F432575

General Info

Members Datasets Scaffolds Average Seq Length
393 189 786 338

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10041224|Ga0114129_100412243
Length 362
Sequence VAVDFPAKASYSLKTPSIMAKPNHAFLAACRREHSSYTPVWLMRQAGRYMEEYRKLRAQYDFLELCKKPDLAAEITITPVERLGVDAAILFADILLVLEPMGVGLEYSKNGGPVIHHPVRSGKDVDNLKDFDPQQELSFVYDAVKKISKTLKNKVPLIGFAGAPFTLASYLIEGGGSRNYVHTKKLFYGTPEAWKRLMERLAKVVAEYLNCQIAAGAEAVQLFDSWAGCLTPTDYEQFVLPYTKAVIDAITPGVPVINFSTGTAGLLKQIRAAGGDVIGLDWRVNLDEGWGMLGHDVAVQGNLDPVALFASPKDIKARVADVLRRADGRPGHIFNLGHGVLPETPVDHVIAMVDAVHEMSSR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
121 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
189 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 1.27
Rhizosphere 97.96
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10041224 3300009147 Bacteria 6507
2 Ga0065704_10008079 3300005289 Bacteria 2578
3 Ga0065712_10000212 3300005290 Bacteria 30259
4 Ga0065712_10001923 3300005290 Bacteria 5407
5 Ga0065715_10009635 3300005293 Bacteria 2276
6 Ga0065715_10092218 3300005293 Bacteria 5247
7 Ga0070676_10015131 3300005328 Bacteria 4253
8 Ga0070690_100054775 3300005330 Bacteria 2553
9 Ga0070670_100005432 3300005331 Bacteria 10747
10 Ga0070670_100354814 3300005331 Bacteria 1288
11 Ga0068869_100003667 3300005334 Bacteria 9439
12 Ga0070680_100062755 3300005336 Bacteria 3043
13 Ga0070691_10048528 3300005341 Bacteria 2021
14 Ga0070661_100023433 3300005344 Bacteria 4424
15 Ga0070692_10214652 3300005345 Bacteria 1134
16 Ga0070667_100257722 3300005367 Bacteria 1561
17 Ga0070703_10001717 3300005406 Bacteria 6501
18 Ga0070703_10009921 3300005406 Bacteria 2687
19 Ga0070701_10047626 3300005438 Bacteria 2208
20 Ga0070711_100000132 3300005439 Bacteria 39959
21 Ga0070705_100005153 3300005440 Bacteria 6344
22 Ga0070705_100019280 3300005440 Bacteria 3589
23 Ga0070705_100029388 3300005440 Bacteria 3022
24 Ga0070705_100060617 3300005440 Bacteria 2245
25 Ga0070694_100010404 3300005444 Bacteria 5740
26 Ga0070694_100033554 3300005444 Bacteria 3378
27 Ga0070708_100006773 3300005445 Bacteria 9127
28 Ga0070708_100026592 3300005445 Bacteria 4955
29 Ga0070708_100030000 3300005445 Bacteria 4696
30 Ga0070678_100048049 3300005456 Bacteria 3070
31 Ga0070681_10079082 3300005458 Bacteria 3245
32 Ga0070681_10134494 3300005458 Bacteria 2403
33 Ga0068867_100095662 3300005459 Bacteria 2260
34 Ga0068867_100188090 3300005459 Bacteria 1646
35 Ga0070685_10001536 3300005466 Bacteria 12169
36 Ga0070706_100020758 3300005467 Bacteria 6049
37 Ga0070706_100057594 3300005467 Bacteria 3586
38 Ga0070707_100010512 3300005468 Bacteria 8623
39 Ga0070707_100024174 3300005468 Bacteria 5751
40 Ga0070707_100180844 3300005468 Bacteria 2056
41 Ga0070707_100285754 3300005468 Bacteria 1603
42 Ga0070707_100457185 3300005468 Bacteria 1237
43 Ga0070698_100001479 3300005471 Bacteria 26097
44 Ga0070698_100003277 3300005471 Bacteria 17785
45 Ga0070698_100054371 3300005471 Bacteria 4064
46 Ga0070698_100085509 3300005471 Bacteria 3141
47 Ga0070698_100160294 3300005471 Bacteria 2194
48 Ga0070698_100301037 3300005471 Bacteria 1534
49 Ga0070699_100013663 3300005518 Bacteria 6986
50 Ga0070699_100021117 3300005518 Bacteria 5612
51 Ga0070699_100025975 3300005518 Bacteria 5051
52 Ga0070699_100028815 3300005518 Bacteria 4787
53 Ga0070699_100029581 3300005518 Bacteria 4724
54 Ga0070699_100057489 3300005518 Bacteria 3369
55 Ga0070699_100060811 3300005518 Bacteria 3273
56 Ga0070699_100126996 3300005518 Bacteria 2246
57 Ga0070699_100291563 3300005518 Bacteria 1463
58 Ga0070699_100460675 3300005518 Bacteria 1153
59 Ga0070679_100011149 3300005530 Bacteria 8561
60 Ga0070697_100024912 3300005536 Bacteria 4766
61 Ga0070697_100026100 3300005536 Bacteria 4663
62 Ga0070697_100050259 3300005536 Bacteria 3384
63 Ga0070697_100065539 3300005536 Bacteria 2968
64 Ga0070697_100220799 3300005536 Bacteria 1615
65 Ga0070697_100276370 3300005536 Bacteria 1440
66 Ga0068853_100317517 3300005539 Bacteria 1444
67 Ga0068853_100354060 3300005539 Bacteria 1366
68 Ga0070672_100314271 3300005543 Bacteria 1330
69 Ga0070695_100019018 3300005545 Bacteria 4176
70 Ga0070695_100066434 3300005545 Bacteria 2351
71 Ga0070695_100066939 3300005545 Bacteria 2342
72 Ga0070695_100069339 3300005545 Bacteria 2304
73 Ga0070695_100100794 3300005545 Bacteria 1944
74 Ga0070695_100199030 3300005545 Bacteria 1430
75 Ga0070696_100002744 3300005546 Bacteria 11684
76 Ga0070696_100039500 3300005546 Bacteria 3258
77 Ga0070696_100042113 3300005546 Bacteria 3157
78 Ga0070696_100118041 3300005546 Bacteria 1917
79 Ga0070693_100066474 3300005547 Bacteria 2110
80 Ga0070665_100296911 3300005548 Unclassified 1618
81 Ga0070704_100000065 3300005549 Bacteria 34530
82 Ga0070704_100027787 3300005549 Bacteria 3757
83 Ga0070704_100261634 3300005549 Bacteria 1426
84 Ga0070704_100309256 3300005549 Bacteria 1320
85 Ga0068855_100018798 3300005563 Bacteria 8305
86 Ga0070664_100011835 3300005564 Bacteria 7082
87 Ga0070664_100198206 3300005564 Bacteria 1791
88 Ga0068857_100006911 3300005577 Bacteria 9770
89 Ga0068854_100085324 3300005578 Bacteria 2338
90 Ga0070702_100018973 3300005615 Bacteria 3577
91 Ga0068870_10008103 3300005840 Bacteria 4710
92 Ga0068863_100167593 3300005841 Bacteria 2106
93 Ga0068863_100377989 3300005841 Bacteria 1383
94 Ga0068862_100036099 3300005844 Bacteria 4188
95 Ga0068862_100234867 3300005844 Bacteria 1665
96 Ga0081455_10002129 3300005937 Bacteria 23609
97 Ga0081455_10108954 3300005937 Bacteria 2205
98 Ga0081538_10013736 3300005981 Bacteria 6395
99 Ga0070716_100000865 3300006173 Bacteria 13038
100 Ga0070716_100001751 3300006173 Bacteria 9807
101 Ga0070716_100012356 3300006173 Bacteria 4327
102 Ga0070712_100004036 3300006175 Bacteria 9008
103 Ga0075428_100108835 3300006844 Bacteria 3020
104 Ga0075428_100135975 3300006844 Bacteria 2672
105 Ga0075428_100363399 3300006844 Bacteria 1552
106 Ga0075431_100000900 3300006847 Bacteria 26186
107 Ga0075431_100006870 3300006847 Bacteria 11306
108 Ga0075431_100060958 3300006847 Bacteria 3893
109 Ga0075431_100210390 3300006847 Bacteria 1987
110 Ga0075433_10010612 3300006852 Bacteria 7406
111 Ga0075433_10017059 3300006852 Bacteria 6003
112 Ga0075433_10020785 3300006852 Bacteria 5495
113 Ga0075433_10024265 3300006852 Bacteria 5115
114 Ga0075433_10030398 3300006852 Bacteria 4608
115 Ga0075433_10186887 3300006852 Bacteria 1843
116 Ga0075434_100001037 3300006871 Bacteria 22656
117 Ga0075434_100001884 3300006871 Bacteria 18155
118 Ga0075434_100004576 3300006871 Bacteria 12496
119 Ga0075434_100009445 3300006871 Bacteria 9093
120 Ga0075434_100022776 3300006871 Bacteria 6100
121 Ga0075434_100036488 3300006871 Bacteria 4862
122 Ga0075434_100041239 3300006871 Bacteria 4573
123 Ga0075434_100088900 3300006871 Bacteria 3091
124 Ga0075434_100723964 3300006871 Bacteria 1012
125 Ga0075436_100008743 3300006914 Bacteria 6927
126 Ga0075436_100025048 3300006914 Bacteria 4102
127 Ga0075436_100030710 3300006914 Bacteria 3697
128 Ga0075436_100035720 3300006914 Bacteria 3427
129 Ga0075436_100044283 3300006914 Bacteria 3068
130 Ga0075436_100045252 3300006914 Bacteria 3035
131 Ga0075436_100094785 3300006914 Bacteria 2076
132 Ga0075435_100054201 3300007076 Bacteria 3236
133 Ga0075435_100067191 3300007076 Bacteria 2919
134 Ga0075435_100075663 3300007076 Bacteria 2758
135 Ga0099794_10006530 3300007265 Bacteria 4732
136 Ga0105240_10343245 3300009093 Unclassified 1696
137 Ga0111539_10000916 3300009094 Bacteria 38556
138 Ga0111539_10278896 3300009094 Bacteria 1945
139 Ga0111539_10301820 3300009094 Bacteria 1864
140 Ga0114129_10054070 3300009147 Bacteria 5630
141 Ga0114129_10194635 3300009147 Bacteria 2750
142 Ga0114129_10222347 3300009147 Bacteria 2546
143 Ga0114129_10245446 3300009147 Bacteria 2406
144 Ga0114129_10414584 3300009147 Bacteria 1773
145 Ga0114129_10945629 3300009147 Bacteria 1089
146 Ga0105242_10006567 3300009176 Bacteria 8957
147 Ga0105242_10167185 3300009176 Bacteria 1930
148 Ga0105237_10100236 3300009545 Bacteria 2888
149 Ga0105239_10001856 3300010375 Bacteria 27635
150 Ga0105246_10011468 3300011119 Bacteria 5501
151 Ga0157374_10166708 3300013296 Bacteria 2147
152 Ga0157378_10071632 3300013297 Bacteria 3113
153 Ga0157378_10346141 3300013297 Bacteria 1451
154 Ga0163162_10068683 3300013306 Bacteria 3596
155 Ga0163162_10125036 3300013306 Unclassified 2677
156 Ga0157372_10059884 3300013307 Bacteria 4260
157 Ga0157377_10037442 3300014745 Bacteria 2673
158 Ga0157379_10000178 3300014968 Bacteria 47965
159 Ga0157376_10024155 3300014969 Bacteria 4768
160 Ga0207697_10021710 3300025315 Bacteria 2629
161 Ga0207653_10001767 3300025885 Bacteria 6908
162 Ga0207682_10010984 3300025893 Bacteria 3547
163 Ga0207699_10000873 3300025906 Bacteria 14375
164 Ga0207645_10012706 3300025907 Bacteria 5709
165 Ga0207643_10015370 3300025908 Bacteria 4166
166 Ga0207684_10010389 3300025910 Bacteria 8195
167 Ga0207684_10092690 3300025910 Bacteria 2575
168 Ga0207684_10180471 3300025910 Bacteria 1820
169 Ga0207707_10005570 3300025912 Bacteria 11018
170 Ga0207707_10007946 3300025912 Bacteria 9225
171 Ga0207695_10244119 3300025913 Unclassified 1696
172 Ga0207671_10115957 3300025914 Bacteria 2043
173 Ga0207693_10003550 3300025915 Bacteria 13318
174 Ga0207663_10000034 3300025916 Bacteria 88414
175 Ga0207660_10029161 3300025917 Bacteria 3782
176 Ga0207660_10058102 3300025917 Bacteria 2772
177 Ga0207660_10087351 3300025917 Bacteria 2304
178 Ga0207657_10012591 3300025919 Bacteria 8338
179 Ga0207649_10014009 3300025920 Bacteria 4488
180 Ga0207646_10000921 3300025922 Bacteria 37878
181 Ga0207646_10001472 3300025922 Bacteria 29122
182 Ga0207646_10133454 3300025922 Bacteria 2235
183 Ga0207646_10154373 3300025922 Bacteria 2071
184 Ga0207650_10001233 3300025925 Bacteria 18644
185 Ga0207687_10169493 3300025927 Bacteria 1683
186 Ga0207700_10152868 3300025928 Bacteria 1909
187 Ga0207706_10002680 3300025933 Bacteria 17353
188 Ga0207706_10076364 3300025933 Bacteria 2946
189 Ga0207686_10037854 3300025934 Bacteria 2914
190 Ga0207665_10000917 3300025939 Bacteria 19930
191 Ga0207665_10011995 3300025939 Bacteria 5692
192 Ga0207665_10012204 3300025939 Bacteria 5642
193 Ga0207665_10189790 3300025939 Bacteria 1492
194 Ga0207689_10031342 3300025942 Bacteria 4427
195 Ga0207679_10009000 3300025945 Bacteria 6381
196 Ga0207712_10047693 3300025961 Bacteria 2975
197 Ga0207658_10216707 3300025986 Bacteria 1608
198 Ga0207678_10015107 3300026067 Bacteria 6792
199 Ga0207708_10018264 3300026075 Bacteria 5279
200 Ga0207708_10050209 3300026075 Bacteria 3176
201 Ga0207708_10095714 3300026075 Bacteria 2293
202 Ga0207641_10105257 3300026088 Bacteria 2492
203 Ga0207648_10062700 3300026089 Bacteria 3241
204 Ga0207674_10006800 3300026116 Bacteria 13419
205 Ga0207675_100099978 3300026118 Bacteria 2732
206 Ga0207675_100491750 3300026118 Bacteria 1220
207 Ga0209588_1003748 3300027671 Bacteria 4231
208 Ga0209971_1000668 3300027682 Bacteria 8922
209 Ga0207428_10002620 3300027907 Bacteria 17942
210 Ga0268266_10005277 3300028379 Bacteria 12132
211 Ga0268265_10006214 3300028380 Bacteria 8094
212 Ga0268265_10063030 3300028380 Bacteria 2851
213 Ga0268265_10109890 3300028380 Bacteria 2248
214 Ga0268264_10059115 3300028381 Bacteria 3211
215 Ga0268264_10154548 3300028381 Bacteria 2061
216 Ga0268264_10308080 3300028381 Bacteria 1493
217 Ga0265338_10018495 3300028800 Bacteria 7457
218 Ga0265329_10034686 3300031242 Bacteria 1630
219 Ga0265316_10003663 3300031344 Bacteria 15475
220 Ga0307408_100129206 3300031548 Bacteria 1969
221 Ga0307408_100151726 3300031548 Bacteria 1830
222 Ga0265314_10097689 3300031711 Bacteria 1896
223 Ga0307405_10059923 3300031731 Bacteria 2400
224 Ga0307413_10002694 3300031824 Bacteria 7282
225 Ga0307410_10007154 3300031852 Bacteria 6087
226 Ga0307410_10251885 3300031852 Bacteria 1373
227 Ga0307412_10137721 3300031911 Bacteria 1783
228 Ga0307409_100016057 3300031995 Bacteria 4940
229 Ga0307416_100003431 3300032002 Bacteria 9307
230 Ga0307416_100010911 3300032002 Bacteria 6027
231 Ga0307414_10003232 3300032004 Bacteria 8674
232 Ga0307411_10047531 3300032005 Bacteria 2775
233 Ga0373930_0008303 3300034816 Bacteria 1815
234 Ga0373948_0022482 3300034817 Bacteria 1216
235 Ga0373945_0037268 3300035116 Bacteria 1745
236 Ga0373931_0013154 3300035691 Bacteria 4025
237 Ga0373931_0017224 3300035691 Bacteria 3570
238 Ga0373947_0076947 3300035725 Bacteria 2057
239 Ga0373937_0040670 3300036401 Bacteria 4238
240 Ga0373925_0167271 3300037068 Bacteria 1734
241 Ga0400484_41371 3300038725 Unclassified 2577
242 Ga0436361_1207968 3300039447 Bacteria 1591
243 Ga0439459_0027869 3300042438 Bacteria 1130
244 Ga0451577_0002547 3300042876 Bacteria 21528
245 Ga0451577_0223934 3300042876 Bacteria 1700
246 Ga0453683_0238182 3300044673 Bacteria 1159
247 Ga0453684_0002981 3300044712 Bacteria 39484
248 Ga0453684_0204294 3300044712 Bacteria 2301
249 Ga0453684_0331359 3300044712 Bacteria 1721
250 Ga0451576_0023999 3300045051 Bacteria 6592
251 Ga0451576_0033675 3300045051 Bacteria 5445
252 Ga0451576_0083698 3300045051 Bacteria 3318
253 Ga0451576_0096936 3300045051 Bacteria 3067
254 Ga0451576_0251395 3300045051 Bacteria 1847
255 Ga0451576_0299618 3300045051 Bacteria 1681
256 Ga0495580_0001006 3300046472 Bacteria 24801
257 Ga0495580_0012395 3300046472 Bacteria 6536
258 Ga0495580_0104827 3300046472 Bacteria 1965
259 Ga0495663_0055684 3300046525 Bacteria 1234
260 Ga0495633_0103395 3300046558 Unclassified 1322
261 Ga0495672_0193250 3300047320 Bacteria 1022
262 Ga0495686_0078487 3300047472 Bacteria 2020
263 Ga0496109_0160585 3300048912 Bacteria 2106
264 Ga0496112_0007269 3300048915 Bacteria 9814
265 Ga0496112_0017754 3300048915 Bacteria 6696
266 Ga0496113_0059734 3300048916 Bacteria 2873
267 Ga0496115_0317697 3300048918 Bacteria 1274
268 Ga0501298_012718 3300049521 Bacteria 1480
269 Ga0501031_0011980 3300049568 Bacteria 5653
270 Ga0501032_0009188 3300049569 Bacteria 7166
271 Ga0501033_0002641 3300049570 Bacteria 15081
272 Ga0501036_0171572 3300049572 Bacteria 1827
273 Ga0501036_0257778 3300049572 Bacteria 1461
274 Ga0501037_0100239 3300049573 Bacteria 2091
275 Ga0501038_0003810 3300049574 Bacteria 14024
276 Ga0501038_0003892 3300049574 Bacteria 13880
277 Ga0501038_0203085 3300049574 Bacteria 1589
278 Ga0501039_0013624 3300049575 Bacteria 6218
279 Ga0501039_0059745 3300049575 Bacteria 2952
280 Ga0501040_0009074 3300049576 Bacteria 6470
281 Ga0501040_0026561 3300049576 Bacteria 3894
282 Ga0501040_0093666 3300049576 Bacteria 2089
283 Ga0501041_0082320 3300049577 Bacteria 1983
284 Ga0501041_0117793 3300049577 Bacteria 1649
285 Ga0501042_0054679 3300049578 Bacteria 2848
286 Ga0501042_0063541 3300049578 Bacteria 2638
287 Ga0501042_0152344 3300049578 Bacteria 1667
288 Ga0501042_0277073 3300049578 Unclassified 1211
289 Ga0501043_0001665 3300049579 Bacteria 19295
290 Ga0501043_0004427 3300049579 Bacteria 11410
291 Ga0501043_0041676 3300049579 Bacteria 3607
292 Ga0501046_0011526 3300049580 Bacteria 7559
293 Ga0501046_0025672 3300049580 Bacteria 4819
294 Ga0501046_0097531 3300049580 Bacteria 2258
295 Ga0501047_0004491 3300049581 Bacteria 13126
296 Ga0501047_0031390 3300049581 Bacteria 5124
297 Ga0501048_0014127 3300049582 Bacteria 5917
298 Ga0501048_0026778 3300049582 Bacteria 4196
299 Ga0501067_0000028 3300049583 Bacteria 88712
300 Ga0501068_0004552 3300049584 Bacteria 7543
301 Ga0501068_0020515 3300049584 Bacteria 3851
302 Ga0501069_0026632 3300049585 Bacteria 3167
303 Ga0501069_0074863 3300049585 Bacteria 1901
304 Ga0501070_0005136 3300049586 Bacteria 11155
305 Ga0501070_0118892 3300049586 Bacteria 2184
306 Ga0501071_0005877 3300049587 Bacteria 7932
307 Ga0501071_0232146 3300049587 Bacteria 1390
308 Ga0501071_0312563 3300049587 Bacteria 1192
309 Ga0501072_0007413 3300049588 Bacteria 8324
310 Ga0501072_0282955 3300049588 Bacteria 1319
311 Ga0501072_0302334 3300049588 Bacteria 1272
312 Ga0501072_0338899 3300049588 Bacteria 1194
313 Ga0501073_0000002 3300049589 Bacteria 323865
314 Ga0501073_0095796 3300049589 Bacteria 2061
315 Ga0501074_0001858 3300049590 Bacteria 14490
316 Ga0501074_0021041 3300049590 Bacteria 4737
317 Ga0501074_0294126 3300049590 Bacteria 1154
318 Ga0501075_0002344 3300049591 Bacteria 12574
319 Ga0501075_0191353 3300049591 Bacteria 1560
320 Ga0501076_0033869 3300049592 Bacteria 3989
321 Ga0501076_0064635 3300049592 Bacteria 2916
322 Ga0501076_0108090 3300049592 Bacteria 2247
323 Ga0501076_0224763 3300049592 Bacteria 1534
324 Ga0501076_0224809 3300049592 Bacteria 1534
325 Ga0501077_0000002 3300049593 Bacteria 159855
326 Ga0501077_0001881 3300049593 Bacteria 12703
327 Ga0501077_0007607 3300049593 Bacteria 6686
328 Ga0501077_0014393 3300049593 Bacteria 4971
329 Ga0501216_007022 3300049660 Bacteria 1743
330 Ga0501079_0004952 3300049741 Bacteria 9875
331 Ga0501079_0066093 3300049741 Bacteria 2790
332 Ga0501080_0006312 3300049742 Bacteria 10637
333 Ga0501080_0025369 3300049742 Bacteria 5500
334 Ga0501080_0054057 3300049742 Bacteria 3740
335 Ga0501080_0134180 3300049742 Bacteria 2291
336 Ga0501081_0005109 3300049743 Bacteria 8449
337 Ga0501081_0011689 3300049743 Bacteria 5746
338 Ga0501081_0016466 3300049743 Bacteria 4887
339 Ga0501081_0035348 3300049743 Bacteria 3401
340 Ga0501083_0000620 3300049744 Bacteria 22897
341 Ga0501035_0128432 3300049822 Bacteria 2211
342 Ga0501044_0002054 3300049823 Bacteria 23229
343 Ga0501044_0014007 3300049823 Bacteria 8661
344 Ga0501044_0254874 3300049823 Bacteria 1694
345 Ga0501045_0003318 3300049824 Bacteria 11004
346 Ga0501045_0115887 3300049824 Bacteria 1988
347 nmdc:mga05p37_160075_c1 3300050507 Bacteria 2750
348 nmdc:mga05p37_307965_c1 3300050507 Bacteria 1879
349 nmdc:mga05p37_39523_c1 3300050507 Bacteria 5793
350 nmdc:mga05p37_50674_c1 3300050507 Bacteria 5107
351 nmdc:mga05p37_55698_c1 3300050507 Bacteria 4314
352 nmdc:mga05p37_674041_c1 3300050507 Bacteria 1154
353 nmdc:mga05p37_6771_c1 3300050507 Bacteria 13506
354 nmdc:mga0qj67_324178_c1 3300050509 Bacteria 1247
355 nmdc:mga06r32_109_c1 3300050510 Bacteria 58480
356 nmdc:mga06r32_201970_c1 3300050510 Bacteria 1975
357 nmdc:mga0n895_1517_c1 3300050512 Bacteria 17420
358 nmdc:mga0n895_291236_c1 3300050512 Bacteria 1655
359 nmdc:mga0n895_388_c1 3300050512 Bacteria 29481
360 nmdc:mga0n895_62023_c1 3300050512 Bacteria 3693
361 nmdc:mga0n895_7652_c1 3300050512 Bacteria 9290
362 nmdc:mga0n895_802_c1 3300050512 Bacteria 22472
363 nmdc:mga0rr50_225599_c1 3300050513 Unclassified 1549
364 nmdc:mga0rr50_2682_c1 3300050513 Bacteria 10081
365 nmdc:mga0rr50_311658_c1 3300050513 Bacteria 1318
366 nmdc:mga08x19_11492_c1 3300050514 Bacteria 5328
367 nmdc:mga08x19_13967_c1 3300050514 Bacteria 4865
368 nmdc:mga08x19_153284_c1 3300050514 Bacteria 1562
369 nmdc:mga08x19_190084_c1 3300050514 Bacteria 1405
370 nmdc:mga08x19_234907_c1 3300050514 Bacteria 1263
371 nmdc:mga08x19_4087_c1 3300050514 Bacteria 8659
372 nmdc:mga08x19_6547_c1 3300050514 Bacteria 6899
373 nmdc:mga0a205_10636_c1 3300050515 Bacteria 8457
374 nmdc:mga0a205_14897_c1 3300050515 Bacteria 7255
375 nmdc:mga0a205_238731_c1 3300050515 Bacteria 1699
376 nmdc:mga0a205_243693_c1 3300050515 Bacteria 1678
377 nmdc:mga0a205_36714_c1 3300050515 Unclassified 4710
378 nmdc:mga0a205_46531_c1 3300050515 Bacteria 4184
379 nmdc:mga0a205_4810_c1 3300050515 Bacteria 12139
380 nmdc:mga0a205_493_c1 3300050515 Bacteria 30906
381 nmdc:mga0a205_9537_c1 3300050515 Bacteria 8880
382 Ga0500595_001278 3300053119 Bacteria 13701
383 Ga0501084_0008555 3300054114 Bacteria 8463
384 Ga0501084_0029233 3300054114 Bacteria 4610
385 Ga0501084_0035882 3300054114 Bacteria 4145
386 Ga0501084_0073382 3300054114 Bacteria 2866
387 Ga0501084_0105882 3300054114 Bacteria 2362
388 Ga0501084_0357831 3300054114 Bacteria 1233
389 Ga0501082_0009342 3300060353 Bacteria 8452
390 Ga0501082_0057544 3300060353 Bacteria 3349
391 Ga0530510_0043136 3300061734 Bacteria 3258
392 2688069484 2687453257 Bacteria 6784659
393 2889419101 2889415604 Bacteria 8048700
394 Ga0114129_10041224
395 Ga0065704_10008079
396 Ga0065712_10000212
397 Ga0065712_10001923
398 Ga0065715_10009635
399 Ga0065715_10092218
400 Ga0070676_10015131
401 Ga0070690_100054775
402 Ga0070670_100005432
403 Ga0070670_100354814
404 Ga0068869_100003667
405 Ga0070680_100062755
406 Ga0070691_10048528
407 Ga0070661_100023433
408 Ga0070692_10214652
409 Ga0070667_100257722
410 Ga0070703_10001717
411 Ga0070703_10009921
412 Ga0070701_10047626
413 Ga0070711_100000132
414 Ga0070705_100005153
415 Ga0070705_100019280
416 Ga0070705_100029388
417 Ga0070705_100060617
418 Ga0070694_100010404
419 Ga0070694_100033554
420 Ga0070708_100006773
421 Ga0070708_100026592
422 Ga0070708_100030000
423 Ga0070678_100048049
424 Ga0070681_10079082
425 Ga0070681_10134494
426 Ga0068867_100095662
427 Ga0068867_100188090
428 Ga0070685_10001536
429 Ga0070706_100020758
430 Ga0070706_100057594
431 Ga0070707_100010512
432 Ga0070707_100024174
433 Ga0070707_100180844
434 Ga0070707_100285754
435 Ga0070707_100457185
436 Ga0070698_100001479
437 Ga0070698_100003277
438 Ga0070698_100054371
439 Ga0070698_100085509
440 Ga0070698_100160294
441 Ga0070698_100301037
442 Ga0070699_100013663
443 Ga0070699_100021117
444 Ga0070699_100025975
445 Ga0070699_100028815
446 Ga0070699_100029581
447 Ga0070699_100057489
448 Ga0070699_100060811
449 Ga0070699_100126996
450 Ga0070699_100291563
451 Ga0070699_100460675
452 Ga0070679_100011149
453 Ga0070697_100024912
454 Ga0070697_100026100
455 Ga0070697_100050259
456 Ga0070697_100065539
457 Ga0070697_100220799
458 Ga0070697_100276370
459 Ga0068853_100317517
460 Ga0068853_100354060
461 Ga0070672_100314271
462 Ga0070695_100019018
463 Ga0070695_100066434
464 Ga0070695_100066939
465 Ga0070695_100069339
466 Ga0070695_100100794
467 Ga0070695_100199030
468 Ga0070696_100002744
469 Ga0070696_100039500
470 Ga0070696_100042113
471 Ga0070696_100118041
472 Ga0070693_100066474
473 Ga0070665_100296911
474 Ga0070704_100000065
475 Ga0070704_100027787
476 Ga0070704_100261634
477 Ga0070704_100309256
478 Ga0068855_100018798
479 Ga0070664_100011835
480 Ga0070664_100198206
481 Ga0068857_100006911
482 Ga0068854_100085324
483 Ga0070702_100018973
484 Ga0068870_10008103
485 Ga0068863_100167593
486 Ga0068863_100377989
487 Ga0068862_100036099
488 Ga0068862_100234867
489 Ga0081455_10002129
490 Ga0081455_10108954
491 Ga0081538_10013736
492 Ga0070716_100000865
493 Ga0070716_100001751
494 Ga0070716_100012356
495 Ga0070712_100004036
496 Ga0075428_100108835
497 Ga0075428_100135975
498 Ga0075428_100363399
499 Ga0075431_100000900
500 Ga0075431_100006870
501 Ga0075431_100060958
502 Ga0075431_100210390
503 Ga0075433_10010612
504 Ga0075433_10017059
505 Ga0075433_10020785
506 Ga0075433_10024265
507 Ga0075433_10030398
508 Ga0075433_10186887
509 Ga0075434_100001037
510 Ga0075434_100001884
511 Ga0075434_100004576
512 Ga0075434_100009445
513 Ga0075434_100022776
514 Ga0075434_100036488
515 Ga0075434_100041239
516 Ga0075434_100088900
517 Ga0075434_100723964
518 Ga0075436_100008743
519 Ga0075436_100025048
520 Ga0075436_100030710
521 Ga0075436_100035720
522 Ga0075436_100044283
523 Ga0075436_100045252
524 Ga0075436_100094785
525 Ga0075435_100054201
526 Ga0075435_100067191
527 Ga0075435_100075663
528 Ga0099794_10006530
529 Ga0105240_10343245
530 Ga0111539_10000916
531 Ga0111539_10278896
532 Ga0111539_10301820
533 Ga0114129_10054070
534 Ga0114129_10194635
535 Ga0114129_10222347
536 Ga0114129_10245446
537 Ga0114129_10414584
538 Ga0114129_10945629
539 Ga0105242_10006567
540 Ga0105242_10167185
541 Ga0105237_10100236
542 Ga0105239_10001856
543 Ga0105246_10011468
544 Ga0157374_10166708
545 Ga0157378_10071632
546 Ga0157378_10346141
547 Ga0163162_10068683
548 Ga0163162_10125036
549 Ga0157372_10059884
550 Ga0157377_10037442
551 Ga0157379_10000178
552 Ga0157376_10024155
553 Ga0207697_10021710
554 Ga0207653_10001767
555 Ga0207682_10010984
556 Ga0207699_10000873
557 Ga0207645_10012706
558 Ga0207643_10015370
559 Ga0207684_10010389
560 Ga0207684_10092690
561 Ga0207684_10180471
562 Ga0207707_10005570
563 Ga0207707_10007946
564 Ga0207695_10244119
565 Ga0207671_10115957
566 Ga0207693_10003550
567 Ga0207663_10000034
568 Ga0207660_10029161
569 Ga0207660_10058102
570 Ga0207660_10087351
571 Ga0207657_10012591
572 Ga0207649_10014009
573 Ga0207646_10000921
574 Ga0207646_10001472
575 Ga0207646_10133454
576 Ga0207646_10154373
577 Ga0207650_10001233
578 Ga0207687_10169493
579 Ga0207700_10152868
580 Ga0207706_10002680
581 Ga0207706_10076364
582 Ga0207686_10037854
583 Ga0207665_10000917
584 Ga0207665_10011995
585 Ga0207665_10012204
586 Ga0207665_10189790
587 Ga0207689_10031342
588 Ga0207679_10009000
589 Ga0207712_10047693
590 Ga0207658_10216707
591 Ga0207678_10015107
592 Ga0207708_10018264
593 Ga0207708_10050209
594 Ga0207708_10095714
595 Ga0207641_10105257
596 Ga0207648_10062700
597 Ga0207674_10006800
598 Ga0207675_100099978
599 Ga0207675_100491750
600 Ga0209588_1003748
601 Ga0209971_1000668
602 Ga0207428_10002620
603 Ga0268266_10005277
604 Ga0268265_10006214
605 Ga0268265_10063030
606 Ga0268265_10109890
607 Ga0268264_10059115
608 Ga0268264_10154548
609 Ga0268264_10308080
610 Ga0265338_10018495
611 Ga0265329_10034686
612 Ga0265316_10003663
613 Ga0307408_100129206
614 Ga0307408_100151726
615 Ga0265314_10097689
616 Ga0307405_10059923
617 Ga0307413_10002694
618 Ga0307410_10007154
619 Ga0307410_10251885
620 Ga0307412_10137721
621 Ga0307409_100016057
622 Ga0307416_100003431
623 Ga0307416_100010911
624 Ga0307414_10003232
625 Ga0307411_10047531
626 Ga0373930_0008303
627 Ga0373948_0022482
628 Ga0373945_0037268
629 Ga0373931_0013154
630 Ga0373931_0017224
631 Ga0373947_0076947
632 Ga0373937_0040670
633 Ga0373925_0167271
634 Ga0400484_41371
635 Ga0436361_1207968
636 Ga0439459_0027869
637 Ga0451577_0002547
638 Ga0451577_0223934
639 Ga0453683_0238182
640 Ga0453684_0002981
641 Ga0453684_0204294
642 Ga0453684_0331359
643 Ga0451576_0023999
644 Ga0451576_0033675
645 Ga0451576_0083698
646 Ga0451576_0096936
647 Ga0451576_0251395
648 Ga0451576_0299618
649 Ga0495580_0001006
650 Ga0495580_0012395
651 Ga0495580_0104827
652 Ga0495663_0055684
653 Ga0495633_0103395
654 Ga0495672_0193250
655 Ga0495686_0078487
656 Ga0496109_0160585
657 Ga0496112_0007269
658 Ga0496112_0017754
659 Ga0496113_0059734
660 Ga0496115_0317697
661 Ga0501298_012718
662 Ga0501031_0011980
663 Ga0501032_0009188
664 Ga0501033_0002641
665 Ga0501036_0171572
666 Ga0501036_0257778
667 Ga0501037_0100239
668 Ga0501038_0003810
669 Ga0501038_0003892
670 Ga0501038_0203085
671 Ga0501039_0013624
672 Ga0501039_0059745
673 Ga0501040_0009074
674 Ga0501040_0026561
675 Ga0501040_0093666
676 Ga0501041_0082320
677 Ga0501041_0117793
678 Ga0501042_0054679
679 Ga0501042_0063541
680 Ga0501042_0152344
681 Ga0501042_0277073
682 Ga0501043_0001665
683 Ga0501043_0004427
684 Ga0501043_0041676
685 Ga0501046_0011526
686 Ga0501046_0025672
687 Ga0501046_0097531
688 Ga0501047_0004491
689 Ga0501047_0031390
690 Ga0501048_0014127
691 Ga0501048_0026778
692 Ga0501067_0000028
693 Ga0501068_0004552
694 Ga0501068_0020515
695 Ga0501069_0026632
696 Ga0501069_0074863
697 Ga0501070_0005136
698 Ga0501070_0118892
699 Ga0501071_0005877
700 Ga0501071_0232146
701 Ga0501071_0312563
702 Ga0501072_0007413
703 Ga0501072_0282955
704 Ga0501072_0302334
705 Ga0501072_0338899
706 Ga0501073_0000002
707 Ga0501073_0095796
708 Ga0501074_0001858
709 Ga0501074_0021041
710 Ga0501074_0294126
711 Ga0501075_0002344
712 Ga0501075_0191353
713 Ga0501076_0033869
714 Ga0501076_0064635
715 Ga0501076_0108090
716 Ga0501076_0224763
717 Ga0501076_0224809
718 Ga0501077_0000002
719 Ga0501077_0001881
720 Ga0501077_0007607
721 Ga0501077_0014393
722 Ga0501216_007022
723 Ga0501079_0004952
724 Ga0501079_0066093
725 Ga0501080_0006312
726 Ga0501080_0025369
727 Ga0501080_0054057
728 Ga0501080_0134180
729 Ga0501081_0005109
730 Ga0501081_0011689
731 Ga0501081_0016466
732 Ga0501081_0035348
733 Ga0501083_0000620
734 Ga0501035_0128432
735 Ga0501044_0002054
736 Ga0501044_0014007
737 Ga0501044_0254874
738 Ga0501045_0003318
739 Ga0501045_0115887
740 nmdc:mga05p37_160075_c1
741 nmdc:mga05p37_307965_c1
742 nmdc:mga05p37_39523_c1
743 nmdc:mga05p37_50674_c1
744 nmdc:mga05p37_55698_c1
745 nmdc:mga05p37_674041_c1
746 nmdc:mga05p37_6771_c1
747 nmdc:mga0qj67_324178_c1
748 nmdc:mga06r32_109_c1
749 nmdc:mga06r32_201970_c1
750 nmdc:mga0n895_1517_c1
751 nmdc:mga0n895_291236_c1
752 nmdc:mga0n895_388_c1
753 nmdc:mga0n895_62023_c1
754 nmdc:mga0n895_7652_c1
755 nmdc:mga0n895_802_c1
756 nmdc:mga0rr50_225599_c1
757 nmdc:mga0rr50_2682_c1
758 nmdc:mga0rr50_311658_c1
759 nmdc:mga08x19_11492_c1
760 nmdc:mga08x19_13967_c1
761 nmdc:mga08x19_153284_c1
762 nmdc:mga08x19_190084_c1
763 nmdc:mga08x19_234907_c1
764 nmdc:mga08x19_4087_c1
765 nmdc:mga08x19_6547_c1
766 nmdc:mga0a205_10636_c1
767 nmdc:mga0a205_14897_c1
768 nmdc:mga0a205_238731_c1
769 nmdc:mga0a205_243693_c1
770 nmdc:mga0a205_36714_c1
771 nmdc:mga0a205_46531_c1
772 nmdc:mga0a205_4810_c1
773 nmdc:mga0a205_493_c1
774 nmdc:mga0a205_9537_c1
775 Ga0500595_001278
776 Ga0501084_0008555
777 Ga0501084_0029233
778 Ga0501084_0035882
779 Ga0501084_0073382
780 Ga0501084_0105882
781 Ga0501084_0357831
782 Ga0501082_0009342
783 Ga0501082_0057544
784 Ga0530510_0043136
785 2688069484
786 2889419101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

21

359

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cyv-assembly1.cif.gz_A-2 crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism 0.9702 1 318
4wsh-assembly1.cif.gz_A crystal structure of probable uroporphyrinogen decarboxylase (upd) (uro-d) from pseudomonas aeruginosa 0.9667 1 319
6w2o-assembly1.cif.gz_A crystal structure of uroporphyrinogen iii decarboxylate (heme) from stenotrophomonas maltophilia 0.9657 1 320
6w2o-assembly1.cif.gz_A crystal structure of uroporphyrinogen iii decarboxylate (heme) from stenotrophomonas maltophilia 0.9627 1 320
4zr8-assembly1.cif.gz_A structure of uroporphyrinogen decarboxylase from acinetobacter baumannii 0.9621 1 319
ID Description Score Start End Superfamily
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9713 1 316 3.20.20.210
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9568 1 320 3.20.20.210
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9565 1 316 3.20.20.210
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9539 1 320 3.20.20.210
af_P9WFE1_2_357_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9497 1 317 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A1G1JTY0-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9896 1 320 GO:0004852
GO:0004853
GO:0005829
GO:0006782
AF-D5MMI4-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9889 1 320 GO:0004852
GO:0004853
GO:0005829
GO:0006782
AF-A0A2V6THW4-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 0.9876 44 320 GO:0004853
GO:0005829
GO:0006782
AF-A0A2V7BI52-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9875 1 320 GO:0004853
GO:0005829
GO:0006782
AF-A0A524JNJ6-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9872 1 316 GO:0004852
GO:0004853
GO:0005829
GO:0006782

Map