456 Bacteria 12130
145 Ga0307513_10060607 3300031456 Bacteria 4011
146 Ga0307513_10188950 3300031456 Bacteria 1914
147 Ga0307509_10023449 3300031507 Bacteria 6927
148 Ga0307408_100050032 3300031548 Bacteria 3003
149 Ga0307508_10012599 3300031616 Bacteria 7735
150 Ga0307508_10193177 3300031616 Bacteria 1637
151 Ga0307514_10000938 3300031649 Bacteria 44333
152 Ga0307516_10000022 3300031730 Bacteria 191854
153 Ga0307516_10031213 3300031730 Bacteria 5371
154 Ga0307516_10165358 3300031730 Bacteria 1958
155 Ga0307516_10400442 3300031730 Bacteria 1032
156 Ga0307405_10000118 3300031731 Bacteria 31782
157 Ga0307406_10011388 3300031901 Bacteria 5046
158 Ga0307407_10113576 3300031903 Bacteria 1705
159 Ga0307412_10000024 3300031911 Bacteria 235467
160 Ga0307414_10241748 3300032004 Bacteria 1495
161 Ga0307507_10014736 3300033179 Bacteria 9287
162 Ga0307510_10026754 3300033180 Bacteria 6621
163 Ga0316212_1001486 3300033547 Bacteria 3196
164 Ga0316582_0008259 3300036647 Bacteria 5585
165 Ga0316584_0090493 3300036712 Bacteria 2291
166 Ga0373925_0031695 3300037068 Bacteria 3887
167 Ga0373925_0285044 3300037068 Bacteria 1331
168 Ga0395899_0027815 3300037312 Bacteria 4260
169 Ga0395900_0016592 3300037418 Bacteria 7511
170 Ga0395898_0025505 3300037466 Bacteria 5956
171 Ga0436364_0371086 3300037853 Bacteria 1595
172 Ga0436364_0913654 3300037853 Bacteria 6078
173 Ga0436364_1184930 3300037853 Bacteria 1327
174 Ga0436364_1517608 3300037853 Bacteria 999
175 Ga0395901_0354882 3300038443 Bacteria 1513
176 Ga0400483_032911 3300039062 Bacteria 2536
177 Ga0400483_116204 3300039062 Bacteria 2907
178 Ga0400483_188487 3300039062 Bacteria 1240
179 Ga0436363_0943576 3300039450 Bacteria 2253
180 Ga0436362_0293187 3300039453 Bacteria 1313
181 Ga0439436_0001860 3300041404 Bacteria 6234
182 Ga0439433_0005285 3300041999 Bacteria 2775
183 Ga0439445_0005292 3300042004 Bacteria 2938
184 Ga0439432_000413 3300042006 Bacteria 15863
185 Ga0439449_0072100 3300042007 Bacteria 1272
186 Ga0439452_009092 3300042010 Bacteria 2949
187 Ga0439463_000040 3300042016 Bacteria 27327
188 Ga0450897_000172 3300042128 Bacteria 3170
189 Ga0450898_000164 3300042134 Bacteria 6890
190 Ga0450899_001344 3300042135 Bacteria 2765
191 Ga0450909_003568 3300042185 Bacteria 2216
192 Ga0439434_0009895 3300042435 Bacteria 2806
193 Ga0495627_002063 3300046453 Bacteria 10243
194 Ga0495592_0037443 3300046454 Bacteria 3652
195 Ga0495591_000691 3300046458 Bacteria 24640
196 Ga0495591_026339 3300046458 Bacteria 1808
197 Ga0495629_0102598 3300046459 Bacteria 1995
198 Ga0495651_0151508 3300046462 Bacteria 1671
199 Ga0495651_0212871 3300046462 Bacteria 1343
200 Ga0495653_0016275 3300046463 Bacteria 6059
201 Ga0495580_0000252 3300046472 Bacteria 42451
202 Ga0495662_0003471 3300046476 Bacteria 7986
203 Ga0495664_0000589 3300046477 Bacteria 18348
204 Ga0495664_0006494 3300046477 Bacteria 6463
205 Ga0495664_0127178 3300046477 Bacteria 1542
206 Ga0495585_0000955 3300046492 Bacteria 24351
207 Ga0495596_0026712 3300046500 Bacteria 2325
208 Ga0495583_0000387 3300046506 Bacteria 67820
209 Ga0495606_0004988 3300046507 Bacteria 12946
210 Ga0495608_0356774 3300046511 Bacteria 899
211 Ga0495610_0005120 3300046512 Bacteria 9424
212 Ga0495610_0005227 3300046512 Bacteria 9290
213 Ga0495610_0043272 3300046512 Bacteria 2245
214 Ga0495620_0003912 3300046515 Bacteria 8493
215 Ga0495628_0003441 3300046516 Bacteria 14175
216 Ga0495628_0015233 3300046516 Bacteria 6423
217 Ga0495630_0014953 3300046517 Bacteria 5660
218 Ga0495631_0002199 3300046518 Bacteria 11231
219 Ga0495632_0003176 3300046519 Bacteria 11845
220 Ga0495637_0007422 3300046520 Bacteria 5430
221 Ga0495643_0015389 3300046522 Bacteria 4522
222 Ga0495648_0012016 3300046524 Bacteria 6487
223 Ga0495666_0110550 3300046526 Bacteria 1291
224 Ga0495652_0048853 3300046529 Bacteria 3624
225 Ga0495654_0000166 3300046530 Bacteria 64935
226 Ga0495654_0019422 3300046530 Bacteria 3554
227 Ga0495654_0023900 3300046530 Bacteria 3161
228 Ga0495665_0020796 3300046531 Bacteria 3525
229 Ga0495640_0039985 3300046533 Bacteria 3287
230 Ga0495640_0094620 3300046533 Bacteria 1968
231 Ga0495587_0002283 3300046536 Bacteria 12843
232 Ga0495645_0015453 3300046543 Bacteria 5428
233 Ga0495645_0039015 3300046543 Bacteria 3464
234 Ga0495622_0143901 3300046557 Bacteria 1081
235 Ga0495633_0047138 3300046558 Bacteria 2037
236 Ga0495656_0000831 3300046615 Bacteria 9943
237 Ga0495656_0002909 3300046615 Bacteria 5737
238 Ga0495634_0002198 3300046642 Bacteria 16380
239 Ga0495634_0032994 3300046642 Bacteria 3559
240 Ga0495635_0000703 3300046663 Bacteria 21566
241 Ga0495661_0000048 3300046665 Bacteria 144678
242 Ga0495661_0000692 3300046665 Bacteria 33517
243 Ga0495661_0004168 3300046665 Bacteria 10511
244 Ga0495657_0026194 3300046675 Bacteria 4130
245 Ga0495599_0092691 3300046678 Bacteria 1885
246 Ga0495599_0191633 3300046678 Bacteria 1257
247 Ga0495623_0004828 3300046679 Bacteria 8842
248 Ga0495646_0003020 3300046680 Bacteria 10427
249 Ga0495646_0009670 3300046680 Bacteria 6119
250 Ga0495658_0011345 3300046683 Bacteria 4480
251 Ga0495613_0000749 3300046689 Bacteria 25488
252 Ga0495624_0160999 3300046690 Bacteria 1371
253 Ga0495589_0003511 3300046794 Bacteria 8481
254 Ga0495600_0014143 3300046809 Bacteria 5027
255 Ga0495581_0020379 3300047315 Bacteria 3848
256 Ga0495604_0001039 3300047317 Bacteria 23112
257 Ga0495604_0010587 3300047317 Bacteria 7312
258 Ga0495674_0011689 3300047319 Bacteria 8282
259 Ga0495674_0099274 3300047319 Bacteria 2479
260 Ga0495672_0005003 3300047320 Bacteria 10608
261 Ga0495672_0017041 3300047320 Bacteria 4867
262 Ga0495676_0003021 3300047321 Bacteria 15207
263 Ga0495680_0009364 3300047322 Bacteria 8817
264 Ga0495687_002006 3300047443 Bacteria 17255
265 Ga0495675_0059507 3300047444 Bacteria 2422
266 Ga0495675_0331512 3300047444 Bacteria 898
267 Ga0495679_000476 3300047446 Bacteria 29039
268 Ga0495679_009641 3300047446 Bacteria 3847
269 Ga0495681_0003824 3300047470 Bacteria 10416
270 Ga0495681_0011383 3300047470 Bacteria 5299
271 Ga0495681_0021708 3300047470 Bacteria 3452
272 Ga0495684_0004019 3300047471 Bacteria 11472
273 Ga0495684_0039605 3300047471 Bacteria 3613
274 Ga0495593_0105346 3300047673 Bacteria 1443
275 Ga0495602_0011546 3300048088 Bacteria 9127
276 Ga0495602_0065518 3300048088 Bacteria 3135
277 Ga0495614_0002572 3300048089 Bacteria 8068
278 Ga0495615_0004134 3300048090 Bacteria 2504
279 Ga0495626_0058183 3300048091 Bacteria 1767
280 Ga0496100_0000020 3300048903 Bacteria 147250
281 Ga0496100_0073494 3300048903 Bacteria 2288
282 Ga0496101_0000045 3300048904 Bacteria 157340
283 Ga0496101_0000051 3300048904 Bacteria 142699
284 Ga0496102_0000032 3300048905 Bacteria 214049
285 Ga0496102_0000223 3300048905 Bacteria 75090
286 Ga0496103_0000027 3300048906 Bacteria 213677
287 Ga0496103_0004481 3300048906 Bacteria 8466
288 Ga0496105_0586110 3300048908 Bacteria 867
289 Ga0496107_0001412 3300048910 Bacteria 14811
290 Ga0496108_0313611 3300048911 Bacteria 1367
291 Ga0496109_0193312 3300048912 Bacteria 1912
292 Ga0496109_0329941 3300048912 Bacteria 1440
293 Ga0496114_0077088 3300048917 Bacteria 2810
294 Ga0496114_0157762 3300048917 Bacteria 1971
295 Ga0496116_0000088 3300048919 Bacteria 213188
296 Ga0496116_0010201 3300048919 Bacteria 7902
297 Ga0496116_0047182 3300048919 Bacteria 2901
298 Ga0496117_0000018 3300048920 Bacteria 479613
299 Ga0496117_0000465 3300048920 Bacteria 67537
300 Ga0496117_0010522 3300048920 Bacteria 8412
301 Ga0496117_0012749 3300048920 Bacteria 7376
302 Ga0496117_0031036 3300048920 Bacteria 4087
303 Ga0496117_0181627 3300048920 Bacteria 1208
304 Ga0496118_0000013 3300048921 Bacteria 574008
305 Ga0496118_0000302 3300048921 Bacteria 85602
306 Ga0496118_0003590 3300048921 Bacteria 19301
307 Ga0496118_0004010 3300048921 Bacteria 17914
308 Ga0496118_0016039 3300048921 Bacteria 6896
309 Ga0496118_0016483 3300048921 Bacteria 6776
310 Ga0496118_0021937 3300048921 Bacteria 5600
311 Ga0496119_0009153 3300048922 Bacteria 8559
312 Ga0496119_0010492 3300048922 Bacteria 7788
313 Ga0496120_0010340 3300048923 Bacteria 6519
314 Ga0496120_0101608 3300048923 Bacteria 1518
315 Ga0496121_0000095 3300048924 Bacteria 209011
316 Ga0496121_0000519 3300048924 Bacteria 73425
317 Ga0496121_0035680 3300048924 Bacteria 4449
318 Ga0496121_0130228 3300048924 Bacteria 1884
319 Ga0496122_0058399 3300048925 Bacteria 2856
320 Ga0496122_0060676 3300048925 Bacteria 2783
321 Ga0496122_0085200 3300048925 Bacteria 2181
322 Ga0496122_0181914 3300048925 Bacteria 1252
323 Ga0496123_0013982 3300048926 Bacteria 6685
324 Ga0496123_0163507 3300048926 Bacteria 1183
325 Ga0496124_0000744 3300048927 Bacteria 53387
326 Ga0496124_0172935 3300048927 Bacteria 1670
327 Ga0496125_0017730 3300048928 Bacteria 6777
328 Ga0496125_0186974 3300048928 Bacteria 1372
329 Ga0496126_0000232 3300048929 Bacteria 120250
330 Ga0496126_0002401 3300048929 Bacteria 25433
331 Ga0496126_0033353 3300048929 Bacteria 4844
332 Ga0501047_0026566 3300049581 Bacteria 5571
333 Ga0501079_0575568 3300049741 Bacteria 886
334 Ga0501044_0148352 3300049823 Bacteria 2329
335 nmdc:mga03683_85478_c1 3300050489 Bacteria 1368
336 nmdc:mga00v17_161360_c1 3300050491 Bacteria 1443
337 nmdc:mga0yw44_32851_c1 3300050492 Bacteria 3027
338 nmdc:mga06z11_533273_c1 3300050494 Bacteria 712
339 nmdc:mga07m45_105770_c1 3300050496 Bacteria 1618
340 nmdc:mga07m45_166325_c1 3300050496 Bacteria 1281
341 nmdc:mga07m45_334_c1 3300050496 Bacteria 19102
342 nmdc:mga0sz30_86325_c1 3300050516 Bacteria 1362
343 Ga0495612_0194285 3300053078 Bacteria 894
344 Ga0500644_0015652 3300053088 Bacteria 2168
345 Ga0500644_0041083 3300053088 Bacteria 1534
346 Ga0500651_0023716 3300053093 Bacteria 3843
347 Ga0500640_014720 3300053095 Bacteria 3261
348 Ga0500593_001771 3300053117 Bacteria 7764
349 Ga0500618_000586 3300053125 Bacteria 22520
350 Ga0500626_197502 3300053128 Bacteria 796
351 Ga0500652_014722 3300053131 Bacteria 2804
352 Ga0500559_0229190 3300053136 Bacteria 876
353 Ga0500600_0029878 3300053149 Bacteria 3213
354 Ga0500604_0030811 3300053151 Bacteria 1571
355 Ga0500624_004057 3300053157 Bacteria 1920
356 Ga0500634_0003858 3300053161 Bacteria 6788
357 Ga0500645_002076 3300053730 Bacteria 9280
358 Ga0500661_008442 3300055283 Bacteria 1895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031507 Ga0307509_10023449 Ga0307509_100234496 213
2 3300031730 Ga0307516_10031213 Ga0307516_100312135 213
3 3300047443 Ga0495687_002006 Ga0495687_002006_13201_13962 213
4 3300009551 Ga0105238_11074810 Ga0105238_110748102 215
5 3300046511 Ga0495608_0356774 Ga0495608_0356774_30_680 215
6 3300053128 Ga0500626_197502 Ga0500626_197502_135_785 215
7 3300050494 nmdc:mga06z11_533273_c1 nmdc:mga06z11_533273_c1_10_693 226
8 3300006173 Ga0070716_100269783 Ga0070716_1002697831 229
9 3300025939 Ga0207665_10514214 Ga0207665_105142141 229
10 3300037068 Ga0373925_0285044 Ga0373925_0285044_195_956 229
11 3300046462 Ga0495651_0151508 Ga0495651_0151508_588_1349 229
12 3300046463 Ga0495653_0016275 Ga0495653_0016275_3856_4617 229
13 3300046477 Ga0495664_0127178 Ga0495664_0127178_407_1168 229
14 3300046533 Ga0495640_0094620 Ga0495640_0094620_1174_1935 229
15 3300046642 Ga0495634_0032994 Ga0495634_0032994_2191_2952 229
16 3300046809 Ga0495600_0014143 Ga0495600_0014143_48_809 229
17 3300047319 Ga0495674_0011689 Ga0495674_0011689_6661_7422 229
18 3300047322 Ga0495680_0009364 Ga0495680_0009364_4144_4905 229
19 3300047471 Ga0495684_0004019 Ga0495684_0004019_7430_8191 229
20 3300005355 Ga0070671_100050248 Ga0070671_1000502482 234
21 3300005466 Ga0070685_10076438 Ga0070685_100764383 234
22 3300005617 Ga0068859_100025328 Ga0068859_1000253283 234
23 3300005618 Ga0068864_100012540 Ga0068864_1000125406 234
24 3300005841 Ga0068863_100208056 Ga0068863_1002080562 234
25 3300006931 Ga0097620_100025328 Ga0097620_1000253286 234
26 3300009098 Ga0105245_10479012 Ga0105245_104790121 234
27 3300009174 Ga0105241_10311724 Ga0105241_103117242 234
28 3300013306 Ga0163162_10058998 Ga0163162_100589984 234
29 3300026088 Ga0207641_10226449 Ga0207641_102264492 234
30 3300026095 Ga0207676_10190005 Ga0207676_101900052 234
31 3300005548 Ga0070665_100031760 Ga0070665_1000317606 237
32 3300005459 Ga0068867_100383866 Ga0068867_1003838662 239
33 3300006358 Ga0068871_100314346 Ga0068871_1003143462 239
34 3300009176 Ga0105242_10341036 Ga0105242_103410362 239
35 3300013306 Ga0163162_10135525 Ga0163162_101355252 239
36 3300013308 Ga0157375_10540874 Ga0157375_105408743 239
37 3300025938 Ga0207704_10093804 Ga0207704_100938041 239
38 3300026121 Ga0207683_10537608 Ga0207683_105376081 239
39 3300042016 Ga0439463_000040 Ga0439463_000040_13984_14754 239
40 3300048917 Ga0496114_0157762 Ga0496114_0157762_103_876 239
41 3300021388 Ga0213875_10005886 Ga0213875_100058865 240
42 3300037853 Ga0436364_0913654 Ga0436364_0913654_3675_4439 240
43 3300028794 Ga0307515_10001137 Ga0307515_1000113731 241
44 3300031456 Ga0307513_10188950 Ga0307513_101889502 241
45 3300039453 Ga0436362_0293187 Ga0436362_0293187_342_1067 241
46 3300048908 Ga0496105_0586110 Ga0496105_0586110_66_821 241
47 3300037312 Ga0395899_0027815 Ga0395899_0027815_524_1297 243
48 3300037466 Ga0395898_0025505 Ga0395898_0025505_4583_5356 243
49 3300037853 Ga0436364_1184930 Ga0436364_1184930_513_1289 244
50 3300039062 Ga0400483_032911 Ga0400483_032911_1478_2230 244
51 3300039062 Ga0400483_188487 Ga0400483_188487_146_898 244
52 3300006177 Ga0075362_10049341 Ga0075362_100493412 246
53 3300005456 Ga0070678_100406491 Ga0070678_1004064911 247
54 3300037418 Ga0395900_0016592 Ga0395900_0016592_4947_5720 248
55 iso_pu_bacteria 3005710791 3005716894 248
56 3300002067 JGI24735J21928_10034391 JGI24735J21928_100343911 249
57 3300006186 Ga0075369_10042074 Ga0075369_100420743 249
58 3300025914 Ga0207671_10028601 Ga0207671_100286012 249
59 3300031616 Ga0307508_10193177 Ga0307508_101931771 249
60 3300031730 Ga0307516_10000022 Ga0307516_10000022159 249
61 3300049581 Ga0501047_0026566 Ga0501047_0026566_3962_4753 249
62 3300049823 Ga0501044_0148352 Ga0501044_0148352_94_885 249
63 3300050516 nmdc:mga0sz30_86325_c1 nmdc:mga0sz30_86325_c1_343_1101 249
64 3300003322 rootL2_10205537 rootL2_102055371 250
65 3300010375 Ga0105239_10212185 Ga0105239_102121853 250
66 3300028794 Ga0307515_10004232 Ga0307515_100042323 250
67 3300030521 Ga0307511_10129733 Ga0307511_101297332 250
68 3300030522 Ga0307512_10002119 Ga0307512_100021197 250
69 3300031456 Ga0307513_10009748 Ga0307513_1000974814 250
70 3300031616 Ga0307508_10012599 Ga0307508_100125998 250
71 3300031730 Ga0307516_10400442 Ga0307516_104004421 250
72 3300033179 Ga0307507_10014736 Ga0307507_100147366 250
73 3300033180 Ga0307510_10026754 Ga0307510_100267544 250
74 3300033547 Ga0316212_1001486 Ga0316212_10014862 250
75 3300046454 Ga0495592_0037443 Ga0495592_0037443_2637_3398 250
76 3300046459 Ga0495629_0102598 Ga0495629_0102598_213_974 250
77 3300046462 Ga0495651_0212871 Ga0495651_0212871_201_962 250
78 3300046476 Ga0495662_0003471 Ga0495662_0003471_2706_3467 250
79 3300046477 Ga0495664_0000589 Ga0495664_0000589_3373_4134 250
80 3300046516 Ga0495628_0015233 Ga0495628_0015233_2339_3100 250
81 3300046517 Ga0495630_0014953 Ga0495630_0014953_388_1149 250
82 3300046526 Ga0495666_0110550 Ga0495666_0110550_77_838 250
83 3300046529 Ga0495652_0048853 Ga0495652_0048853_2702_3463 250
84 3300046533 Ga0495640_0039985 Ga0495640_0039985_488_1249 250
85 3300046536 Ga0495587_0002283 Ga0495587_0002283_3805_4566 250
86 3300046543 Ga0495645_0039015 Ga0495645_0039015_162_923 250
87 3300046557 Ga0495622_0143901 Ga0495622_0143901_38_799 250
88 3300046642 Ga0495634_0002198 Ga0495634_0002198_1266_2027 250
89 3300046663 Ga0495635_0000703 Ga0495635_0000703_19784_20545 250
90 3300046675 Ga0495657_0026194 Ga0495657_0026194_352_1113 250
91 3300046678 Ga0495599_0092691 Ga0495599_0092691_1052_1813 250
92 3300046680 Ga0495646_0003020 Ga0495646_0003020_9147_9908 250
93 3300046683 Ga0495658_0011345 Ga0495658_0011345_674_1435 250
94 3300046689 Ga0495613_0000749 Ga0495613_0000749_12287_13048 250
95 3300046690 Ga0495624_0160999 Ga0495624_0160999_327_1088 250
96 3300047315 Ga0495581_0020379 Ga0495581_0020379_381_1142 250
97 3300047317 Ga0495604_0010587 Ga0495604_0010587_480_1241 250
98 3300047321 Ga0495676_0003021 Ga0495676_0003021_278_1039 250
99 3300047444 Ga0495675_0331512 Ga0495675_0331512_83_844 250
100 3300047471 Ga0495684_0039605 Ga0495684_0039605_2754_3515 250
101 3300047673 Ga0495593_0105346 Ga0495593_0105346_657_1418 250
102 3300048088 Ga0495602_0065518 Ga0495602_0065518_2327_3088 250
103 3300048089 Ga0495614_0002572 Ga0495614_0002572_658_1419 250
104 3300048903 Ga0496100_0073494 Ga0496100_0073494_447_1208 250
105 3300048904 Ga0496101_0000051 Ga0496101_0000051_99118_99879 250
106 3300048905 Ga0496102_0000032 Ga0496102_0000032_42227_42988 250
107 3300048906 Ga0496103_0000027 Ga0496103_0000027_42596_43357 250
108 3300048910 Ga0496107_0001412 Ga0496107_0001412_13594_14355 250
109 3300048919 Ga0496116_0000088 Ga0496116_0000088_42250_43011 250
110 3300048920 Ga0496117_0000018 Ga0496117_0000018_263698_264459 250
111 3300048921 Ga0496118_0000013 Ga0496118_0000013_215155_215916 250
112 3300048922 Ga0496119_0009153 Ga0496119_0009153_558_1319 250
113 3300048924 Ga0496121_0000095 Ga0496121_0000095_166299_167060 250
114 3300053078 Ga0495612_0194285 Ga0495612_0194285_101_862 250
115 3300053088 Ga0500644_0041083 Ga0500644_0041083_386_1162 250
116 3300053093 Ga0500651_0023716 Ga0500651_0023716_629_1405 250
117 3300053095 Ga0500640_014720 Ga0500640_014720_2301_3062 250
118 3300053131 Ga0500652_014722 Ga0500652_014722_1208_1984 250
119 3300053149 Ga0500600_0029878 Ga0500600_0029878_283_1056 250
120 3300053157 Ga0500624_004057 Ga0500624_004057_340_1101 250
121 3300046477 Ga0495664_0006494 Ga0495664_0006494_257_1012 251
122 3300046516 Ga0495628_0003441 Ga0495628_0003441_10098_10853 251
123 3300046531 Ga0495665_0020796 Ga0495665_0020796_2416_3171 251
124 3300046543 Ga0495645_0015453 Ga0495645_0015453_1041_1796 251
125 3300046678 Ga0495599_0191633 Ga0495599_0191633_374_1129 251
126 3300046679 Ga0495623_0004828 Ga0495623_0004828_7960_8715 251
127 3300046680 Ga0495646_0009670 Ga0495646_0009670_2569_3324 251
128 3300047317 Ga0495604_0001039 Ga0495604_0001039_14198_14953 251
129 3300047319 Ga0495674_0099274 Ga0495674_0099274_618_1373 251
130 3300047320 Ga0495672_0005003 Ga0495672_0005003_6217_6972 251
131 3300048088 Ga0495602_0011546 Ga0495602_0011546_8178_8933 251
132 iso_pu_bacteria 2894772417 2894775305 251
133 3300005578 Ga0068854_100350056 Ga0068854_1003500562 253
134 3300006058 Ga0075432_10125754 Ga0075432_101257541 253
135 3300039062 Ga0400483_116204 Ga0400483_116204_1504_2268 253
136 iso_pu_bacteria 2599185288 2599878052 253
137 iso_pu_bacteria 2599185303 2599947264 253
138 iso_pu_bacteria 2738541294 2738809965 253
139 iso_pu_bacteria 2738541309 2738897325 253
140 iso_pu_bacteria 2808606385 2808977068 253
141 iso_pu_bacteria 2808606388 2808992223 253
142 iso_pu_bacteria 2818991450 2819622515 253
143 iso_pu_bacteria 2852612431 2852613598 253
144 iso_pu_bacteria 2852667396 2852668666 253
145 iso_pu_bacteria 2885192300 2885196551 253
146 iso_pu_bacteria 2885270888 2885272834 253
147 iso_pu_bacteria 2900634093 2900639985 253
148 iso_pu_bacteria 2908446538 2908450593 253
149 iso_pu_bacteria 2921643360 2921645943 253
150 iso_pu_bacteria 2928108538 2928111928 253
151 iso_pu_bacteria 2928135762 2928139167 253
152 iso_pu_bacteria 2928503688 2928508871 253
153 iso_pu_bacteria 2945961074 2945964642 253
154 iso_pu_bacteria 2946006987 2946008904 253
155 iso_pu_bacteria 8054503363 8054507117 253
156 iso_pu_bacteria 8056131705 8056135555 253
157 3300005436 Ga0070713_100401201 Ga0070713_1004012012 254
158 3300002987 JGI25159J45721_1000587 JGI25159J45721_10005875 255
159 3300002987 JGI25159J45721_1003433 JGI25159J45721_10034335 255
160 3300003187 JGI25151J46595_10005197 JGI25151J46595_100051975 255
161 3300003187 JGI25151J46595_10011161 JGI25151J46595_100111614 255
162 3300003187 JGI25151J46595_10019106 JGI25151J46595_100191062 255
163 3300003354 JGI25160J50197_1000158 JGI25160J50197_100015817 255
164 3300003374 JGI25161J50226_1000040 JGI25161J50226_100004060 255
165 3300003771 Ga0055526_1009555 Ga0055526_10095552 255
166 3300003771 Ga0055526_1009619 Ga0055526_10096195 255
167 3300003771 Ga0055526_1044902 Ga0055526_10449021 255
168 3300003773 Ga0055537_1001181 Ga0055537_10011815 255
169 3300003775 Ga0055524_1000077 Ga0055524_100007757 255
170 3300003781 Ga0055536_1003606 Ga0055536_10036062 255
171 3300003784 Ga0055534_1002147 Ga0055534_10021477 255
172 3300003790 Ga0055528_1001468 Ga0055528_100146811 255
173 3300003791 Ga0055530_10001468 Ga0055530_1000146811 255
174 3300003791 Ga0055530_10019774 Ga0055530_100197742 255
175 3300003791 Ga0055530_10056504 Ga0055530_100565041 255
176 3300003792 Ga0055540_1000010 Ga0055540_1000010169 255
177 3300003794 Ga0055531_10000405 Ga0055531_1000040541 255
178 3300004625 Ga0055543_1000167 Ga0055543_10001678 255
179 3300005262 Ga0065165_1008033 Ga0065165_10080333 255
180 3300005262 Ga0065165_1050597 Ga0065165_10505971 255
181 3300006195 Ga0075366_10148710 Ga0075366_101487102 255
182 3300006353 Ga0075370_10039334 Ga0075370_100393342 255
183 3300012513 Ga0157326_1002850 Ga0157326_10028502 255
184 3300025245 Ga0207425_1002988 Ga0207425_10029886 255
185 3300025245 Ga0207425_1005499 Ga0207425_10054994 255
186 3300025258 Ga0209129_1025065 Ga0209129_10250651 255
187 3300025263 Ga0209565_1000036 Ga0209565_1000036188 255
188 3300025263 Ga0209565_1000856 Ga0209565_10008564 255
189 3300025273 Ga0209673_1000008 Ga0209673_1000008586 255
190 3300025284 Ga0209130_1000042 Ga0209130_100004260 255
191 3300025284 Ga0209130_1003226 Ga0209130_10032265 255
192 3300025291 Ga0209675_1000106 Ga0209675_100010631 255
193 3300025291 Ga0209675_1002057 Ga0209675_10020577 255
194 3300025292 Ga0209676_1000007 Ga0209676_1000007195 255
195 3300025294 Ga0209025_1005131 Ga0209025_10051317 255
196 3300025294 Ga0209025_1005855 Ga0209025_10058556 255
197 3300025294 Ga0209025_1008997 Ga0209025_10089977 255
198 3300025294 Ga0209025_1013909 Ga0209025_10139095 255
199 3300025295 Ga0209564_1000487 Ga0209564_100048759 255
200 3300025295 Ga0209564_1002397 Ga0209564_10023975 255
201 3300025295 Ga0209564_1011381 Ga0209564_10113812 255
202 3300025297 Ga0209758_1007679 Ga0209758_10076794 255
203 3300025298 Ga0209050_1000003 Ga0209050_10000031313 255
204 3300025298 Ga0209050_1001730 Ga0209050_10017305 255
205 3300025298 Ga0209050_1008908 Ga0209050_10089086 255
206 3300025299 Ga0209256_1000001 Ga0209256_10000011315 255
207 3300025299 Ga0209256_1030916 Ga0209256_10309162 255
208 3300025299 Ga0209256_1048008 Ga0209256_10480082 255
209 3300025302 Ga0207426_1000097 Ga0207426_100009766 255
210 3300025302 Ga0207426_1005747 Ga0207426_10057475 255
211 3300025303 Ga0209051_1000003 Ga0209051_10000031313 255
212 3300025304 Ga0209257_1000020 Ga0209257_1000020195 255
213 3300025304 Ga0209257_1023073 Ga0209257_10230732 255
214 3300031456 Ga0307513_10000011 Ga0307513_10000011253 255
215 3300031548 Ga0307408_100050032 Ga0307408_1000500322 255
216 3300031901 Ga0307406_10011388 Ga0307406_100113884 255
217 3300037068 Ga0373925_0031695 Ga0373925_0031695_1024_1791 255
218 3300037853 Ga0436364_0371086 Ga0436364_0371086_748_1515 255
219 3300038443 Ga0395901_0354882 Ga0395901_0354882_694_1461 255
220 3300049741 Ga0501079_0575568 Ga0501079_0575568_102_869 255
221 3300050489 nmdc:mga03683_85478_c1 nmdc:mga03683_85478_c1_259_1026 255
222 3300050491 nmdc:mga00v17_161360_c1 nmdc:mga00v17_161360_c1_490_1257 255
223 3300050496 nmdc:mga07m45_105770_c1 nmdc:mga07m45_105770_c1_657_1424 255
224 3300053088 Ga0500644_0015652 Ga0500644_0015652_819_1586 255
225 3300053117 Ga0500593_001771 Ga0500593_001771_3957_4724 255
226 3300053136 Ga0500559_0229190 Ga0500559_0229190_20_787 255
227 3300053151 Ga0500604_0030811 Ga0500604_0030811_279_1046 255
228 3300053730 Ga0500645_002076 Ga0500645_002076_5702_6469 255
229 3300055283 Ga0500661_008442 Ga0500661_008442_149_916 255
230 iso_pu_bacteria 2738541296 2738824350 255
231 iso_pu_bacteria 2738541298 2738836719 255
232 iso_pu_bacteria 2738541306 2738878250 255
233 iso_pu_bacteria 2738543002 2739189942 255
234 iso_pu_bacteria 2738543008 2739224843 255
235 iso_pu_bacteria 8055266321 8055273394 255
236 3300005337 Ga0070682_100119635 Ga0070682_1001196352 256
237 3300006038 Ga0075365_10097113 Ga0075365_100971132 256
238 3300006353 Ga0075370_10038571 Ga0075370_100385713 256
239 3300031456 Ga0307513_10000017 Ga0307513_1000001724 256
240 3300031730 Ga0307516_10165358 Ga0307516_101653582 256
241 3300037853 Ga0436364_1517608 Ga0436364_1517608_153_923 256
242 3300039450 Ga0436363_0943576 Ga0436363_0943576_468_1238 256
243 3300050492 nmdc:mga0yw44_32851_c1 nmdc:mga0yw44_32851_c1_1405_2175 256
244 3300050496 nmdc:mga07m45_166325_c1 nmdc:mga07m45_166325_c1_344_1117 256
245 3300050496 nmdc:mga07m45_334_c1 nmdc:mga07m45_334_c1_7547_8317 256
246 3300001989 JGI24739J22299_10000884 JGI24739J22299_100008843 257
247 3300001990 JGI24737J22298_10052676 JGI24737J22298_100526762 257
248 3300002075 JGI24738J21930_10004984 JGI24738J21930_100049842 257
249 3300002705 JGI25156J39149_1001160 JGI25156J39149_10011601 257
250 3300003354 JGI25160J50197_1000062 JGI25160J50197_100006262 257
251 3300003756 Ga0055533_1005296 Ga0055533_10052962 257
252 3300005262 Ga0065165_1000308 Ga0065165_100030824 257
253 3300005331 Ga0070670_100001182 Ga0070670_10000118210 257
254 3300005333 Ga0070677_10029423 Ga0070677_100294233 257
255 3300005459 Ga0068867_100486866 Ga0068867_1004868661 257
256 3300005548 Ga0070665_100712117 Ga0070665_1007121172 257
257 3300005718 Ga0068866_10100762 Ga0068866_101007622 257
258 3300006195 Ga0075366_10350525 Ga0075366_103505251 257
259 3300009011 Ga0105251_10000496 Ga0105251_1000049615 257
260 3300009011 Ga0105251_10020135 Ga0105251_100201353 257
261 3300009036 Ga0105244_10001367 Ga0105244_1000136715 257
262 3300009092 Ga0105250_10000304 Ga0105250_1000030427 257
263 3300009092 Ga0105250_10043658 Ga0105250_100436582 257
264 3300009093 Ga0105240_10364276 Ga0105240_103642762 257
265 3300013100 Ga0157373_10249339 Ga0157373_102493392 257
266 3300013105 Ga0157369_10143937 Ga0157369_101439371 257
267 3300013306 Ga0163162_10227945 Ga0163162_102279452 257
268 3300013308 Ga0157375_10000410 Ga0157375_1000041015 257
269 3300014497 Ga0182008_10202933 Ga0182008_102029331 257
270 3300014969 Ga0157376_10000820 Ga0157376_100008207 257
271 3300015262 Ga0182007_10002674 Ga0182007_100026746 257
272 3300017792 Ga0163161_10001580 Ga0163161_100015804 257
273 3300025206 Ga0209435_101167 Ga0209435_1011675 257
274 3300025226 Ga0209674_100078 Ga0209674_100078136 257
275 3300025256 Ga0209759_1000087 Ga0209759_1000087113 257
276 3300025284 Ga0209130_1006376 Ga0209130_10063762 257
277 3300025302 Ga0207426_1000004 Ga0207426_1000004294 257
278 3300025711 Ga0207696_1000108 Ga0207696_100010826 257
279 3300025728 Ga0207655_1004838 Ga0207655_10048383 257
280 3300025735 Ga0207713_1001113 Ga0207713_100111323 257
281 3300025735 Ga0207713_1018029 Ga0207713_10180292 257
282 3300025899 Ga0207642_10118790 Ga0207642_101187902 257
283 3300025904 Ga0207647_10004634 Ga0207647_100046349 257
284 3300025925 Ga0207650_10000068 Ga0207650_1000006844 257
285 3300026089 Ga0207648_10596966 Ga0207648_105969661 257
286 3300028380 Ga0268265_10026780 Ga0268265_100267803 257
287 3300028794 Ga0307515_10000267 Ga0307515_1000026775 257
288 3300028794 Ga0307515_10000893 Ga0307515_1000089323 257
289 3300030521 Ga0307511_10171511 Ga0307511_101715112 257
290 3300031239 Ga0265328_10097844 Ga0265328_100978441 257
291 3300031456 Ga0307513_10060607 Ga0307513_100606075 257
292 3300031649 Ga0307514_10000938 Ga0307514_1000093815 257
293 3300031731 Ga0307405_10000118 Ga0307405_1000011823 257
294 3300031903 Ga0307407_10113576 Ga0307407_101135761 257
295 3300031911 Ga0307412_10000024 Ga0307412_10000024250 257
296 3300032004 Ga0307414_10241748 Ga0307414_102417482 257
297 3300036647 Ga0316582_0008259 Ga0316582_0008259_2666_3454 257
298 3300036712 Ga0316584_0090493 Ga0316584_0090493_915_1703 257
299 3300041404 Ga0439436_0001860 Ga0439436_0001860_2212_2985 257
300 3300041999 Ga0439433_0005285 Ga0439433_0005285_1335_2108 257
301 3300042004 Ga0439445_0005292 Ga0439445_0005292_1221_1994 257
302 3300042006 Ga0439432_000413 Ga0439432_000413_12576_13349 257
303 3300042007 Ga0439449_0072100 Ga0439449_0072100_246_1019 257
304 3300042010 Ga0439452_009092 Ga0439452_009092_2073_2846 257
305 3300042128 Ga0450897_000172 Ga0450897_000172_565_1338 257
306 3300042134 Ga0450898_000164 Ga0450898_000164_246_1019 257
307 3300042135 Ga0450899_001344 Ga0450899_001344_1187_1960 257
308 3300042185 Ga0450909_003568 Ga0450909_003568_840_1613 257
309 3300042435 Ga0439434_0009895 Ga0439434_0009895_1222_1995 257
310 3300046453 Ga0495627_002063 Ga0495627_002063_1390_2163 257
311 3300046458 Ga0495591_000691 Ga0495591_000691_7888_8661 257
312 3300046458 Ga0495591_026339 Ga0495591_026339_268_1041 257
313 3300046472 Ga0495580_0000252 Ga0495580_0000252_14981_15754 257
314 3300046492 Ga0495585_0000955 Ga0495585_0000955_15493_16266 257
315 3300046500 Ga0495596_0026712 Ga0495596_0026712_375_1154 257
316 3300046506 Ga0495583_0000387 Ga0495583_0000387_13220_13993 257
317 3300046507 Ga0495606_0004988 Ga0495606_0004988_5531_6304 257
318 3300046512 Ga0495610_0005120 Ga0495610_0005120_3839_4612 257
319 3300046512 Ga0495610_0005227 Ga0495610_0005227_7348_8121 257
320 3300046512 Ga0495610_0043272 Ga0495610_0043272_1343_2116 257
321 3300046515 Ga0495620_0003912 Ga0495620_0003912_6422_7195 257
322 3300046518 Ga0495631_0002199 Ga0495631_0002199_9154_9927 257
323 3300046519 Ga0495632_0003176 Ga0495632_0003176_1334_2107 257
324 3300046520 Ga0495637_0007422 Ga0495637_0007422_1354_2127 257
325 3300046522 Ga0495643_0015389 Ga0495643_0015389_1880_2653 257
326 3300046524 Ga0495648_0012016 Ga0495648_0012016_994_1767 257
327 3300046530 Ga0495654_0000166 Ga0495654_0000166_13315_14088 257
328 3300046530 Ga0495654_0019422 Ga0495654_0019422_1636_2409 257
329 3300046530 Ga0495654_0023900 Ga0495654_0023900_1217_1990 257
330 3300046558 Ga0495633_0047138 Ga0495633_0047138_341_1114 257
331 3300046615 Ga0495656_0000831 Ga0495656_0000831_144_917 257
332 3300046615 Ga0495656_0002909 Ga0495656_0002909_4154_4975 257
333 3300046665 Ga0495661_0000048 Ga0495661_0000048_10363_11136 257
334 3300046665 Ga0495661_0000692 Ga0495661_0000692_31244_32017 257
335 3300046665 Ga0495661_0004168 Ga0495661_0004168_1445_2218 257
336 3300046794 Ga0495589_0003511 Ga0495589_0003511_6450_7223 257
337 3300047320 Ga0495672_0017041 Ga0495672_0017041_1732_2505 257
338 3300047444 Ga0495675_0059507 Ga0495675_0059507_622_1455 257
339 3300047446 Ga0495679_000476 Ga0495679_000476_22587_23360 257
340 3300047446 Ga0495679_009641 Ga0495679_009641_1184_1957 257
341 3300047470 Ga0495681_0003824 Ga0495681_0003824_8326_9099 257
342 3300047470 Ga0495681_0011383 Ga0495681_0011383_1340_2113 257
343 3300047470 Ga0495681_0021708 Ga0495681_0021708_1629_2402 257
344 3300048090 Ga0495615_0004134 Ga0495615_0004134_1335_2156 257
345 3300048091 Ga0495626_0058183 Ga0495626_0058183_102_881 257
346 3300048903 Ga0496100_0000020 Ga0496100_0000020_130760_131539 257
347 3300048904 Ga0496101_0000045 Ga0496101_0000045_25809_26588 257
348 3300048905 Ga0496102_0000223 Ga0496102_0000223_14714_15493 257
349 3300048906 Ga0496103_0004481 Ga0496103_0004481_5696_6475 257
350 3300048911 Ga0496108_0313611 Ga0496108_0313611_389_1198 257
351 3300048912 Ga0496109_0193312 Ga0496109_0193312_418_1209 257
352 3300048912 Ga0496109_0329941 Ga0496109_0329941_545_1318 257
353 3300048917 Ga0496114_0077088 Ga0496114_0077088_330_1103 257
354 3300048919 Ga0496116_0010201 Ga0496116_0010201_1374_2147 257
355 3300048919 Ga0496116_0047182 Ga0496116_0047182_1013_1786 257
356 3300048920 Ga0496117_0000465 Ga0496117_0000465_25749_26528 257
357 3300048920 Ga0496117_0010522 Ga0496117_0010522_1227_2000 257
358 3300048920 Ga0496117_0012749 Ga0496117_0012749_6240_7013 257
359 3300048920 Ga0496117_0031036 Ga0496117_0031036_887_1660 257
360 3300048920 Ga0496117_0181627 Ga0496117_0181627_72_845 257
361 3300048921 Ga0496118_0000302 Ga0496118_0000302_59132_59911 257
362 3300048921 Ga0496118_0003590 Ga0496118_0003590_12967_13740 257
363 3300048921 Ga0496118_0004010 Ga0496118_0004010_11309_12082 257
364 3300048921 Ga0496118_0016039 Ga0496118_0016039_364_1137 257
365 3300048921 Ga0496118_0016483 Ga0496118_0016483_5175_5948 257
366 3300048921 Ga0496118_0021937 Ga0496118_0021937_1227_2000 257
367 3300048922 Ga0496119_0010492 Ga0496119_0010492_1189_1962 257
368 3300048923 Ga0496120_0010340 Ga0496120_0010340_586_1359 257
369 3300048923 Ga0496120_0101608 Ga0496120_0101608_356_1135 257
370 3300048924 Ga0496121_0000519 Ga0496121_0000519_13727_14506 257
371 3300048924 Ga0496121_0035680 Ga0496121_0035680_2909_3682 257
372 3300048924 Ga0496121_0130228 Ga0496121_0130228_768_1541 257
373 3300048925 Ga0496122_0058399 Ga0496122_0058399_868_1641 257
374 3300048925 Ga0496122_0060676 Ga0496122_0060676_1570_2349 257
375 3300048925 Ga0496122_0085200 Ga0496122_0085200_1090_1863 257
376 3300048925 Ga0496122_0181914 Ga0496122_0181914_325_1098 257
377 3300048926 Ga0496123_0013982 Ga0496123_0013982_1189_1962 257
378 3300048926 Ga0496123_0163507 Ga0496123_0163507_256_1029 257
379 3300048927 Ga0496124_0000744 Ga0496124_0000744_34901_35674 257
380 3300048927 Ga0496124_0172935 Ga0496124_0172935_795_1568 257
381 3300048928 Ga0496125_0017730 Ga0496125_0017730_5761_6534 257
382 3300048928 Ga0496125_0186974 Ga0496125_0186974_244_1017 257
383 3300048929 Ga0496126_0000232 Ga0496126_0000232_94980_95753 257
384 3300048929 Ga0496126_0002401 Ga0496126_0002401_19164_19937 257
385 3300048929 Ga0496126_0033353 Ga0496126_0033353_1186_1959 257
386 3300053125 Ga0500618_000586 Ga0500618_000586_13878_14672 257
387 3300053161 Ga0500634_0003858 Ga0500634_0003858_4826_5599 257
388 iso_pu_bacteria 2856287931 2856288040 257
389 iso_pu_bacteria 2857357740 2857358338 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

43

237

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

49

284

0.96

PF08659

KR

KR domain

44

217

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g81-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9903 7 257
4ibo-assembly1.cif.gz_C crystal structure of a putative gluconate dehydrogenase from agrobacterium tumefaciens (target efi-506446) 0.987 7 257
4g81-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9787 7 257
5u9p-assembly1.cif.gz_C crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp and tartrate 0.9771 3 257
4ibo-assembly1.cif.gz_C crystal structure of a putative gluconate dehydrogenase from agrobacterium tumefaciens (target efi-506446) 0.9755 7 257
ID Description Score Start End Superfamily
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9897 7 257 3.40.50.720
5u9pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9782 4 257 3.40.50.720
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9781 7 257 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9753 10 253 3.40.50.720
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9731 13 93 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A226X3U2-F1-model_v4 5-keto-D-gluconate 5-reductase 0.9989 1 257 GO:0016491
AF-A0A6A8QJW6-F1-model_v4 SDR family oxidoreductase 0.9978 7 257 GO:0016616
AF-A0A6A5L2G6-F1-model_v4 deleted 0.9968 1 257
AF-A0A4Q1U4F9-F1-model_v4 deleted 0.9955 5 257
AF-A0A4S5BTJ8-F1-model_v4 SDR family oxidoreductase 0.9954 7 257 GO:0016616

Feature Viewer

pLDDT pTM Quality
95.93 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map