F431968

General Info

Members Datasets Scaffolds Average Seq Length
391 190 391 228

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100307999|Ga0070698_1003079992
Length 277
Sequence MSFLQGDHALTGRDGRVRGKDAGSADSPSYRRDRGRRIAPPSATGQPVLHPEGSSKPRVGVVTYPGSQDDRDALWALAALDAEAVSVWHAESELPPLDAIVLPGGFSYGDYLRCGAIARFSPATRAVCEFAEAGGLVLGICNGFQVLCEAGLLPGVLLRNESLRFVCRDVPLVVERDDLPFTSHCTIGQTLVIPVKHGDGRYVPPPGLDPAQVVFRYADNPNGSVDDIAGVCNERGNVLGLMPHPEHAVDPLLGSDDGAFILASLVDAARDRAPAAA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.67
Rhizosphere 92.07
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10041042 3300005327 Bacteria 3733
2 Ga0070658_10429591 3300005327 Bacteria 1137
3 Ga0070683_100042475 3300005329 Bacteria 4186
4 Ga0070683_100642644 3300005329 Bacteria 1016
5 Ga0070680_100349693 3300005336 Bacteria 1257
6 Ga0070680_100422080 3300005336 Bacteria 1138
7 Ga0070680_100436291 3300005336 Bacteria 1118
8 Ga0070682_100081981 3300005337 Bacteria 2090
9 Ga0070682_100153710 3300005337 Bacteria 1582
10 Ga0070660_100031065 3300005339 Bacteria 4009
11 Ga0070660_100036640 3300005339 Bacteria 3716
12 Ga0070660_100105719 3300005339 Bacteria 2234
13 Ga0070659_100114834 3300005366 Bacteria 2176
14 Ga0070709_10011315 3300005434 Bacteria 4968
15 Ga0070714_100034199 3300005435 Bacteria 4255
16 Ga0070714_100069917 3300005435 Bacteria 3033
17 Ga0070714_100144330 3300005435 Bacteria 2140
18 Ga0070714_100145945 3300005435 Bacteria 2128
19 Ga0070714_100166254 3300005435 Bacteria 1999
20 Ga0070714_100216149 3300005435 Bacteria 1760
21 Ga0070710_10031605 3300005437 Bacteria 2860
22 Ga0070710_10448706 3300005437 Bacteria 874
23 Ga0070708_100478703 3300005445 Bacteria 1175
24 Ga0070663_100589206 3300005455 Bacteria 934
25 Ga0070681_10032707 3300005458 Bacteria 5222
26 Ga0070681_10106934 3300005458 Bacteria 2739
27 Ga0070681_10123201 3300005458 Bacteria 2525
28 Ga0070681_10132732 3300005458 Bacteria 2422
29 Ga0070681_10149121 3300005458 Bacteria 2266
30 Ga0070681_10233780 3300005458 Bacteria 1752
31 Ga0070681_10496961 3300005458 Bacteria 1133
32 Ga0070707_100000570 3300005468 Bacteria 37054
33 Ga0070707_100123638 3300005468 Bacteria 2513
34 Ga0070707_100434795 3300005468 Bacteria 1273
35 Ga0070698_100015489 3300005471 Bacteria 8053
36 Ga0070698_100307999 3300005471 Bacteria 1515
37 Ga0070699_100166587 3300005518 Bacteria 1952
38 Ga0070679_100019458 3300005530 Bacteria 6601
39 Ga0070679_100155445 3300005530 Bacteria 2262
40 Ga0070679_100156105 3300005530 Bacteria 2257
41 Ga0070679_100241496 3300005530 Bacteria 1763
42 Ga0070679_100461403 3300005530 Bacteria 1215
43 Ga0070684_100023081 3300005535 Bacteria 5196
44 Ga0070684_100070847 3300005535 Bacteria 3069
45 Ga0070684_100202362 3300005535 Bacteria 1809
46 Ga0070697_100473795 3300005536 Bacteria 1093
47 Ga0068853_100476887 3300005539 Bacteria 1176
48 Ga0070695_100000253 3300005545 Bacteria 26811
49 Ga0070696_100184619 3300005546 Bacteria 1549
50 Ga0070665_100565156 3300005548 Bacteria 1150
51 Ga0070704_100067894 3300005549 Bacteria 2577
52 Ga0068855_100052596 3300005563 Bacteria 4794
53 Ga0070664_100628740 3300005564 Bacteria 997
54 Ga0068854_100711496 3300005578 Bacteria 868
55 Ga0068852_100317143 3300005616 Bacteria 1513
56 Ga0070717_10006656 3300006028 Bacteria 8519
57 Ga0070717_10012809 3300006028 Bacteria 6403
58 Ga0070717_10042171 3300006028 Bacteria 3722
59 Ga0070717_10052786 3300006028 Bacteria 3350
60 Ga0070717_10147034 3300006028 Bacteria 2036
61 Ga0070717_10366937 3300006028 Bacteria 1289
62 Ga0070712_100142958 3300006175 Bacteria 1828
63 Ga0097621_100431920 3300006237 Bacteria 1184
64 Ga0105240_10050080 3300009093 Bacteria 5268
65 Ga0105240_10180280 3300009093 Bacteria 2493
66 Ga0105245_10009775 3300009098 Bacteria 8356
67 Ga0105248_10344721 3300009177 Bacteria 1677
68 Ga0105237_10172828 3300009545 Bacteria 2161
69 Ga0105237_10772059 3300009545 Bacteria 968
70 Ga0105238_10074304 3300009551 Bacteria 3392
71 Ga0105238_10916165 3300009551 Bacteria 895
72 Ga0105239_10178931 3300010375 Bacteria 2372
73 Ga0157373_10194919 3300013100 Bacteria 1428
74 Ga0157373_10256485 3300013100 Bacteria 1237
75 Ga0157370_10008749 3300013104 Bacteria 10886
76 Ga0157370_10219331 3300013104 Bacteria 1762
77 Ga0157369_10484411 3300013105 Bacteria 1280
78 Ga0157372_10232874 3300013307 Bacteria 2136
79 Ga0182008_10008509 3300014497 Bacteria 5603
80 Ga0182006_1012923 3300015261 Bacteria 3641
81 Ga0182007_10023948 3300015262 Bacteria 2141
82 Ga0197907_10559547 3300020069 Bacteria 2495
83 Ga0206356_10625959 3300020070 Bacteria 2782
84 Ga0206356_11016126 3300020070 Bacteria 5157
85 Ga0206354_10799421 3300020081 Bacteria 1873
86 Ga0206353_10162256 3300020082 Bacteria 4356
87 Ga0206353_11396466 3300020082 Bacteria 9336
88 Ga0213871_10084399 3300021441 Bacteria 914
89 Ga0207692_10176680 3300025898 Bacteria 1241
90 Ga0207699_10019672 3300025906 Bacteria 3605
91 Ga0207699_10130132 3300025906 Bacteria 1640
92 Ga0207705_10042863 3300025909 Bacteria 3250
93 Ga0207705_10102409 3300025909 Bacteria 2108
94 Ga0207705_10309375 3300025909 Bacteria 1213
95 Ga0207684_10258792 3300025910 Bacteria 1501
96 Ga0207707_10082086 3300025912 Bacteria 2814
97 Ga0207707_10092825 3300025912 Bacteria 2637
98 Ga0207707_10092918 3300025912 Bacteria 2636
99 Ga0207707_10151884 3300025912 Bacteria 2024
100 Ga0207707_10610682 3300025912 Bacteria 922
101 Ga0207695_10071466 3300025913 Bacteria 3544
102 Ga0207695_10647346 3300025913 Bacteria 938
103 Ga0207671_10083040 3300025914 Bacteria 2405
104 Ga0207693_10002559 3300025915 Bacteria 15814
105 Ga0207693_10029601 3300025915 Bacteria 4324
106 Ga0207693_10188205 3300025915 Bacteria 1625
107 Ga0207693_10321922 3300025915 Bacteria 1210
108 Ga0207693_10326076 3300025915 Bacteria 1202
109 Ga0207693_10741736 3300025915 Bacteria 759
110 Ga0207663_10002881 3300025916 Bacteria 8308
111 Ga0207660_10162806 3300025917 Bacteria 1722
112 Ga0207657_10001344 3300025919 Bacteria 26151
113 Ga0207657_10009662 3300025919 Bacteria 9679
114 Ga0207657_10015304 3300025919 Bacteria 7436
115 Ga0207652_10044820 3300025921 Bacteria 3769
116 Ga0207652_10080649 3300025921 Bacteria 2845
117 Ga0207652_10119256 3300025921 Bacteria 2346
118 Ga0207652_10462878 3300025921 Bacteria 1143
119 Ga0207646_10000371 3300025922 Bacteria 59994
120 Ga0207646_10057680 3300025922 Bacteria 3469
121 Ga0207700_10035417 3300025928 Bacteria 3595
122 Ga0207700_10084679 3300025928 Bacteria 2486
123 Ga0207700_10138634 3300025928 Bacteria 1996
124 Ga0207664_10004888 3300025929 Bacteria 9110
125 Ga0207664_10034890 3300025929 Bacteria 3877
126 Ga0207664_10038111 3300025929 Bacteria 3725
127 Ga0207664_10058331 3300025929 Bacteria 3071
128 Ga0207664_10059139 3300025929 Bacteria 3051
129 Ga0207664_10091187 3300025929 Bacteria 2498
130 Ga0207664_10514429 3300025929 Bacteria 1073
131 Ga0207644_10045421 3300025931 Bacteria 3125
132 Ga0207690_10075425 3300025932 Bacteria 2339
133 Ga0207665_10009528 3300025939 Bacteria 6377
134 Ga0207661_10107205 3300025944 Bacteria 2356
135 Ga0207661_10220261 3300025944 Bacteria 1677
136 Ga0207661_10479975 3300025944 Bacteria 1135
137 Ga0207679_10580045 3300025945 Bacteria 1009
138 Ga0207667_10061417 3300025949 Bacteria 3931
139 Ga0207677_10771548 3300026023 Bacteria 858
140 Ga0207703_10804221 3300026035 Bacteria 898
141 Ga0207639_10376102 3300026041 Bacteria 1275
142 Ga0207678_10305159 3300026067 Bacteria 1368
143 Ga0207683_10621035 3300026121 Bacteria 1001
144 Ga0207698_10277802 3300026142 Bacteria 1547
145 Ga0265337_1081467 3300028556 Bacteria 885
146 Ga0265319_1001506 3300028563 Bacteria 13842
147 Ga0265319_1093652 3300028563 Bacteria 947
148 Ga0265334_10095610 3300028573 Bacteria 1080
149 Ga0265318_10003550 3300028577 Bacteria 7817
150 Ga0265322_10054849 3300028654 Bacteria 1130
151 Ga0265338_10002322 3300028800 Bacteria 28800
152 Ga0265338_10006178 3300028800 Bacteria 15355
153 Ga0265338_10007391 3300028800 Bacteria 13652
154 Ga0265338_10010646 3300028800 Bacteria 10749
155 Ga0265338_10020910 3300028800 Bacteria 6851
156 Ga0265338_10023514 3300028800 Bacteria 6333
157 Ga0265338_10163507 3300028800 Bacteria 1716
158 Ga0265324_10020026 3300029957 Bacteria 2407
159 Ga0265330_10008056 3300031235 Bacteria 5097
160 Ga0265330_10161682 3300031235 Bacteria 951
161 Ga0265332_10092006 3300031238 Bacteria 1282
162 Ga0265328_10120277 3300031239 Bacteria 979
163 Ga0265320_10092187 3300031240 Bacteria 1402
164 Ga0265329_10019552 3300031242 Bacteria 2297
165 Ga0265340_10050887 3300031247 Bacteria 2008
166 Ga0265340_10086174 3300031247 Bacteria 1473
167 Ga0265327_10009229 3300031251 Bacteria 7154
168 Ga0265327_10033558 3300031251 Bacteria 2858
169 Ga0265327_10048597 3300031251 Bacteria 2230
170 Ga0265316_10020572 3300031344 Bacteria 5614
171 Ga0265314_10006166 3300031711 Bacteria 10650
172 Ga0265314_10008434 3300031711 Bacteria 8829
173 Ga0265342_10010787 3300031712 Bacteria 6302
174 Ga0265342_10016006 3300031712 Bacteria 4914
175 Ga0316583_10028303 3300032133 Bacteria 1999
176 Ga0373934_0143557 3300035086 Bacteria 977
177 Ga0373945_0002469 3300035116 Bacteria 5800
178 Ga0373955_0055386 3300035172 Bacteria 2172
179 Ga0373935_0103661 3300035692 Bacteria 1879
180 Ga0373933_0057624 3300035724 Bacteria 2335
181 Ga0373947_0006051 3300035725 Bacteria 7050
182 Ga0373937_0078927 3300036401 Bacteria 3042
183 Ga0373925_0003168 3300037068 Bacteria 12878
184 Ga0395899_0014999 3300037312 Bacteria 5911
185 Ga0395899_0224379 3300037312 Bacteria 1300
186 Ga0395899_0361997 3300037312 Bacteria 968
187 Ga0395900_0046890 3300037418 Bacteria 4449
188 Ga0395900_0151617 3300037418 Bacteria 2368
189 Ga0395900_0226912 3300037418 Bacteria 1880
190 Ga0395900_0287821 3300037418 Bacteria 1633
191 Ga0395898_0035110 3300037466 Bacteria 4990
192 Ga0395898_0072543 3300037466 Bacteria 3326
193 Ga0395898_0163172 3300037466 Bacteria 2131
194 Ga0395898_0639218 3300037466 Bacteria 1006
195 Ga0395905_0320176 3300037471 Bacteria 1440
196 Ga0395905_0591049 3300037471 Bacteria 1012
197 Ga0395901_0135721 3300038443 Bacteria 2586
198 Ga0395901_0286259 3300038443 Bacteria 1711
199 Ga0395901_0479780 3300038443 Bacteria 1268
200 Ga0436360_1015244 3300039438 Bacteria 6330
201 Ga0436360_1281619 3300039438 Bacteria 1057
202 Ga0436363_1002732 3300039450 Bacteria 1321
203 Ga0466969_0016387 3300044656 Bacteria 3877
204 Ga0466965_0158005 3300044683 Bacteria 1188
205 Ga0466966_0020298 3300044684 Bacteria 4372
206 Ga0466966_0383595 3300044684 Bacteria 844
207 Ga0466961_0003166 3300044693 Bacteria 10246
208 Ga0466961_0017573 3300044693 Bacteria 4596
209 Ga0466961_0068244 3300044693 Bacteria 2258
210 Ga0466961_0490754 3300044693 Bacteria 742
211 Ga0466963_0000048 3300044694 Bacteria 39958
212 Ga0466963_0000967 3300044694 Bacteria 14752
213 Ga0466963_0001327 3300044694 Bacteria 13181
214 Ga0466963_0002800 3300044694 Bacteria 9828
215 Ga0466963_0010395 3300044694 Bacteria 5634
216 Ga0466963_0032079 3300044694 Bacteria 3399
217 Ga0466963_0044907 3300044694 Bacteria 2908
218 Ga0466963_0126622 3300044694 Bacteria 1761
219 Ga0466964_0000548 3300044706 Bacteria 11788
220 Ga0466964_0004529 3300044706 Bacteria 5133
221 Ga0466964_0034017 3300044706 Bacteria 2033
222 Ga0466964_0061800 3300044706 Bacteria 1560
223 Ga0466971_0001693 3300044719 Bacteria 9343
224 Ga0466971_0002619 3300044719 Bacteria 7610
225 Ga0466971_0068180 3300044719 Bacteria 1613
226 Ga0466957_0002205 3300044842 Bacteria 10443
227 Ga0466957_0034547 3300044842 Bacteria 3033
228 Ga0466957_0039772 3300044842 Bacteria 2838
229 Ga0466957_0052370 3300044842 Bacteria 2485
230 Ga0466957_0079894 3300044842 Bacteria 2036
231 Ga0466957_0105433 3300044842 Bacteria 1782
232 Ga0466957_0121187 3300044842 Bacteria 1667
233 Ga0466957_0176181 3300044842 Bacteria 1395
234 Ga0466957_0205699 3300044842 Bacteria 1294
235 Ga0466957_0342037 3300044842 Bacteria 1013
236 Ga0466960_0411347 3300044901 Bacteria 781
237 Ga0466959_0035689 3300045049 Bacteria 3675
238 Ga0466959_0612177 3300045049 Bacteria 732
239 Ga0466958_0000428 3300045836 Bacteria 17380
240 Ga0466958_0001308 3300045836 Bacteria 11730
241 Ga0466958_0003345 3300045836 Bacteria 8310
242 Ga0466958_0005432 3300045836 Bacteria 6860
243 Ga0466958_0011964 3300045836 Bacteria 4903
244 Ga0466958_0041709 3300045836 Bacteria 2761
245 Ga0466958_0123235 3300045836 Bacteria 1624
246 Ga0466958_0332364 3300045836 Bacteria 977
247 Ga0466958_0374707 3300045836 Bacteria 917
248 Ga0466967_0000041 3300045976 Bacteria 46227
249 Ga0466967_0000056 3300045976 Bacteria 40207
250 Ga0466967_0001136 3300045976 Bacteria 14841
251 Ga0466967_0009556 3300045976 Bacteria 7205
252 Ga0466967_0010119 3300045976 Bacteria 7052
253 Ga0466967_0016342 3300045976 Bacteria 5850
254 Ga0466967_0025487 3300045976 Bacteria 4878
255 Ga0466967_0041038 3300045976 Bacteria 3986
256 Ga0466967_0064089 3300045976 Bacteria 3267
257 Ga0466967_0098590 3300045976 Bacteria 2668
258 Ga0466967_0122876 3300045976 Bacteria 2401
259 Ga0466967_0160582 3300045976 Bacteria 2109
260 Ga0466967_0227351 3300045976 Bacteria 1775
261 Ga0466967_0306646 3300045976 Bacteria 1528
262 Ga0466967_0311842 3300045976 Bacteria 1515
263 Ga0466967_0337080 3300045976 Bacteria 1457
264 Ga0466967_1265375 3300045976 Bacteria 735
265 Ga0495592_0293713 3300046454 Bacteria 1058
266 Ga0495629_0308517 3300046459 Bacteria 1083
267 Ga0495641_0158729 3300046461 Bacteria 1011
268 Ga0495651_0030418 3300046462 Bacteria 4211
269 Ga0495651_0060470 3300046462 Bacteria 2901
270 Ga0495651_0076324 3300046462 Bacteria 2539
271 Ga0495653_0012796 3300046463 Bacteria 6850
272 Ga0495653_0097907 3300046463 Bacteria 2130
273 Ga0495653_0167405 3300046463 Bacteria 1520
274 Ga0495653_0184709 3300046463 Bacteria 1427
275 Ga0495653_0211775 3300046463 Bacteria 1308
276 Ga0495580_0005739 3300046472 Bacteria 10197
277 Ga0495639_0002012 3300046475 Bacteria 9004
278 Ga0495662_0031529 3300046476 Bacteria 2561
279 Ga0495664_0002458 3300046477 Bacteria 9973
280 Ga0495608_0042314 3300046511 Bacteria 3046
281 Ga0495608_0045018 3300046511 Bacteria 2943
282 Ga0495608_0193870 3300046511 Bacteria 1282
283 Ga0495608_0231508 3300046511 Bacteria 1156
284 Ga0495618_0088590 3300046514 Bacteria 1979
285 Ga0495618_0116266 3300046514 Bacteria 1712
286 Ga0495618_0145449 3300046514 Bacteria 1515
287 Ga0495628_0034140 3300046516 Bacteria 4095
288 Ga0495630_0009935 3300046517 Bacteria 6853
289 Ga0495630_0164026 3300046517 Bacteria 1691
290 Ga0495630_0193791 3300046517 Bacteria 1550
291 Ga0495666_0001833 3300046526 Bacteria 10499
292 Ga0495652_0033562 3300046529 Bacteria 4480
293 Ga0495665_0001146 3300046531 Bacteria 14076
294 Ga0495586_0009376 3300046535 Bacteria 5207
295 Ga0495645_0114423 3300046543 Bacteria 1906
296 Ga0495667_0019599 3300046559 Bacteria 4563
297 Ga0495667_0043796 3300046559 Bacteria 2965
298 Ga0495667_0103228 3300046559 Bacteria 1844
299 Ga0495667_0124332 3300046559 Bacteria 1665
300 Ga0495634_0009599 3300046642 Bacteria 7130
301 Ga0495634_0030991 3300046642 Bacteria 3686
302 Ga0495635_0142414 3300046663 Bacteria 1632
303 Ga0495635_0186492 3300046663 Bacteria 1409
304 Ga0495657_0027126 3300046675 Bacteria 4047
305 Ga0495657_0054861 3300046675 Bacteria 2660
306 Ga0495599_0051142 3300046678 Bacteria 2589
307 Ga0495623_0110336 3300046679 Bacteria 1668
308 Ga0495646_0191961 3300046680 Bacteria 1116
309 Ga0495647_0000409 3300046681 Bacteria 12314
310 Ga0495658_0001411 3300046683 Bacteria 12621
311 Ga0495613_0015455 3300046689 Bacteria 5675
312 Ga0495613_0401145 3300046689 Bacteria 935
313 Ga0495624_0001586 3300046690 Bacteria 17481
314 Ga0495624_0032405 3300046690 Bacteria 3389
315 Ga0495600_0154298 3300046809 Bacteria 1486
316 Ga0495581_0000855 3300047315 Bacteria 16229
317 Ga0495604_0166789 3300047317 Bacteria 1552
318 Ga0495674_0011237 3300047319 Bacteria 8453
319 Ga0495674_0198236 3300047319 Bacteria 1666
320 Ga0495674_0292541 3300047319 Bacteria 1332
321 Ga0495676_0013093 3300047321 Bacteria 7463
322 Ga0495676_0335414 3300047321 Bacteria 1013
323 Ga0495680_0085626 3300047322 Bacteria 2373
324 Ga0495675_0085883 3300047444 Bacteria 1978
325 Ga0495684_0004610 3300047471 Bacteria 10764
326 Ga0495684_0012175 3300047471 Bacteria 6635
327 Ga0495684_0036579 3300047471 Bacteria 3763
328 Ga0495593_0000420 3300047673 Bacteria 23646
329 Ga0495614_0000273 3300048089 Bacteria 20182
330 Ga0496100_0428186 3300048903 Bacteria 1012
331 Ga0496101_0180543 3300048904 Bacteria 1625
332 Ga0496102_0125468 3300048905 Bacteria 2399
333 Ga0496102_0181644 3300048905 Bacteria 1982
334 Ga0496102_0298343 3300048905 Bacteria 1519
335 Ga0496104_0007553 3300048907 Bacteria 9614
336 Ga0496104_0834369 3300048907 Bacteria 827
337 Ga0496105_0004615 3300048908 Bacteria 10382
338 Ga0496105_0056268 3300048908 Bacteria 3246
339 Ga0496106_0002736 3300048909 Bacteria 13066
340 Ga0496107_0004538 3300048910 Bacteria 9401
341 Ga0496107_0445436 3300048910 Bacteria 962
342 Ga0496108_0132376 3300048911 Bacteria 2143
343 Ga0496109_0010128 3300048912 Bacteria 8044
344 Ga0496109_0091756 3300048912 Bacteria 2809
345 Ga0496109_0136341 3300048912 Bacteria 2293
346 Ga0496110_0014684 3300048913 Bacteria 6510
347 Ga0496110_0168575 3300048913 Bacteria 1986
348 Ga0496111_0255455 3300048914 Bacteria 1300
349 Ga0496111_0488058 3300048914 Bacteria 907
350 Ga0496111_0511830 3300048914 Bacteria 883
351 Ga0496112_0003763 3300048915 Bacteria 12665
352 Ga0496112_0065565 3300048915 Bacteria 3584
353 Ga0496112_0130281 3300048915 Bacteria 2486
354 Ga0496112_0234255 3300048915 Bacteria 1790
355 Ga0496113_0398751 3300048916 Bacteria 1105
356 Ga0496114_0295165 3300048917 Bacteria 1430
357 Ga0496114_0394305 3300048917 Bacteria 1226
358 Ga0496114_0673800 3300048917 Bacteria 908
359 Ga0496115_0014102 3300048918 Bacteria 6051
360 Ga0501034_0050743 3300049571 Bacteria 4184
361 Ga0501047_0351479 3300049581 Bacteria 1311
362 Ga0501067_0024113 3300049583 Bacteria 3373
363 Ga0501067_0058895 3300049583 Bacteria 2127
364 Ga0501067_0068225 3300049583 Bacteria 1969
365 Ga0501067_0074363 3300049583 Bacteria 1883
366 Ga0501069_0005142 3300049585 Bacteria 6793
367 Ga0501069_0044655 3300049585 Bacteria 2453
368 Ga0501069_0143556 3300049585 Bacteria 1370
369 Ga0501070_0057816 3300049586 Bacteria 3216
370 Ga0501070_0170893 3300049586 Bacteria 1790
371 Ga0501072_0003578 3300049588 Bacteria 11692
372 Ga0501073_0006396 3300049589 Bacteria 8770
373 Ga0501074_0044191 3300049590 Bacteria 3225
374 Ga0501074_0137243 3300049590 Bacteria 1749
375 Ga0501080_0018701 3300049742 Bacteria 6412
376 Ga0501083_0000290 3300049744 Bacteria 31698
377 Ga0501083_0328701 3300049744 Bacteria 994
378 nmdc:mga0n895_4986_c1 3300050512 Bacteria 11015
379 nmdc:mga0rr50_22727_c1 3300050513 Bacteria 4309
380 Ga0495601_0037198 3300053077 Bacteria 3042
381 Ga0495601_0038673 3300053077 Bacteria 2984
382 Ga0495595_0004782 3300053084 Bacteria 5456
383 Ga0495595_0033428 3300053084 Bacteria 2320
384 Ga0495595_0202011 3300053084 Bacteria 990
385 Ga0495619_0161170 3300053085 Bacteria 1549
386 Ga0495619_0198632 3300053085 Bacteria 1388
387 Ga0466962_0006487 3300061719 Bacteria 5616
388 Ga0466962_0006824 3300061719 Bacteria 5480
389 Ga0466962_0028637 3300061719 Bacteria 2667
390 Ga0466962_0069210 3300061719 Bacteria 1686
391 Ga0466962_0070208 3300061719 Bacteria 1673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100711496 Ga0068854_1007114961 218
2 3300005437 Ga0070710_10448706 Ga0070710_104487061 221
3 3300013105 Ga0157369_10484411 Ga0157369_104844112 221
4 3300028563 Ga0265319_1093652 Ga0265319_10936522 222
5 3300028800 Ga0265338_10007391 Ga0265338_100073914 222
6 3300028800 Ga0265338_10163507 Ga0265338_101635073 222
7 3300029957 Ga0265324_10020026 Ga0265324_100200263 222
8 3300009545 Ga0105237_10772059 Ga0105237_107720592 223
9 3300025931 Ga0207644_10045421 Ga0207644_100454215 224
10 3300028800 Ga0265338_10002322 Ga0265338_100023224 224
11 3300046529 Ga0495652_0033562 Ga0495652_0033562_2616_3293 224
12 3300046679 Ga0495623_0110336 Ga0495623_0110336_91_768 224
13 3300053077 Ga0495601_0038673 Ga0495601_0038673_1871_2548 224
14 3300009177 Ga0105248_10344721 Ga0105248_103447213 225
15 3300031251 Ga0265327_10033558 Ga0265327_100335582 225
16 3300039450 Ga0436363_1002732 Ga0436363_1002732_554_1234 225
17 3300046462 Ga0495651_0076324 Ga0495651_0076324_938_1618 225
18 3300047322 Ga0495680_0085626 Ga0495680_0085626_344_1027 225
19 3300053084 Ga0495595_0202011 Ga0495595_0202011_44_727 225
20 3300005327 Ga0070658_10429591 Ga0070658_104295913 226
21 3300005329 Ga0070683_100642644 Ga0070683_1006426442 226
22 3300005336 Ga0070680_100349693 Ga0070680_1003496932 226
23 3300005336 Ga0070680_100436291 Ga0070680_1004362911 226
24 3300005337 Ga0070682_100081981 Ga0070682_1000819812 226
25 3300005337 Ga0070682_100153710 Ga0070682_1001537101 226
26 3300005339 Ga0070660_100031065 Ga0070660_1000310654 226
27 3300005339 Ga0070660_100105719 Ga0070660_1001057194 226
28 3300005366 Ga0070659_100114834 Ga0070659_1001148344 226
29 3300005434 Ga0070709_10011315 Ga0070709_100113152 226
30 3300005435 Ga0070714_100034199 Ga0070714_1000341993 226
31 3300005435 Ga0070714_100069917 Ga0070714_1000699174 226
32 3300005435 Ga0070714_100144330 Ga0070714_1001443303 226
33 3300005437 Ga0070710_10031605 Ga0070710_100316052 226
34 3300005445 Ga0070708_100478703 Ga0070708_1004787031 226
35 3300005455 Ga0070663_100589206 Ga0070663_1005892062 226
36 3300005458 Ga0070681_10032707 Ga0070681_100327074 226
37 3300005458 Ga0070681_10106934 Ga0070681_101069341 226
38 3300005458 Ga0070681_10123201 Ga0070681_101232013 226
39 3300005458 Ga0070681_10132732 Ga0070681_101327322 226
40 3300005458 Ga0070681_10149121 Ga0070681_101491213 226
41 3300005458 Ga0070681_10233780 Ga0070681_102337803 226
42 3300005458 Ga0070681_10496961 Ga0070681_104969612 226
43 3300005468 Ga0070707_100000570 Ga0070707_10000057033 226
44 3300005468 Ga0070707_100123638 Ga0070707_1001236382 226
45 3300005468 Ga0070707_100434795 Ga0070707_1004347951 226
46 3300005471 Ga0070698_100307999 Ga0070698_1003079992 226
47 3300005518 Ga0070699_100166587 Ga0070699_1001665872 226
48 3300005530 Ga0070679_100019458 Ga0070679_1000194584 226
49 3300005530 Ga0070679_100155445 Ga0070679_1001554453 226
50 3300005530 Ga0070679_100156105 Ga0070679_1001561054 226
51 3300005530 Ga0070679_100461403 Ga0070679_1004614031 226
52 3300005535 Ga0070684_100023081 Ga0070684_1000230814 226
53 3300005535 Ga0070684_100070847 Ga0070684_1000708473 226
54 3300005536 Ga0070697_100473795 Ga0070697_1004737952 226
55 3300005545 Ga0070695_100000253 Ga0070695_1000002539 226
56 3300005546 Ga0070696_100184619 Ga0070696_1001846193 226
57 3300005548 Ga0070665_100565156 Ga0070665_1005651562 226
58 3300005549 Ga0070704_100067894 Ga0070704_1000678943 226
59 3300005564 Ga0070664_100628740 Ga0070664_1006287402 226
60 3300006028 Ga0070717_10012809 Ga0070717_100128094 226
61 3300006028 Ga0070717_10042171 Ga0070717_100421714 226
62 3300006028 Ga0070717_10052786 Ga0070717_100527862 226
63 3300006028 Ga0070717_10147034 Ga0070717_101470343 226
64 3300006028 Ga0070717_10366937 Ga0070717_103669371 226
65 3300006175 Ga0070712_100142958 Ga0070712_1001429583 226
66 3300006237 Ga0097621_100431920 Ga0097621_1004319202 226
67 3300009093 Ga0105240_10180280 Ga0105240_101802803 226
68 3300009098 Ga0105245_10009775 Ga0105245_100097751 226
69 3300009545 Ga0105237_10172828 Ga0105237_101728283 226
70 3300009551 Ga0105238_10916165 Ga0105238_109161652 226
71 3300010375 Ga0105239_10178931 Ga0105239_101789313 226
72 3300013100 Ga0157373_10194919 Ga0157373_101949193 226
73 3300013104 Ga0157370_10219331 Ga0157370_102193312 226
74 3300013307 Ga0157372_10232874 Ga0157372_102328743 226
75 3300014497 Ga0182008_10008509 Ga0182008_100085094 226
76 3300015261 Ga0182006_1012923 Ga0182006_10129235 226
77 3300015262 Ga0182007_10023948 Ga0182007_100239483 226
78 3300020070 Ga0206356_10625959 Ga0206356_106259593 226
79 3300020082 Ga0206353_10162256 Ga0206353_101622564 226
80 3300021441 Ga0213871_10084399 Ga0213871_100843992 226
81 3300025898 Ga0207692_10176680 Ga0207692_101766802 226
82 3300025906 Ga0207699_10019672 Ga0207699_100196723 226
83 3300025906 Ga0207699_10130132 Ga0207699_101301323 226
84 3300025909 Ga0207705_10042863 Ga0207705_100428634 226
85 3300025909 Ga0207705_10102409 Ga0207705_101024092 226
86 3300025909 Ga0207705_10309375 Ga0207705_103093752 226
87 3300025910 Ga0207684_10258792 Ga0207684_102587923 226
88 3300025912 Ga0207707_10082086 Ga0207707_100820863 226
89 3300025912 Ga0207707_10092825 Ga0207707_100928253 226
90 3300025912 Ga0207707_10092918 Ga0207707_100929184 226
91 3300025912 Ga0207707_10151884 Ga0207707_101518843 226
92 3300025912 Ga0207707_10610682 Ga0207707_106106822 226
93 3300025913 Ga0207695_10071466 Ga0207695_100714664 226
94 3300025913 Ga0207695_10647346 Ga0207695_106473462 226
95 3300025914 Ga0207671_10083040 Ga0207671_100830403 226
96 3300025915 Ga0207693_10002559 Ga0207693_1000255917 226
97 3300025915 Ga0207693_10029601 Ga0207693_100296014 226
98 3300025915 Ga0207693_10188205 Ga0207693_101882051 226
99 3300025915 Ga0207693_10321922 Ga0207693_103219222 226
100 3300025915 Ga0207693_10326076 Ga0207693_103260762 226
101 3300025915 Ga0207693_10741736 Ga0207693_107417361 226
102 3300025916 Ga0207663_10002881 Ga0207663_100028815 226
103 3300025917 Ga0207660_10162806 Ga0207660_101628063 226
104 3300025919 Ga0207657_10009662 Ga0207657_1000966211 226
105 3300025919 Ga0207657_10015304 Ga0207657_1001530410 226
106 3300025921 Ga0207652_10044820 Ga0207652_100448205 226
107 3300025921 Ga0207652_10080649 Ga0207652_100806492 226
108 3300025921 Ga0207652_10119256 Ga0207652_101192563 226
109 3300025921 Ga0207652_10462878 Ga0207652_104628782 226
110 3300025922 Ga0207646_10000371 Ga0207646_1000037165 226
111 3300025922 Ga0207646_10057680 Ga0207646_100576803 226
112 3300025928 Ga0207700_10035417 Ga0207700_100354173 226
113 3300025928 Ga0207700_10084679 Ga0207700_100846792 226
114 3300025929 Ga0207664_10034890 Ga0207664_100348905 226
115 3300025929 Ga0207664_10058331 Ga0207664_100583315 226
116 3300025929 Ga0207664_10059139 Ga0207664_100591392 226
117 3300025929 Ga0207664_10514429 Ga0207664_105144292 226
118 3300025932 Ga0207690_10075425 Ga0207690_100754254 226
119 3300025939 Ga0207665_10009528 Ga0207665_100095285 226
120 3300025944 Ga0207661_10220261 Ga0207661_102202613 226
121 3300025944 Ga0207661_10479975 Ga0207661_104799752 226
122 3300025945 Ga0207679_10580045 Ga0207679_105800452 226
123 3300026023 Ga0207677_10771548 Ga0207677_107715482 226
124 3300026035 Ga0207703_10804221 Ga0207703_108042211 226
125 3300026067 Ga0207678_10305159 Ga0207678_103051593 226
126 3300026121 Ga0207683_10621035 Ga0207683_106210351 226
127 3300028556 Ga0265337_1081467 Ga0265337_10814672 226
128 3300028563 Ga0265319_1001506 Ga0265319_10015068 226
129 3300028573 Ga0265334_10095610 Ga0265334_100956102 226
130 3300028577 Ga0265318_10003550 Ga0265318_100035508 226
131 3300028654 Ga0265322_10054849 Ga0265322_100548492 226
132 3300028800 Ga0265338_10006178 Ga0265338_100061788 226
133 3300028800 Ga0265338_10010646 Ga0265338_100106466 226
134 3300028800 Ga0265338_10020910 Ga0265338_100209107 226
135 3300028800 Ga0265338_10023514 Ga0265338_100235142 226
136 3300031235 Ga0265330_10008056 Ga0265330_100080564 226
137 3300031235 Ga0265330_10161682 Ga0265330_101616822 226
138 3300031238 Ga0265332_10092006 Ga0265332_100920062 226
139 3300031239 Ga0265328_10120277 Ga0265328_101202771 226
140 3300031240 Ga0265320_10092187 Ga0265320_100921872 226
141 3300031242 Ga0265329_10019552 Ga0265329_100195523 226
142 3300031247 Ga0265340_10050887 Ga0265340_100508873 226
143 3300031247 Ga0265340_10086174 Ga0265340_100861742 226
144 3300031251 Ga0265327_10009229 Ga0265327_100092293 226
145 3300031251 Ga0265327_10048597 Ga0265327_100485973 226
146 3300031344 Ga0265316_10020572 Ga0265316_100205726 226
147 3300031711 Ga0265314_10006166 Ga0265314_100061667 226
148 3300031711 Ga0265314_10008434 Ga0265314_100084343 226
149 3300031712 Ga0265342_10010787 Ga0265342_100107874 226
150 3300031712 Ga0265342_10016006 Ga0265342_100160066 226
151 3300032133 Ga0316583_10028303 Ga0316583_100283032 226
152 3300035086 Ga0373934_0143557 Ga0373934_0143557_38_733 226
153 3300035116 Ga0373945_0002469 Ga0373945_0002469_4634_5314 226
154 3300035172 Ga0373955_0055386 Ga0373955_0055386_883_1578 226
155 3300035692 Ga0373935_0103661 Ga0373935_0103661_1189_1869 226
156 3300035724 Ga0373933_0057624 Ga0373933_0057624_1266_1961 226
157 3300035725 Ga0373947_0006051 Ga0373947_0006051_5847_6527 226
158 3300036401 Ga0373937_0078927 Ga0373937_0078927_1072_1767 226
159 3300037068 Ga0373925_0003168 Ga0373925_0003168_342_1022 226
160 3300037312 Ga0395899_0014999 Ga0395899_0014999_1201_1896 226
161 3300037312 Ga0395899_0224379 Ga0395899_0224379_232_912 226
162 3300037312 Ga0395899_0361997 Ga0395899_0361997_220_900 226
163 3300037418 Ga0395900_0046890 Ga0395900_0046890_2888_3583 226
164 3300037418 Ga0395900_0151617 Ga0395900_0151617_750_1430 226
165 3300037418 Ga0395900_0226912 Ga0395900_0226912_425_1105 226
166 3300037418 Ga0395900_0287821 Ga0395900_0287821_863_1558 226
167 3300037466 Ga0395898_0035110 Ga0395898_0035110_3648_4328 226
168 3300037466 Ga0395898_0072543 Ga0395898_0072543_15_710 226
169 3300037466 Ga0395898_0163172 Ga0395898_0163172_225_905 226
170 3300037466 Ga0395898_0639218 Ga0395898_0639218_101_781 226
171 3300037471 Ga0395905_0320176 Ga0395905_0320176_231_911 226
172 3300037471 Ga0395905_0591049 Ga0395905_0591049_268_948 226
173 3300038443 Ga0395901_0135721 Ga0395901_0135721_1203_1883 226
174 3300038443 Ga0395901_0286259 Ga0395901_0286259_278_958 226
175 3300038443 Ga0395901_0479780 Ga0395901_0479780_538_1218 226
176 3300039438 Ga0436360_1015244 Ga0436360_1015244_1996_2676 226
177 3300039438 Ga0436360_1281619 Ga0436360_1281619_149_829 226
178 3300044683 Ga0466965_0158005 Ga0466965_0158005_112_792 226
179 3300044684 Ga0466966_0020298 Ga0466966_0020298_1777_2457 226
180 3300044684 Ga0466966_0383595 Ga0466966_0383595_64_744 226
181 3300044693 Ga0466961_0003166 Ga0466961_0003166_1209_1889 226
182 3300044693 Ga0466961_0017573 Ga0466961_0017573_3411_4091 226
183 3300044693 Ga0466961_0068244 Ga0466961_0068244_395_1075 226
184 3300044693 Ga0466961_0490754 Ga0466961_0490754_12_692 226
185 3300044694 Ga0466963_0000048 Ga0466963_0000048_35568_36248 226
186 3300044694 Ga0466963_0000967 Ga0466963_0000967_4241_4921 226
187 3300044694 Ga0466963_0001327 Ga0466963_0001327_4008_4688 226
188 3300044694 Ga0466963_0002800 Ga0466963_0002800_700_1380 226
189 3300044694 Ga0466963_0010395 Ga0466963_0010395_1240_1920 226
190 3300044694 Ga0466963_0032079 Ga0466963_0032079_1862_2542 226
191 3300044694 Ga0466963_0044907 Ga0466963_0044907_1633_2313 226
192 3300044694 Ga0466963_0126622 Ga0466963_0126622_387_1067 226
193 3300044706 Ga0466964_0000548 Ga0466964_0000548_3137_3817 226
194 3300044706 Ga0466964_0004529 Ga0466964_0004529_1131_1811 226
195 3300044706 Ga0466964_0034017 Ga0466964_0034017_596_1276 226
196 3300044706 Ga0466964_0061800 Ga0466964_0061800_297_977 226
197 3300044719 Ga0466971_0002619 Ga0466971_0002619_307_987 226
198 3300044719 Ga0466971_0068180 Ga0466971_0068180_628_1308 226
199 3300044842 Ga0466957_0002205 Ga0466957_0002205_5613_6293 226
200 3300044842 Ga0466957_0034547 Ga0466957_0034547_1631_2311 226
201 3300044842 Ga0466957_0039772 Ga0466957_0039772_553_1233 226
202 3300044842 Ga0466957_0079894 Ga0466957_0079894_819_1514 226
203 3300044842 Ga0466957_0121187 Ga0466957_0121187_962_1642 226
204 3300044842 Ga0466957_0176181 Ga0466957_0176181_310_1005 226
205 3300044842 Ga0466957_0205699 Ga0466957_0205699_489_1169 226
206 3300044842 Ga0466957_0342037 Ga0466957_0342037_160_840 226
207 3300044901 Ga0466960_0411347 Ga0466960_0411347_29_718 226
208 3300045049 Ga0466959_0035689 Ga0466959_0035689_1459_2139 226
209 3300045836 Ga0466958_0001308 Ga0466958_0001308_3672_4352 226
210 3300045836 Ga0466958_0003345 Ga0466958_0003345_1006_1686 226
211 3300045836 Ga0466958_0005432 Ga0466958_0005432_3317_3997 226
212 3300045836 Ga0466958_0011964 Ga0466958_0011964_3332_4027 226
213 3300045836 Ga0466958_0041709 Ga0466958_0041709_130_810 226
214 3300045836 Ga0466958_0123235 Ga0466958_0123235_727_1407 226
215 3300045836 Ga0466958_0332364 Ga0466958_0332364_281_961 226
216 3300045836 Ga0466958_0374707 Ga0466958_0374707_45_740 226
217 3300045976 Ga0466967_0000041 Ga0466967_0000041_16636_17316 226
218 3300045976 Ga0466967_0000056 Ga0466967_0000056_3649_4344 226
219 3300045976 Ga0466967_0001136 Ga0466967_0001136_5574_6254 226
220 3300045976 Ga0466967_0009556 Ga0466967_0009556_5156_5836 226
221 3300045976 Ga0466967_0010119 Ga0466967_0010119_4055_4735 226
222 3300045976 Ga0466967_0016342 Ga0466967_0016342_2222_2902 226
223 3300045976 Ga0466967_0025487 Ga0466967_0025487_2479_3159 226
224 3300045976 Ga0466967_0041038 Ga0466967_0041038_1919_2599 226
225 3300045976 Ga0466967_0064089 Ga0466967_0064089_1438_2118 226
226 3300045976 Ga0466967_0098590 Ga0466967_0098590_1086_1766 226
227 3300045976 Ga0466967_0122876 Ga0466967_0122876_1145_1825 226
228 3300045976 Ga0466967_0160582 Ga0466967_0160582_1034_1714 226
229 3300045976 Ga0466967_0227351 Ga0466967_0227351_252_932 226
230 3300045976 Ga0466967_0306646 Ga0466967_0306646_766_1446 226
231 3300045976 Ga0466967_0311842 Ga0466967_0311842_818_1498 226
232 3300045976 Ga0466967_0337080 Ga0466967_0337080_582_1277 226
233 3300045976 Ga0466967_1265375 Ga0466967_1265375_13_693 226
234 3300046454 Ga0495592_0293713 Ga0495592_0293713_171_851 226
235 3300046459 Ga0495629_0308517 Ga0495629_0308517_66_761 226
236 3300046461 Ga0495641_0158729 Ga0495641_0158729_217_897 226
237 3300046462 Ga0495651_0030418 Ga0495651_0030418_1199_1894 226
238 3300046462 Ga0495651_0060470 Ga0495651_0060470_596_1276 226
239 3300046463 Ga0495653_0012796 Ga0495653_0012796_522_1217 226
240 3300046463 Ga0495653_0097907 Ga0495653_0097907_300_980 226
241 3300046463 Ga0495653_0167405 Ga0495653_0167405_429_1109 226
242 3300046463 Ga0495653_0184709 Ga0495653_0184709_55_735 226
243 3300046463 Ga0495653_0211775 Ga0495653_0211775_361_1041 226
244 3300046472 Ga0495580_0005739 Ga0495580_0005739_2102_2782 226
245 3300046475 Ga0495639_0002012 Ga0495639_0002012_7416_8096 226
246 3300046476 Ga0495662_0031529 Ga0495662_0031529_1180_1860 226
247 3300046477 Ga0495664_0002458 Ga0495664_0002458_382_1062 226
248 3300046511 Ga0495608_0042314 Ga0495608_0042314_2250_2945 226
249 3300046511 Ga0495608_0045018 Ga0495608_0045018_914_1594 226
250 3300046511 Ga0495608_0193870 Ga0495608_0193870_406_1101 226
251 3300046511 Ga0495608_0231508 Ga0495608_0231508_316_996 226
252 3300046514 Ga0495618_0088590 Ga0495618_0088590_894_1589 226
253 3300046514 Ga0495618_0116266 Ga0495618_0116266_861_1541 226
254 3300046514 Ga0495618_0145449 Ga0495618_0145449_172_852 226
255 3300046516 Ga0495628_0034140 Ga0495628_0034140_3266_3946 226
256 3300046517 Ga0495630_0009935 Ga0495630_0009935_5847_6527 226
257 3300046517 Ga0495630_0164026 Ga0495630_0164026_525_1205 226
258 3300046517 Ga0495630_0193791 Ga0495630_0193791_604_1284 226
259 3300046526 Ga0495666_0001833 Ga0495666_0001833_1036_1716 226
260 3300046531 Ga0495665_0001146 Ga0495665_0001146_12879_13559 226
261 3300046535 Ga0495586_0009376 Ga0495586_0009376_4150_4830 226
262 3300046543 Ga0495645_0114423 Ga0495645_0114423_554_1234 226
263 3300046559 Ga0495667_0019599 Ga0495667_0019599_3240_3920 226
264 3300046559 Ga0495667_0043796 Ga0495667_0043796_1717_2412 226
265 3300046559 Ga0495667_0103228 Ga0495667_0103228_259_939 226
266 3300046559 Ga0495667_0124332 Ga0495667_0124332_336_1016 226
267 3300046642 Ga0495634_0009599 Ga0495634_0009599_2015_2710 226
268 3300046642 Ga0495634_0030991 Ga0495634_0030991_2645_3325 226
269 3300046663 Ga0495635_0142414 Ga0495635_0142414_576_1256 226
270 3300046663 Ga0495635_0186492 Ga0495635_0186492_576_1271 226
271 3300046675 Ga0495657_0027126 Ga0495657_0027126_2979_3674 226
272 3300046675 Ga0495657_0054861 Ga0495657_0054861_628_1308 226
273 3300046678 Ga0495599_0051142 Ga0495599_0051142_1843_2523 226
274 3300046680 Ga0495646_0191961 Ga0495646_0191961_266_946 226
275 3300046681 Ga0495647_0000409 Ga0495647_0000409_604_1284 226
276 3300046683 Ga0495658_0001411 Ga0495658_0001411_11031_11711 226
277 3300046689 Ga0495613_0015455 Ga0495613_0015455_1692_2372 226
278 3300046689 Ga0495613_0401145 Ga0495613_0401145_75_770 226
279 3300046690 Ga0495624_0001586 Ga0495624_0001586_911_1591 226
280 3300046690 Ga0495624_0032405 Ga0495624_0032405_965_1645 226
281 3300046809 Ga0495600_0154298 Ga0495600_0154298_285_980 226
282 3300047315 Ga0495581_0000855 Ga0495581_0000855_14870_15550 226
283 3300047317 Ga0495604_0166789 Ga0495604_0166789_592_1272 226
284 3300047319 Ga0495674_0011237 Ga0495674_0011237_911_1591 226
285 3300047319 Ga0495674_0198236 Ga0495674_0198236_408_1088 226
286 3300047319 Ga0495674_0292541 Ga0495674_0292541_530_1225 226
287 3300047321 Ga0495676_0013093 Ga0495676_0013093_5838_6518 226
288 3300047321 Ga0495676_0335414 Ga0495676_0335414_308_988 226
289 3300047444 Ga0495675_0085883 Ga0495675_0085883_1055_1750 226
290 3300047471 Ga0495684_0004610 Ga0495684_0004610_4119_4799 226
291 3300047471 Ga0495684_0012175 Ga0495684_0012175_1336_2016 226
292 3300047471 Ga0495684_0036579 Ga0495684_0036579_2159_2854 226
293 3300047673 Ga0495593_0000420 Ga0495593_0000420_22790_23470 226
294 3300048089 Ga0495614_0000273 Ga0495614_0000273_9890_10570 226
295 3300048903 Ga0496100_0428186 Ga0496100_0428186_42_737 226
296 3300048904 Ga0496101_0180543 Ga0496101_0180543_212_892 226
297 3300048905 Ga0496102_0125468 Ga0496102_0125468_65_760 226
298 3300048905 Ga0496102_0181644 Ga0496102_0181644_280_960 226
299 3300048905 Ga0496102_0298343 Ga0496102_0298343_564_1244 226
300 3300048907 Ga0496104_0007553 Ga0496104_0007553_3127_3807 226
301 3300048907 Ga0496104_0834369 Ga0496104_0834369_121_801 226
302 3300048908 Ga0496105_0004615 Ga0496105_0004615_9513_10193 226
303 3300048908 Ga0496105_0056268 Ga0496105_0056268_71_751 226
304 3300048909 Ga0496106_0002736 Ga0496106_0002736_1961_2656 226
305 3300048910 Ga0496107_0004538 Ga0496107_0004538_2475_3170 226
306 3300048910 Ga0496107_0445436 Ga0496107_0445436_250_930 226
307 3300048911 Ga0496108_0132376 Ga0496108_0132376_1172_1852 226
308 3300048912 Ga0496109_0010128 Ga0496109_0010128_1305_2000 226
309 3300048912 Ga0496109_0091756 Ga0496109_0091756_483_1163 226
310 3300048912 Ga0496109_0136341 Ga0496109_0136341_879_1559 226
311 3300048913 Ga0496110_0014684 Ga0496110_0014684_1836_2531 226
312 3300048913 Ga0496110_0168575 Ga0496110_0168575_1016_1696 226
313 3300048914 Ga0496111_0255455 Ga0496111_0255455_493_1188 226
314 3300048914 Ga0496111_0488058 Ga0496111_0488058_112_792 226
315 3300048914 Ga0496111_0511830 Ga0496111_0511830_51_731 226
316 3300048915 Ga0496112_0003763 Ga0496112_0003763_3079_3774 226
317 3300048915 Ga0496112_0065565 Ga0496112_0065565_2498_3193 226
318 3300048915 Ga0496112_0130281 Ga0496112_0130281_1482_2177 226
319 3300048916 Ga0496113_0398751 Ga0496113_0398751_345_1040 226
320 3300048917 Ga0496114_0295165 Ga0496114_0295165_47_727 226
321 3300048917 Ga0496114_0394305 Ga0496114_0394305_490_1170 226
322 3300048917 Ga0496114_0673800 Ga0496114_0673800_21_716 226
323 3300048918 Ga0496115_0014102 Ga0496115_0014102_4911_5591 226
324 3300049571 Ga0501034_0050743 Ga0501034_0050743_494_1174 226
325 3300049581 Ga0501047_0351479 Ga0501047_0351479_337_1017 226
326 3300049583 Ga0501067_0024113 Ga0501067_0024113_226_906 226
327 3300049583 Ga0501067_0058895 Ga0501067_0058895_1248_1928 226
328 3300049583 Ga0501067_0068225 Ga0501067_0068225_520_1215 226
329 3300049583 Ga0501067_0074363 Ga0501067_0074363_686_1366 226
330 3300049585 Ga0501069_0005142 Ga0501069_0005142_522_1202 226
331 3300049585 Ga0501069_0044655 Ga0501069_0044655_1318_1998 226
332 3300049585 Ga0501069_0143556 Ga0501069_0143556_151_831 226
333 3300049586 Ga0501070_0057816 Ga0501070_0057816_1669_2349 226
334 3300049586 Ga0501070_0170893 Ga0501070_0170893_249_929 226
335 3300049588 Ga0501072_0003578 Ga0501072_0003578_1132_1812 226
336 3300049589 Ga0501073_0006396 Ga0501073_0006396_5885_6565 226
337 3300049590 Ga0501074_0044191 Ga0501074_0044191_1683_2363 226
338 3300049590 Ga0501074_0137243 Ga0501074_0137243_646_1326 226
339 3300049742 Ga0501080_0018701 Ga0501080_0018701_2797_3477 226
340 3300049744 Ga0501083_0000290 Ga0501083_0000290_4919_5599 226
341 3300049744 Ga0501083_0328701 Ga0501083_0328701_248_928 226
342 3300050512 nmdc:mga0n895_4986_c1 nmdc:mga0n895_4986_c1_766_1446 226
343 3300050513 nmdc:mga0rr50_22727_c1 nmdc:mga0rr50_22727_c1_1526_2206 226
344 3300053077 Ga0495601_0037198 Ga0495601_0037198_1072_1752 226
345 3300053084 Ga0495595_0004782 Ga0495595_0004782_2458_3153 226
346 3300053084 Ga0495595_0033428 Ga0495595_0033428_1326_2006 226
347 3300053085 Ga0495619_0161170 Ga0495619_0161170_49_729 226
348 3300053085 Ga0495619_0198632 Ga0495619_0198632_171_851 226
349 3300061719 Ga0466962_0006487 Ga0466962_0006487_2775_3455 226
350 3300061719 Ga0466962_0006824 Ga0466962_0006824_2505_3185 226
351 3300061719 Ga0466962_0028637 Ga0466962_0028637_1938_2618 226
352 3300061719 Ga0466962_0069210 Ga0466962_0069210_78_758 226
353 3300005435 Ga0070714_100145945 Ga0070714_1001459454 227
354 3300005435 Ga0070714_100166254 Ga0070714_1001662543 227
355 3300006028 Ga0070717_10006656 Ga0070717_100066567 227
356 3300025928 Ga0207700_10138634 Ga0207700_101386343 227
357 3300025929 Ga0207664_10004888 Ga0207664_100048884 227
358 3300025929 Ga0207664_10091187 Ga0207664_100911873 227
359 3300044656 Ga0466969_0016387 Ga0466969_0016387_2454_3137 227
360 3300044719 Ga0466971_0001693 Ga0466971_0001693_4947_5630 227
361 3300044842 Ga0466957_0052370 Ga0466957_0052370_32_715 227
362 3300045836 Ga0466958_0000428 Ga0466958_0000428_6579_7262 227
363 3300048915 Ga0496112_0234255 Ga0496112_0234255_899_1582 227
364 3300005327 Ga0070658_10041042 Ga0070658_100410422 228
365 3300005329 Ga0070683_100042475 Ga0070683_1000424754 228
366 3300005336 Ga0070680_100422080 Ga0070680_1004220801 228
367 3300005339 Ga0070660_100036640 Ga0070660_1000366405 228
368 3300005435 Ga0070714_100216149 Ga0070714_1002161491 228
369 3300005471 Ga0070698_100015489 Ga0070698_1000154898 228
370 3300005530 Ga0070679_100241496 Ga0070679_1002414963 228
371 3300005535 Ga0070684_100202362 Ga0070684_1002023622 228
372 3300005539 Ga0068853_100476887 Ga0068853_1004768873 228
373 3300005563 Ga0068855_100052596 Ga0068855_1000525966 228
374 3300005616 Ga0068852_100317143 Ga0068852_1003171434 228
375 3300009093 Ga0105240_10050080 Ga0105240_100500806 228
376 3300009551 Ga0105238_10074304 Ga0105238_100743045 228
377 3300013100 Ga0157373_10256485 Ga0157373_102564851 228
378 3300013104 Ga0157370_10008749 Ga0157370_1000874911 228
379 3300020069 Ga0197907_10559547 Ga0197907_105595476 228
380 3300020070 Ga0206356_11016126 Ga0206356_110161266 228
381 3300020081 Ga0206354_10799421 Ga0206354_107994212 228
382 3300020082 Ga0206353_11396466 Ga0206353_113964664 228
383 3300025919 Ga0207657_10001344 Ga0207657_1000134430 228
384 3300025929 Ga0207664_10038111 Ga0207664_100381115 228
385 3300025944 Ga0207661_10107205 Ga0207661_101072054 228
386 3300025949 Ga0207667_10061417 Ga0207667_100614177 228
387 3300026041 Ga0207639_10376102 Ga0207639_103761023 228
388 3300026142 Ga0207698_10277802 Ga0207698_102778022 228
389 3300044842 Ga0466957_0105433 Ga0466957_0105433_41_727 228
390 3300045049 Ga0466959_0612177 Ga0466959_0612177_34_720 228
391 3300061719 Ga0466962_0070208 Ga0466962_0070208_56_742 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

56

256

0.87

PF01965

DJ-1_PfpI

DJ-1/PfpI family

84

158

0.86

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

58

154

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9399 4 216
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9229 4 216
3ujn-assembly1.cif.gz_A formyl glycinamide ribonucleotide amidotransferase from salmonella typhimurium : role of the atp complexation and glutaminase domain in catalytic coupling 0.8632 4 218
4r7g-assembly1.cif.gz_A determination of the formylglycinamide ribonucleotide amidotransferase ammonia pathway by combining 3d-rism theory with experiment 0.8601 4 217
4lgy-assembly1.cif.gz_A importance of hydrophobic cavities in allosteric regulation of formylglycinamide synthetase: insight from xenon trapping and statistical coupling analysis 0.8523 4 217
ID Description Score Start End Superfamily
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.95 4 218 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9471 7 218 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9409 7 219 3.40.50.880
3d54L00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.94 4 216 3.40.50.880
3d54L00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.923 4 216 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7V9P6S3-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9656 78 225 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A6J7KM29-F1-model_v4 Unannotated protein 0.9642 74 227 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A6J6JNV2-F1-model_v4 Unannotated protein 0.964 74 216 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A7Z8PE90-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9599 90 216 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A5E6MCS1-F1-model_v4 Partial phosphoribosylformylglycinamidine synthase (EC 6.3.5.3) 0.9587 71 214 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787

Feature Viewer

pLDDT pTM Quality
91.38 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map