F431685

General Info

Members Datasets Scaffolds Average Seq Length
390 205 780 336

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100296396|Ga0068858_1002963961
Length 385
Sequence MGRGVSSAGETSMSNPGVLRERTPNSRQASLTAGRHDAVLLDDRSDQSTGAIGGSVPPFAPRPSWRGGHAQTIYGWANPRYFPRLPAPTPRYFDVDRDARVLAHCHWQPRPWEHATMLALHGLNGSSDAHYMRGIAAKAFARGMSVVRLNQRNCGDTEHLSAGLFHSGLTADVRRVVEELIGVDGLPAIAVAGYSLGGNLALKLAGEYASQPPPALSAVCAVSPIIEISQCVRALEQPGNWLYQWNFVKDLKRRMRRKERFWPGLFDLSQLNRIKTVREFDEAYTAPYFGFAGAEDYYHRASSMRVVDRIRVPALIITAEDDPFVPAAPFHDPRVSTNPNVAVFVCEHGGHCGFVGPSAGEDDGYWAENQIVAFAEEHGTPHFEV

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
123 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
124 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 14.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100296396 3300005842 Bacteria 1542
2 JGI25406J46586_10000077 3300003203 Bacteria 44105
3 Ga0065704_10087175 3300005289 Bacteria 3049
4 Ga0065704_10103809 3300005289 Bacteria 2161
5 Ga0065715_10092649 3300005293 Bacteria 5004
6 Ga0065715_10193739 3300005293 Unclassified 1400
7 Ga0065707_10004395 3300005295 Bacteria 6260
8 Ga0065707_10005626 3300005295 Bacteria 3044
9 Ga0065707_10007479 3300005295 Bacteria 3222
10 Ga0065707_10114730 3300005295 Bacteria 2287
11 Ga0070658_10091507 3300005327 Bacteria 2507
12 Ga0070683_100282624 3300005329 Bacteria 1578
13 Ga0070690_100035410 3300005330 Bacteria 3133
14 Ga0070690_100066180 3300005330 Bacteria 2338
15 Ga0070690_100070810 3300005330 Bacteria 2265
16 Ga0070670_100060643 3300005331 Unclassified 3248
17 Ga0070670_100069273 3300005331 Bacteria 3028
18 Ga0068869_100096729 3300005334 Bacteria 2229
19 Ga0070666_10125367 3300005335 Bacteria 1783
20 Ga0070666_10242131 3300005335 Bacteria 1276
21 Ga0068868_100387760 3300005338 Bacteria 1203
22 Ga0070689_100016365 3300005340 Bacteria 5427
23 Ga0070689_100129350 3300005340 Bacteria 2024
24 Ga0070687_100098994 3300005343 Bacteria 1629
25 Ga0070692_10027240 3300005345 Bacteria 2831
26 Ga0070668_100057317 3300005347 Bacteria 3010
27 Ga0070669_100014861 3300005353 Bacteria 5547
28 Ga0070669_100135071 3300005353 Bacteria 1897
29 Ga0070675_100000033 3300005354 Bacteria 94281
30 Ga0070675_100009814 3300005354 Bacteria 7460
31 Ga0070675_100038478 3300005354 Unclassified 3898
32 Ga0070675_100053276 3300005354 Bacteria 3327
33 Ga0070675_100062379 3300005354 Bacteria 3080
34 Ga0070671_100092616 3300005355 Bacteria 2532
35 Ga0070673_100032071 3300005364 Bacteria 3951
36 Ga0070673_100121652 3300005364 Bacteria 2178
37 Ga0070688_100004224 3300005365 Bacteria 7465
38 Ga0070659_100069761 3300005366 Bacteria 2791
39 Ga0070667_100138618 3300005367 Unclassified 2128
40 Ga0070713_100044218 3300005436 Bacteria 3645
41 Ga0070711_100179126 3300005439 Bacteria 1622
42 Ga0070700_100130261 3300005441 Bacteria 1697
43 Ga0070694_100006230 3300005444 Bacteria 7241
44 Ga0070694_100014616 3300005444 Bacteria 4916
45 Ga0070708_100085251 3300005445 Bacteria 2867
46 Ga0070678_100049780 3300005456 Bacteria 3026
47 Ga0070678_100121567 3300005456 Bacteria 2060
48 Ga0070681_10069683 3300005458 Bacteria 3483
49 Ga0068867_100008404 3300005459 Bacteria 7280
50 Ga0068867_100012312 3300005459 Bacteria 6050
51 Ga0070706_100395971 3300005467 Bacteria 1286
52 Ga0070707_100002485 3300005468 Bacteria 17581
53 Ga0070707_100216582 3300005468 Unclassified 1866
54 Ga0070699_100002664 3300005518 Bacteria 15952
55 Ga0070699_100150265 3300005518 Bacteria 2060
56 Ga0070672_100045267 3300005543 Bacteria 3402
57 Ga0070686_100000363 3300005544 Bacteria 28989
58 Ga0070686_100006803 3300005544 Bacteria 6367
59 Ga0070686_100020530 3300005544 Unclassified 3910
60 Ga0070696_100101307 3300005546 Bacteria 2064
61 Ga0070665_100174625 3300005548 Unclassified 2149
62 Ga0070704_100000343 3300005549 Bacteria 21179
63 Ga0070704_100004424 3300005549 Bacteria 8118
64 Ga0070704_100037551 3300005549 Unclassified 3310
65 Ga0070664_100158099 3300005564 Bacteria 2004
66 Ga0068857_100019447 3300005577 Bacteria 5963
67 Ga0068857_100149854 3300005577 Bacteria 2113
68 Ga0068852_100159164 3300005616 Bacteria 2107
69 Ga0068859_100029471 3300005617 Bacteria 5506
70 Ga0068859_100044218 3300005617 Unclassified 4475
71 Ga0068859_100284350 3300005617 Bacteria 1747
72 Ga0068864_100015236 3300005618 Bacteria 6395
73 Ga0068864_100240912 3300005618 Bacteria 1676
74 Ga0068861_100013484 3300005719 Bacteria 5722
75 Ga0068861_100229125 3300005719 Bacteria 1575
76 Ga0068870_10009944 3300005840 Bacteria 4346
77 Ga0068870_10027287 3300005840 Bacteria 2854
78 Ga0068863_100082279 3300005841 Bacteria 3050
79 Ga0068858_100013659 3300005842 Bacteria 7664
80 Ga0068858_100042767 3300005842 Unclassified 4201
81 Ga0068858_100100169 3300005842 Unclassified 2702
82 Ga0068858_100273650 3300005842 Bacteria 1607
83 Ga0068858_100346350 3300005842 Bacteria 1423
84 Ga0068860_100013716 3300005843 Bacteria 7947
85 Ga0068860_100162603 3300005843 Bacteria 2153
86 Ga0068860_100166391 3300005843 Bacteria 2129
87 Ga0068862_100274796 3300005844 Bacteria 1542
88 Ga0081539_10000084 3300005985 Bacteria 218801
89 Ga0070715_10049476 3300006163 Bacteria 1801
90 Ga0097621_100005930 3300006237 Bacteria 8634
91 Ga0097621_100022491 3300006237 Unclassified 4894
92 Ga0097621_100031254 3300006237 Bacteria 4224
93 Ga0097621_100039615 3300006237 Bacteria 3786
94 Ga0068871_100008528 3300006358 Bacteria 7367
95 Ga0068871_100025970 3300006358 Bacteria 4564
96 Ga0068871_100115363 3300006358 Unclassified 2264
97 Ga0068871_100158327 3300006358 Bacteria 1935
98 Ga0068871_100236532 3300006358 Unclassified 1587
99 Ga0075428_100000377 3300006844 Bacteria 44160
100 Ga0075428_100001067 3300006844 Bacteria 29125
101 Ga0075428_100014912 3300006844 Bacteria 8635
102 Ga0075431_100014680 3300006847 Bacteria 7927
103 Ga0075431_100036823 3300006847 Bacteria 5040
104 Ga0075431_100084085 3300006847 Bacteria 3285
105 Ga0075433_10008275 3300006852 Bacteria 8289
106 Ga0075433_10008753 3300006852 Bacteria 8075
107 Ga0075433_10015960 3300006852 Bacteria 6176
108 Ga0075433_10106860 3300006852 Bacteria 2481
109 Ga0075433_10109468 3300006852 Unclassified 2451
110 Ga0075434_100000517 3300006871 Bacteria 29347
111 Ga0075434_100000695 3300006871 Bacteria 26301
112 Ga0075434_100022622 3300006871 Bacteria 6120
113 Ga0075434_100075321 3300006871 Bacteria 3368
114 Ga0075434_100105070 3300006871 Bacteria 2834
115 Ga0075434_100130336 3300006871 Bacteria 2533
116 Ga0075429_100107617 3300006880 Unclassified 2436
117 Ga0075429_100139907 3300006880 Unclassified 2119
118 Ga0075429_100173377 3300006880 Bacteria 1890
119 Ga0068865_100147676 3300006881 Bacteria 1780
120 Ga0075436_100001193 3300006914 Bacteria 17647
121 Ga0075436_100025324 3300006914 Bacteria 4083
122 Ga0075436_100062804 3300006914 Bacteria 2567
123 Ga0097620_100029472 3300006931 Bacteria 5506
124 Ga0097620_100044218 3300006931 Unclassified 4475
125 Ga0097620_100076413 3300006931 Bacteria 3390
126 Ga0097620_100284310 3300006931 Bacteria 1747
127 Ga0075435_100000412 3300007076 Bacteria 26301
128 Ga0075435_100001904 3300007076 Bacteria 13584
129 Ga0075435_100003605 3300007076 Bacteria 10528
130 Ga0075435_100010459 3300007076 Bacteria 6789
131 Ga0105240_10099911 3300009093 Bacteria 3531
132 Ga0111539_10003861 3300009094 Bacteria 19727
133 Ga0111539_10004971 3300009094 Bacteria 17302
134 Ga0111539_10006316 3300009094 Bacteria 15282
135 Ga0111539_10012848 3300009094 Bacteria 10479
136 Ga0111539_10432785 3300009094 Unclassified 1532
137 Ga0111539_10712180 3300009094 Unclassified 1168
138 Ga0105245_10195774 3300009098 Bacteria 1939
139 Ga0105245_10294777 3300009098 Bacteria 1590
140 Ga0105247_10015914 3300009101 Bacteria 4504
141 Ga0114129_10000090 3300009147 Bacteria 86472
142 Ga0114129_10003363 3300009147 Bacteria 22462
143 Ga0114129_10003850 3300009147 Bacteria 21164
144 Ga0114129_10006520 3300009147 Bacteria 16561
145 Ga0114129_10020738 3300009147 Bacteria 9338
146 Ga0114129_10035385 3300009147 Bacteria 7054
147 Ga0114129_10041499 3300009147 Bacteria 6483
148 Ga0114129_10485317 3300009147 Bacteria 1616
149 Ga0114129_10607538 3300009147 Bacteria 1416
150 Ga0105242_10015227 3300009176 Bacteria 5973
151 Ga0105242_10029805 3300009176 Bacteria 4354
152 Ga0105242_10071664 3300009176 Bacteria 2876
153 Ga0105242_10367148 3300009176 Unclassified 1334
154 Ga0105248_10001321 3300009177 Bacteria 27614
155 Ga0105248_10040880 3300009177 Bacteria 5198
156 Ga0105248_10054423 3300009177 Bacteria 4487
157 Ga0105248_10097267 3300009177 Bacteria 3316
158 Ga0105248_10201652 3300009177 Bacteria 2241
159 Ga0105238_10037278 3300009551 Bacteria 4943
160 Ga0105249_10020110 3300009553 Bacteria 5964
161 Ga0105249_10517517 3300009553 Unclassified 1240
162 Ga0157378_10010594 3300013297 Bacteria 8057
163 Ga0163162_10099648 3300013306 Bacteria 2997
164 Ga0157375_10008508 3300013308 Bacteria 8986
165 Ga0157375_10045665 3300013308 Bacteria 4265
166 Ga0157375_10154305 3300013308 Unclassified 2434
167 Ga0163163_10013756 3300014325 Bacteria 7417
168 Ga0157380_10002598 3300014326 Bacteria 12209
169 Ga0157380_10049575 3300014326 Bacteria 3313
170 Ga0157377_10005454 3300014745 Bacteria 5979
171 Ga0157377_10029070 3300014745 Bacteria 2981
172 Ga0157377_10046054 3300014745 Unclassified 2438
173 Ga0157379_10008763 3300014968 Bacteria 8820
174 Ga0157376_10002917 3300014969 Bacteria 11729
175 Ga0207682_10038109 3300025893 Bacteria 1949
176 Ga0207688_10132623 3300025901 Unclassified 1461
177 Ga0207680_10100446 3300025903 Bacteria 1858
178 Ga0207647_10087743 3300025904 Bacteria 1858
179 Ga0207645_10057914 3300025907 Bacteria 2474
180 Ga0207643_10004297 3300025908 Bacteria 7660
181 Ga0207643_10125660 3300025908 Bacteria 1522
182 Ga0207663_10144612 3300025916 Bacteria 1661
183 Ga0207662_10013874 3300025918 Bacteria 4510
184 Ga0207662_10028275 3300025918 Bacteria 3240
185 Ga0207662_10034225 3300025918 Bacteria 2965
186 Ga0207662_10072160 3300025918 Bacteria 2092
187 Ga0207662_10107778 3300025918 Unclassified 1733
188 Ga0207657_10005038 3300025919 Bacteria 13860
189 Ga0207646_10009636 3300025922 Bacteria 9527
190 Ga0207681_10014764 3300025923 Bacteria 4862
191 Ga0207650_10168552 3300025925 Bacteria 1739
192 Ga0207659_10002642 3300025926 Bacteria 10672
193 Ga0207659_10002974 3300025926 Bacteria 10094
194 Ga0207659_10005355 3300025926 Bacteria 7774
195 Ga0207659_10044163 3300025926 Bacteria 3135
196 Ga0207659_10050763 3300025926 Bacteria 2948
197 Ga0207659_10180045 3300025926 Bacteria 1674
198 Ga0207659_10219679 3300025926 Unclassified 1527
199 Ga0207687_10006898 3300025927 Bacteria 7483
200 Ga0207700_10467231 3300025928 Unclassified 1114
201 Ga0207706_10160906 3300025933 Bacteria 1973
202 Ga0207706_10240411 3300025933 Bacteria 1583
203 Ga0207709_10016553 3300025935 Bacteria 4100
204 Ga0207670_10074657 3300025936 Unclassified 2355
205 Ga0207669_10000046 3300025937 Bacteria 62654
206 Ga0207669_10220929 3300025937 Bacteria 1390
207 Ga0207704_10012469 3300025938 Bacteria 4218
208 Ga0207704_10040513 3300025938 Bacteria 2724
209 Ga0207704_10118861 3300025938 Bacteria 1804
210 Ga0207704_10145148 3300025938 Bacteria 1666
211 Ga0207691_10026097 3300025940 Bacteria 5483
212 Ga0207691_10049304 3300025940 Bacteria 3857
213 Ga0207691_10080773 3300025940 Bacteria 2924
214 Ga0207691_10177394 3300025940 Bacteria 1863
215 Ga0207711_10013025 3300025941 Bacteria 6907
216 Ga0207711_10040569 3300025941 Bacteria 3960
217 Ga0207711_10093493 3300025941 Bacteria 2648
218 Ga0207711_10141085 3300025941 Bacteria 2168
219 Ga0207711_10316018 3300025941 Unclassified 1442
220 Ga0207689_10065632 3300025942 Bacteria 2985
221 Ga0207651_10034395 3300025960 Bacteria 3282
222 Ga0207651_10044745 3300025960 Bacteria 2965
223 Ga0207651_10135297 3300025960 Bacteria 1894
224 Ga0207712_10039569 3300025961 Bacteria 3231
225 Ga0207668_10052933 3300025972 Bacteria 2811
226 Ga0207668_10468532 3300025972 Unclassified 1078
227 Ga0207640_10076173 3300025981 Bacteria 2276
228 Ga0207677_10035395 3300026023 Bacteria 3243
229 Ga0207703_10004570 3300026035 Bacteria 11347
230 Ga0207703_10047683 3300026035 Bacteria 3455
231 Ga0207703_10252161 3300026035 Bacteria 1591
232 Ga0207703_10275776 3300026035 Bacteria 1525
233 Ga0207639_10255645 3300026041 Bacteria 1530
234 Ga0207708_10020881 3300026075 Bacteria 4941
235 Ga0207708_10061434 3300026075 Bacteria 2869
236 Ga0207708_10074659 3300026075 Bacteria 2599
237 Ga0207708_10150586 3300026075 Bacteria 1831
238 Ga0207648_10000198 3300026089 Bacteria 63567
239 Ga0207648_10011684 3300026089 Bacteria 8264
240 Ga0207648_10064192 3300026089 Bacteria 3200
241 Ga0207676_10011358 3300026095 Bacteria 6366
242 Ga0207676_10215016 3300026095 Bacteria 1708
243 Ga0207674_10031401 3300026116 Bacteria 5581
244 Ga0207674_10035287 3300026116 Bacteria 5221
245 Ga0207675_100001270 3300026118 Bacteria 25243
246 Ga0207675_100096467 3300026118 Bacteria 2784
247 Ga0207675_100453420 3300026118 Bacteria 1271
248 Ga0207683_10071473 3300026121 Bacteria 3068
249 Ga0207683_10105925 3300026121 Bacteria 2514
250 Ga0207683_10227765 3300026121 Bacteria 1699
251 Ga0207428_10000510 3300027907 Bacteria 46433
252 Ga0207428_10003032 3300027907 Bacteria 16532
253 Ga0207428_10005577 3300027907 Bacteria 11704
254 Ga0268266_10050939 3300028379 Bacteria 3553
255 Ga0268265_10000767 3300028380 Bacteria 31011
256 Ga0268265_10544577 3300028380 Unclassified 1101
257 Ga0268264_10031284 3300028381 Bacteria 4364
258 Ga0268264_10153788 3300028381 Bacteria 2065
259 Ga0268264_10176673 3300028381 Bacteria 1936
260 Ga0307408_100012392 3300031548 Bacteria 5647
261 Ga0307408_100365081 3300031548 Unclassified 1229
262 Ga0307405_10004140 3300031731 Bacteria 6817
263 Ga0373928_0011669 3300035084 Bacteria 1743
264 Ga0373929_0004444 3300035085 Bacteria 2513
265 Ga0373949_0005520 3300035090 Bacteria 2820
266 Ga0373951_0000350 3300035091 Bacteria 13996
267 Ga0373952_0000159 3300035092 Bacteria 10101
268 Ga0373932_0000291 3300035112 Bacteria 15116
269 Ga0373936_0044953 3300035113 Bacteria 1778
270 Ga0373939_0002439 3300035114 Bacteria 4384
271 Ga0373943_0005046 3300035170 Bacteria 5954
272 Ga0373946_0010714 3300035171 Bacteria 3403
273 Ga0373955_0074657 3300035172 Bacteria 1904
274 Ga0373961_0003010 3300035241 Bacteria 4251
275 Ga0373962_0006350 3300035242 Bacteria 2862
276 Ga0373924_0003722 3300035410 Bacteria 5268
277 Ga0373931_0001090 3300035691 Bacteria 11504
278 Ga0373931_0063290 3300035691 Bacteria 1999
279 Ga0373935_0008442 3300035692 Bacteria 6164
280 Ga0373933_0033132 3300035724 Bacteria 3004
281 Ga0373937_0293549 3300036401 Bacteria 1536
282 Ga0373937_0670328 3300036401 Bacteria 983
283 Ga0373925_0092078 3300037068 Bacteria 2319
284 Ga0373925_0118612 3300037068 Unclassified 2052
285 Ga0373925_0315693 3300037068 Bacteria 1264
286 Ga0439462_0008368 3300042015 Bacteria 2606
287 Ga0439435_0007420 3300042436 Bacteria 2508
288 Ga0451576_0021557 3300045051 Bacteria 7003
289 Ga0451576_0022636 3300045051 Bacteria 6810
290 Ga0451576_0141487 3300045051 Bacteria 2508
291 Ga0451576_0218652 3300045051 Unclassified 1989
292 Ga0495592_0184077 3300046454 Unclassified 1420
293 Ga0495603_0048777 3300046455 Bacteria 2521
294 Ga0495629_0014576 3300046459 Bacteria 5657
295 Ga0495651_0168812 3300046462 Unclassified 1560
296 Ga0495580_0267150 3300046472 Bacteria 1169
297 Ga0495608_0010425 3300046511 Bacteria 6486
298 Ga0495608_0087720 3300046511 Bacteria 2015
299 Ga0495628_0057983 3300046516 Bacteria 3045
300 Ga0495628_0082639 3300046516 Bacteria 2495
301 Ga0495630_0256341 3300046517 Unclassified 1336
302 Ga0495640_0098741 3300046533 Bacteria 1919
303 Ga0495640_0166502 3300046533 Unclassified 1410
304 Ga0495586_0202885 3300046535 Bacteria 1124
305 Ga0495598_0015916 3300046537 Bacteria 1908
306 Ga0495667_0023481 3300046559 Bacteria 4155
307 Ga0495656_0097495 3300046615 Unclassified 1354
308 Ga0495634_0182256 3300046642 Unclassified 1314
309 Ga0495659_0021739 3300046664 Bacteria 2164
310 Ga0495646_0096316 3300046680 Unclassified 1702
311 Ga0495647_0093864 3300046681 Unclassified 1234
312 Ga0495658_0106891 3300046683 Unclassified 1678
313 Ga0495669_0043631 3300046684 Bacteria 1997
314 Ga0495613_0007772 3300046689 Bacteria 7978
315 Ga0495604_0049539 3300047317 Bacteria 3263
316 Ga0495676_0142163 3300047321 Bacteria 1718
317 Ga0496100_0019511 3300048903 Bacteria 4047
318 Ga0496101_0052043 3300048904 Bacteria 2951
319 Ga0496104_0325663 3300048907 Bacteria 1450
320 Ga0496104_0597795 3300048907 Bacteria 1013
321 Ga0496105_0061841 3300048908 Bacteria 3090
322 Ga0496114_0006566 3300048917 Bacteria 9173
323 Ga0496114_0396768 3300048917 Bacteria 1222
324 Ga0496115_0035397 3300048918 Bacteria 3950
325 Ga0501033_0056634 3300049570 Bacteria 2897
326 Ga0501034_0034540 3300049571 Bacteria 5127
327 Ga0501038_0126198 3300049574 Unclassified 2106
328 Ga0501040_0051811 3300049576 Bacteria 2808
329 Ga0501041_0020280 3300049577 Bacteria 3973
330 Ga0501042_0005015 3300049578 Bacteria 8482
331 Ga0501046_0079722 3300049580 Bacteria 2531
332 Ga0501047_0088726 3300049581 Bacteria 2969
333 Ga0501048_0038707 3300049582 Unclassified 3422
334 Ga0501048_0101439 3300049582 Bacteria 2030
335 Ga0501067_0081368 3300049583 Bacteria 1795
336 Ga0501068_0104603 3300049584 Bacteria 1757
337 Ga0501071_0095094 3300049587 Bacteria 2192
338 Ga0501072_0065139 3300049588 Bacteria 2873
339 Ga0501073_0071259 3300049589 Bacteria 2422
340 Ga0501075_0006788 3300049591 Bacteria 7902
341 Ga0501077_0099092 3300049593 Unclassified 1847
342 Ga0501079_0091331 3300049741 Unclassified 2359
343 Ga0501080_0016704 3300049742 Bacteria 6777
344 Ga0501081_0009192 3300049743 Bacteria 6435
345 Ga0501081_0226444 3300049743 Bacteria 1361
346 Ga0501044_0020133 3300049823 Bacteria 7121
347 Ga0501045_0250872 3300049824 Bacteria 1317
348 nmdc:mga05p37_117502_c1 3300050507 Bacteria 3268
349 nmdc:mga05p37_136300_c1 3300050507 Bacteria 3010
350 nmdc:mga05p37_17966_c1 3300050507 Bacteria 8539
351 nmdc:mga05p37_26211_c1 3300050507 Bacteria 7088
352 nmdc:mga05p37_3425_c1 3300050507 Bacteria 18503
353 nmdc:mga05p37_46638_c1 3300050507 Bacteria 5328
354 nmdc:mga05p37_514121_c1 3300050507 Bacteria 1371
355 nmdc:mga05p37_6944_c1 3300050507 Bacteria 13340
356 nmdc:mga05p37_9343_c1 3300050507 Bacteria 11600
357 nmdc:mga09592_13598_c1 3300050508 Bacteria 6649
358 nmdc:mga09592_41291_c1 3300050508 Unclassified 3878
359 nmdc:mga09592_61839_c1 3300050508 Bacteria 3167
360 nmdc:mga0qj67_11406_c1 3300050509 Bacteria 6658
361 nmdc:mga0qj67_34812_c1 3300050509 Unclassified 3935
362 nmdc:mga06r32_26990_c1 3300050510 Bacteria 5359
363 nmdc:mga06r32_53320_c1 3300050510 Bacteria 3874
364 nmdc:mga08y16_15974_c1 3300050511 Bacteria 7890
365 nmdc:mga08y16_2418_c1 3300050511 Bacteria 19189
366 nmdc:mga08y16_508781_c1 3300050511 Unclassified 1223
367 nmdc:mga08y16_7119_c1 3300050511 Bacteria 11738
368 nmdc:mga0n895_107_c1 3300050512 Bacteria 48793
369 nmdc:mga0n895_114605_c1 3300050512 Bacteria 2713
370 nmdc:mga0n895_14695_c1 3300050512 Bacteria 7119
371 nmdc:mga0n895_17681_c1 3300050512 Bacteria 6579
372 nmdc:mga0n895_43689_c1 3300050512 Bacteria 4368
373 nmdc:mga0n895_76345_c1 3300050512 Bacteria 3332
374 nmdc:mga0rr50_13_c1 3300050513 Bacteria 213605
375 nmdc:mga0rr50_2430_c1 3300050513 Bacteria 10501
376 nmdc:mga0rr50_303149_c1 3300050513 Bacteria 1337
377 nmdc:mga0rr50_90859_c1 3300050513 Bacteria 2377
378 nmdc:mga0rr50_913_c1 3300050513 Bacteria 15979
379 nmdc:mga08x19_153513_c1 3300050514 Bacteria 1561
380 nmdc:mga08x19_6676_c1 3300050514 Bacteria 6845
381 nmdc:mga0a205_2596_c1 3300050515 Bacteria 15951
382 nmdc:mga0a205_86317_c1 3300050515 Unclassified 3031
383 nmdc:mga0a205_89629_c1 3300050515 Unclassified 2973
384 Ga0495601_0021716 3300053077 Bacteria 3933
385 Ga0495601_0046929 3300053077 Bacteria 2719
386 Ga0495619_0004381 3300053085 Bacteria 9003
387 Ga0495619_0048035 3300053085 Bacteria 2812
388 Ga0495619_0282031 3300053085 Unclassified 1151
389 Ga0501084_0029646 3300054114 Unclassified 4578
390 Ga0501082_0208236 3300060353 Bacteria 1701
391 Ga0068858_100296396
392 JGI25406J46586_10000077
393 Ga0065704_10087175
394 Ga0065704_10103809
395 Ga0065715_10092649
396 Ga0065715_10193739
397 Ga0065707_10004395
398 Ga0065707_10005626
399 Ga0065707_10007479
400 Ga0065707_10114730
401 Ga0070658_10091507
402 Ga0070683_100282624
403 Ga0070690_100035410
404 Ga0070690_100066180
405 Ga0070690_100070810
406 Ga0070670_100060643
407 Ga0070670_100069273
408 Ga0068869_100096729
409 Ga0070666_10125367
410 Ga0070666_10242131
411 Ga0068868_100387760
412 Ga0070689_100016365
413 Ga0070689_100129350
414 Ga0070687_100098994
415 Ga0070692_10027240
416 Ga0070668_100057317
417 Ga0070669_100014861
418 Ga0070669_100135071
419 Ga0070675_100000033
420 Ga0070675_100009814
421 Ga0070675_100038478
422 Ga0070675_100053276
423 Ga0070675_100062379
424 Ga0070671_100092616
425 Ga0070673_100032071
426 Ga0070673_100121652
427 Ga0070688_100004224
428 Ga0070659_100069761
429 Ga0070667_100138618
430 Ga0070713_100044218
431 Ga0070711_100179126
432 Ga0070700_100130261
433 Ga0070694_100006230
434 Ga0070694_100014616
435 Ga0070708_100085251
436 Ga0070678_100049780
437 Ga0070678_100121567
438 Ga0070681_10069683
439 Ga0068867_100008404
440 Ga0068867_100012312
441 Ga0070706_100395971
442 Ga0070707_100002485
443 Ga0070707_100216582
444 Ga0070699_100002664
445 Ga0070699_100150265
446 Ga0070672_100045267
447 Ga0070686_100000363
448 Ga0070686_100006803
449 Ga0070686_100020530
450 Ga0070696_100101307
451 Ga0070665_100174625
452 Ga0070704_100000343
453 Ga0070704_100004424
454 Ga0070704_100037551
455 Ga0070664_100158099
456 Ga0068857_100019447
457 Ga0068857_100149854
458 Ga0068852_100159164
459 Ga0068859_100029471
460 Ga0068859_100044218
461 Ga0068859_100284350
462 Ga0068864_100015236
463 Ga0068864_100240912
464 Ga0068861_100013484
465 Ga0068861_100229125
466 Ga0068870_10009944
467 Ga0068870_10027287
468 Ga0068863_100082279
469 Ga0068858_100013659
470 Ga0068858_100042767
471 Ga0068858_100100169
472 Ga0068858_100273650
473 Ga0068858_100346350
474 Ga0068860_100013716
475 Ga0068860_100162603
476 Ga0068860_100166391
477 Ga0068862_100274796
478 Ga0081539_10000084
479 Ga0070715_10049476
480 Ga0097621_100005930
481 Ga0097621_100022491
482 Ga0097621_100031254
483 Ga0097621_100039615
484 Ga0068871_100008528
485 Ga0068871_100025970
486 Ga0068871_100115363
487 Ga0068871_100158327
488 Ga0068871_100236532
489 Ga0075428_100000377
490 Ga0075428_100001067
491 Ga0075428_100014912
492 Ga0075431_100014680
493 Ga0075431_100036823
494 Ga0075431_100084085
495 Ga0075433_10008275
496 Ga0075433_10008753
497 Ga0075433_10015960
498 Ga0075433_10106860
499 Ga0075433_10109468
500 Ga0075434_100000517
501 Ga0075434_100000695
502 Ga0075434_100022622
503 Ga0075434_100075321
504 Ga0075434_100105070
505 Ga0075434_100130336
506 Ga0075429_100107617
507 Ga0075429_100139907
508 Ga0075429_100173377
509 Ga0068865_100147676
510 Ga0075436_100001193
511 Ga0075436_100025324
512 Ga0075436_100062804
513 Ga0097620_100029472
514 Ga0097620_100044218
515 Ga0097620_100076413
516 Ga0097620_100284310
517 Ga0075435_100000412
518 Ga0075435_100001904
519 Ga0075435_100003605
520 Ga0075435_100010459
521 Ga0105240_10099911
522 Ga0111539_10003861
523 Ga0111539_10004971
524 Ga0111539_10006316
525 Ga0111539_10012848
526 Ga0111539_10432785
527 Ga0111539_10712180
528 Ga0105245_10195774
529 Ga0105245_10294777
530 Ga0105247_10015914
531 Ga0114129_10000090
532 Ga0114129_10003363
533 Ga0114129_10003850
534 Ga0114129_10006520
535 Ga0114129_10020738
536 Ga0114129_10035385
537 Ga0114129_10041499
538 Ga0114129_10485317
539 Ga0114129_10607538
540 Ga0105242_10015227
541 Ga0105242_10029805
542 Ga0105242_10071664
543 Ga0105242_10367148
544 Ga0105248_10001321
545 Ga0105248_10040880
546 Ga0105248_10054423
547 Ga0105248_10097267
548 Ga0105248_10201652
549 Ga0105238_10037278
550 Ga0105249_10020110
551 Ga0105249_10517517
552 Ga0157378_10010594
553 Ga0163162_10099648
554 Ga0157375_10008508
555 Ga0157375_10045665
556 Ga0157375_10154305
557 Ga0163163_10013756
558 Ga0157380_10002598
559 Ga0157380_10049575
560 Ga0157377_10005454
561 Ga0157377_10029070
562 Ga0157377_10046054
563 Ga0157379_10008763
564 Ga0157376_10002917
565 Ga0207682_10038109
566 Ga0207688_10132623
567 Ga0207680_10100446
568 Ga0207647_10087743
569 Ga0207645_10057914
570 Ga0207643_10004297
571 Ga0207643_10125660
572 Ga0207663_10144612
573 Ga0207662_10013874
574 Ga0207662_10028275
575 Ga0207662_10034225
576 Ga0207662_10072160
577 Ga0207662_10107778
578 Ga0207657_10005038
579 Ga0207646_10009636
580 Ga0207681_10014764
581 Ga0207650_10168552
582 Ga0207659_10002642
583 Ga0207659_10002974
584 Ga0207659_10005355
585 Ga0207659_10044163
586 Ga0207659_10050763
587 Ga0207659_10180045
588 Ga0207659_10219679
589 Ga0207687_10006898
590 Ga0207700_10467231
591 Ga0207706_10160906
592 Ga0207706_10240411
593 Ga0207709_10016553
594 Ga0207670_10074657
595 Ga0207669_10000046
596 Ga0207669_10220929
597 Ga0207704_10012469
598 Ga0207704_10040513
599 Ga0207704_10118861
600 Ga0207704_10145148
601 Ga0207691_10026097
602 Ga0207691_10049304
603 Ga0207691_10080773
604 Ga0207691_10177394
605 Ga0207711_10013025
606 Ga0207711_10040569
607 Ga0207711_10093493
608 Ga0207711_10141085
609 Ga0207711_10316018
610 Ga0207689_10065632
611 Ga0207651_10034395
612 Ga0207651_10044745
613 Ga0207651_10135297
614 Ga0207712_10039569
615 Ga0207668_10052933
616 Ga0207668_10468532
617 Ga0207640_10076173
618 Ga0207677_10035395
619 Ga0207703_10004570
620 Ga0207703_10047683
621 Ga0207703_10252161
622 Ga0207703_10275776
623 Ga0207639_10255645
624 Ga0207708_10020881
625 Ga0207708_10061434
626 Ga0207708_10074659
627 Ga0207708_10150586
628 Ga0207648_10000198
629 Ga0207648_10011684
630 Ga0207648_10064192
631 Ga0207676_10011358
632 Ga0207676_10215016
633 Ga0207674_10031401
634 Ga0207674_10035287
635 Ga0207675_100001270
636 Ga0207675_100096467
637 Ga0207675_100453420
638 Ga0207683_10071473
639 Ga0207683_10105925
640 Ga0207683_10227765
641 Ga0207428_10000510
642 Ga0207428_10003032
643 Ga0207428_10005577
644 Ga0268266_10050939
645 Ga0268265_10000767
646 Ga0268265_10544577
647 Ga0268264_10031284
648 Ga0268264_10153788
649 Ga0268264_10176673
650 Ga0307408_100012392
651 Ga0307408_100365081
652 Ga0307405_10004140
653 Ga0373928_0011669
654 Ga0373929_0004444
655 Ga0373949_0005520
656 Ga0373951_0000350
657 Ga0373952_0000159
658 Ga0373932_0000291
659 Ga0373936_0044953
660 Ga0373939_0002439
661 Ga0373943_0005046
662 Ga0373946_0010714
663 Ga0373955_0074657
664 Ga0373961_0003010
665 Ga0373962_0006350
666 Ga0373924_0003722
667 Ga0373931_0001090
668 Ga0373931_0063290
669 Ga0373935_0008442
670 Ga0373933_0033132
671 Ga0373937_0293549
672 Ga0373937_0670328
673 Ga0373925_0092078
674 Ga0373925_0118612
675 Ga0373925_0315693
676 Ga0439462_0008368
677 Ga0439435_0007420
678 Ga0451576_0021557
679 Ga0451576_0022636
680 Ga0451576_0141487
681 Ga0451576_0218652
682 Ga0495592_0184077
683 Ga0495603_0048777
684 Ga0495629_0014576
685 Ga0495651_0168812
686 Ga0495580_0267150
687 Ga0495608_0010425
688 Ga0495608_0087720
689 Ga0495628_0057983
690 Ga0495628_0082639
691 Ga0495630_0256341
692 Ga0495640_0098741
693 Ga0495640_0166502
694 Ga0495586_0202885
695 Ga0495598_0015916
696 Ga0495667_0023481
697 Ga0495656_0097495
698 Ga0495634_0182256
699 Ga0495659_0021739
700 Ga0495646_0096316
701 Ga0495647_0093864
702 Ga0495658_0106891
703 Ga0495669_0043631
704 Ga0495613_0007772
705 Ga0495604_0049539
706 Ga0495676_0142163
707 Ga0496100_0019511
708 Ga0496101_0052043
709 Ga0496104_0325663
710 Ga0496104_0597795
711 Ga0496105_0061841
712 Ga0496114_0006566
713 Ga0496114_0396768
714 Ga0496115_0035397
715 Ga0501033_0056634
716 Ga0501034_0034540
717 Ga0501038_0126198
718 Ga0501040_0051811
719 Ga0501041_0020280
720 Ga0501042_0005015
721 Ga0501046_0079722
722 Ga0501047_0088726
723 Ga0501048_0038707
724 Ga0501048_0101439
725 Ga0501067_0081368
726 Ga0501068_0104603
727 Ga0501071_0095094
728 Ga0501072_0065139
729 Ga0501073_0071259
730 Ga0501075_0006788
731 Ga0501077_0099092
732 Ga0501079_0091331
733 Ga0501080_0016704
734 Ga0501081_0009192
735 Ga0501081_0226444
736 Ga0501044_0020133
737 Ga0501045_0250872
738 nmdc:mga05p37_117502_c1
739 nmdc:mga05p37_136300_c1
740 nmdc:mga05p37_17966_c1
741 nmdc:mga05p37_26211_c1
742 nmdc:mga05p37_3425_c1
743 nmdc:mga05p37_46638_c1
744 nmdc:mga05p37_514121_c1
745 nmdc:mga05p37_6944_c1
746 nmdc:mga05p37_9343_c1
747 nmdc:mga09592_13598_c1
748 nmdc:mga09592_41291_c1
749 nmdc:mga09592_61839_c1
750 nmdc:mga0qj67_11406_c1
751 nmdc:mga0qj67_34812_c1
752 nmdc:mga06r32_26990_c1
753 nmdc:mga06r32_53320_c1
754 nmdc:mga08y16_15974_c1
755 nmdc:mga08y16_2418_c1
756 nmdc:mga08y16_508781_c1
757 nmdc:mga08y16_7119_c1
758 nmdc:mga0n895_107_c1
759 nmdc:mga0n895_114605_c1
760 nmdc:mga0n895_14695_c1
761 nmdc:mga0n895_17681_c1
762 nmdc:mga0n895_43689_c1
763 nmdc:mga0n895_76345_c1
764 nmdc:mga0rr50_13_c1
765 nmdc:mga0rr50_2430_c1
766 nmdc:mga0rr50_303149_c1
767 nmdc:mga0rr50_90859_c1
768 nmdc:mga0rr50_913_c1
769 nmdc:mga08x19_153513_c1
770 nmdc:mga08x19_6676_c1
771 nmdc:mga0a205_2596_c1
772 nmdc:mga0a205_86317_c1
773 nmdc:mga0a205_89629_c1
774 Ga0495601_0021716
775 Ga0495601_0046929
776 Ga0495619_0004381
777 Ga0495619_0048035
778 Ga0495619_0282031
779 Ga0501084_0029646
780 Ga0501082_0208236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

115

356

0.77

PF12146

Hydrolase_4

Serine aminopeptidase, S33

112

352

0.75

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

117

361

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.7868 36 326
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.7773 36 326
5g5m-assembly1.cif.gz_A structure of the pyrococcus furiosus esterase pf2001 with space group p21 0.7663 4 326
5g5m-assembly1.cif.gz_A structure of the pyrococcus furiosus esterase pf2001 with space group p21 0.7607 4 326
4zrd-assembly1.cif.gz_A crystal structure of smg1 f278n mutant 0.7551 116 171
ID Description Score Start End Superfamily
af_A0A1D6Q677_141_401_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.937 61 304 3.40.50.1820
af_I1NHC0_113_382_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9259 35 289 3.40.50.1820
af_Q9SVL9_93_391_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9216 36 324 3.40.50.1820
af_A0A0R0IFF4_3_207_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.916 77 276 3.40.50.1820
af_Q54H38_65_359_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9149 14 300 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1F2TXC0-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9978 6 325 GO:0034338
GO:0047372
AF-A0A317HNW5-F1-model_v4 Alpha/beta hydrolase 0.9953 6 327 GO:0034338
GO:0047372
AF-A0A2V9DEA5-F1-model_v4 Alpha/beta hydrolase 0.9827 1 327 GO:0034338
GO:0047372
AF-A0A2V8ZR33-F1-model_v4 Alpha/beta hydrolase 0.981 3 328 GO:0034338
GO:0047372
AF-A0A838SH39-F1-model_v4 Alpha/beta fold hydrolase 0.9775 32 328 GO:0034338
GO:0047372

Map