F432863

General Info

Members Datasets Scaffolds Average Seq Length
394 212 392 274

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100050011|Ga0070712_1000500113
Length 275
Sequence MDRMPALFVGHGSPMNALETNGYTNAWRVFGQQLPRPRALLVISAHWYFGATAVTAMPKPRTIHDFYGFPKDLFEFEYPASGAPDLAQEVVEVVKPHWLGLDHDQWVLAHIYPEADVPVVQLSINALRPLDYHLDLAARLAPLRDRGVMILASGNVVHNLRRVQWDQPDAAFDWAERFDDAVVQQLARDPGDILRLVEHPDFGLAVPTPDHFIPLLYLAALAAAEGVPPEVLVRGYAMGSISMTCYGLGAKGILPQEPERAARLPDGVPPDQTNM

Samples

Sample ID Description Type Environment
1 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
2 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
193 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
194 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
195 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
208 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.25
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 3.05
Rhizosphere 92.13
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000268 3300001989 Bacteria 17502
2 JGI24737J22298_10000441 3300001990 Bacteria 14198
3 JGI24735J21928_10001442 3300002067 Bacteria 8405
4 JGI24738J21930_10000543 3300002075 Bacteria 10769
5 JGI25406J46586_10029776 3300003203 Bacteria 2061
6 rootH1_10015619 3300003316 Bacteria 3772
7 rootH1_10015619 3300003323 Bacteria 3720
8 Ga0070658_10048161 3300005327 Bacteria 3450
9 Ga0070658_10195196 3300005327 Bacteria 1707
10 Ga0070676_10160064 3300005328 Bacteria 1448
11 Ga0070683_100050448 3300005329 Bacteria 3852
12 Ga0070683_100117009 3300005329 Bacteria 2517
13 Ga0070683_100147365 3300005329 Bacteria 2231
14 Ga0070683_100244895 3300005329 Bacteria 1705
15 Ga0070683_100485712 3300005329 Bacteria 1179
16 Ga0070670_100035221 3300005331 Bacteria 4310
17 Ga0070677_10111730 3300005333 Bacteria 1221
18 Ga0068869_100073241 3300005334 Bacteria 2539
19 Ga0070680_100000498 3300005336 Bacteria 26970
20 Ga0070680_100007601 3300005336 Bacteria 8267
21 Ga0070680_100171704 3300005336 Bacteria 1824
22 Ga0070680_100396943 3300005336 Bacteria 1175
23 Ga0070680_100409537 3300005336 Bacteria 1156
24 Ga0070682_100017104 3300005337 Bacteria 4225
25 Ga0070682_100081579 3300005337 Bacteria 2094
26 Ga0068868_100178109 3300005338 Bacteria 1762
27 Ga0068868_100244762 3300005338 Bacteria 1508
28 Ga0070660_100034039 3300005339 Bacteria 3846
29 Ga0070660_100067154 3300005339 Bacteria 2793
30 Ga0070660_100110453 3300005339 Bacteria 2187
31 Ga0070660_100114758 3300005339 Bacteria 2146
32 Ga0070660_100120943 3300005339 Bacteria 2089
33 Ga0070660_100204934 3300005339 Bacteria 1600
34 Ga0070660_100309922 3300005339 Bacteria 1295
35 Ga0070660_100596922 3300005339 Unclassified 923
36 Ga0070689_100099243 3300005340 Bacteria 2304
37 Ga0070661_100009426 3300005344 Bacteria 6756
38 Ga0070661_100024487 3300005344 Bacteria 4330
39 Ga0070661_100032005 3300005344 Bacteria 3805
40 Ga0070661_100124215 3300005344 Bacteria 1935
41 Ga0070661_100163228 3300005344 Bacteria 1688
42 Ga0070661_100238059 3300005344 Bacteria 1401
43 Ga0070692_10170570 3300005345 Bacteria 1254
44 Ga0070668_100050604 3300005347 Bacteria 3199
45 Ga0070675_100256435 3300005354 Bacteria 1532
46 Ga0070674_100031146 3300005356 Bacteria 3532
47 Ga0070659_100008405 3300005366 Bacteria 7540
48 Ga0070659_100010450 3300005366 Bacteria 6827
49 Ga0070659_100062138 3300005366 Bacteria 2952
50 Ga0070659_100073640 3300005366 Bacteria 2719
51 Ga0070659_100104835 3300005366 Bacteria 2278
52 Ga0070659_100135659 3300005366 Bacteria 2001
53 Ga0070659_100225649 3300005366 Bacteria 1547
54 Ga0070659_100567753 3300005366 Unclassified 972
55 Ga0070714_100143070 3300005435 Bacteria 2149
56 Ga0070713_100309761 3300005436 Bacteria 1456
57 Ga0070700_100124037 3300005441 Bacteria 1734
58 Ga0070694_100008270 3300005444 Bacteria 6362
59 Ga0070708_100000450 3300005445 Bacteria 30851
60 Ga0070663_100030876 3300005455 Bacteria 3676
61 Ga0070663_100077748 3300005455 Bacteria 2430
62 Ga0070663_100124106 3300005455 Bacteria 1954
63 Ga0070663_100185852 3300005455 Bacteria 1615
64 Ga0070678_100044403 3300005456 Bacteria 3174
65 Ga0070662_100000934 3300005457 Bacteria 17887
66 Ga0070662_100026273 3300005457 Bacteria 4031
67 Ga0070662_100115688 3300005457 Bacteria 2049
68 Ga0070662_100209477 3300005457 Bacteria 1551
69 Ga0070681_10022967 3300005458 Bacteria 6268
70 Ga0070681_10095796 3300005458 Bacteria 2916
71 Ga0070681_10170236 3300005458 Bacteria 2100
72 Ga0070681_10297988 3300005458 Bacteria 1522
73 Ga0068867_100100087 3300005459 Bacteria 2213
74 Ga0070685_10041727 3300005466 Bacteria 2616
75 Ga0070685_10045673 3300005466 Bacteria 2512
76 Ga0070679_100392989 3300005530 Bacteria 1333
77 Ga0070684_100230928 3300005535 Bacteria 1689
78 Ga0070697_100240091 3300005536 Bacteria 1547
79 Ga0068853_100028472 3300005539 Bacteria 4699
80 Ga0068853_100184576 3300005539 Bacteria 1893
81 Ga0070672_100332522 3300005543 Bacteria 1293
82 Ga0070695_100061398 3300005545 Bacteria 2439
83 Ga0070696_100146902 3300005546 Bacteria 1727
84 Ga0070693_100032603 3300005547 Bacteria 2867
85 Ga0070664_100021723 3300005564 Bacteria 5293
86 Ga0070664_100036193 3300005564 Bacteria 4147
87 Ga0070664_100162806 3300005564 Bacteria 1975
88 Ga0070664_100564886 3300005564 Bacteria 1053
89 Ga0068857_100307116 3300005577 Bacteria 1463
90 Ga0068854_100023490 3300005578 Bacteria 4212
91 Ga0068854_100031688 3300005578 Bacteria 3675
92 Ga0068854_100125265 3300005578 Bacteria 1956
93 Ga0068856_100009582 3300005614 Bacteria 9407
94 Ga0068856_100123583 3300005614 Bacteria 2590
95 Ga0068856_100301588 3300005614 Bacteria 1620
96 Ga0068856_100692880 3300005614 Bacteria 1039
97 Ga0068852_100019340 3300005616 Bacteria 5387
98 Ga0068852_100064024 3300005616 Bacteria 3204
99 Ga0068852_100168568 3300005616 Bacteria 2051
100 Ga0068852_100216090 3300005616 Bacteria 1821
101 Ga0068859_100634624 3300005617 Bacteria 1160
102 Ga0068864_100026115 3300005618 Bacteria 4923
103 Ga0068864_100094741 3300005618 Bacteria 2639
104 Ga0068858_100018190 3300005842 Bacteria 6580
105 Ga0068860_100424225 3300005843 Bacteria 1319
106 Ga0081539_10000205 3300005985 Bacteria 137262
107 Ga0070717_10104251 3300006028 Bacteria 2412
108 Ga0070712_100050011 3300006175 Bacteria 2906
109 Ga0068865_100588740 3300006881 Bacteria 939
110 Ga0097620_100634643 3300006931 Bacteria 1160
111 Ga0105240_10244302 3300009093 Bacteria 2079
112 Ga0105245_10127784 3300009098 Bacteria 2381
113 Ga0105245_10399438 3300009098 Bacteria 1373
114 Ga0105243_10021985 3300009148 Bacteria 4844
115 Ga0105248_10190206 3300009177 Bacteria 2313
116 Ga0105248_10440234 3300009177 Bacteria 1468
117 Ga0105238_10068201 3300009551 Bacteria 3558
118 Ga0105238_10138752 3300009551 Bacteria 2409
119 Ga0105238_10450809 3300009551 Bacteria 1283
120 Ga0105238_10566236 3300009551 Bacteria 1141
121 Ga0105249_10401649 3300009553 Bacteria 1401
122 Ga0105239_10111021 3300010375 Bacteria 3039
123 Ga0105239_10172640 3300010375 Bacteria 2418
124 Ga0105239_10395389 3300010375 Bacteria 1564
125 Ga0105239_10723618 3300010375 Bacteria 1138
126 Ga0105246_10225552 3300011119 Bacteria 1472
127 Ga0157373_10045630 3300013100 Bacteria 3128
128 Ga0157371_10022761 3300013102 Bacteria 4585
129 Ga0157371_10040275 3300013102 Bacteria 3337
130 Ga0157371_10059222 3300013102 Bacteria 2715
131 Ga0157371_10317985 3300013102 Bacteria 1129
132 Ga0157371_10391800 3300013102 Bacteria 1015
133 Ga0157370_10019732 3300013104 Bacteria 6748
134 Ga0157370_10053017 3300013104 Bacteria 3870
135 Ga0157370_10138346 3300013104 Bacteria 2269
136 Ga0157370_10232147 3300013104 Bacteria 1707
137 Ga0157370_10283699 3300013104 Bacteria 1530
138 Ga0157370_10633014 3300013104 Bacteria 978
139 Ga0157369_10010995 3300013105 Bacteria 10302
140 Ga0157369_10148583 3300013105 Bacteria 2477
141 Ga0157369_10169640 3300013105 Bacteria 2300
142 Ga0157369_10186843 3300013105 Bacteria 2179
143 Ga0157369_10194517 3300013105 Bacteria 2130
144 Ga0157369_10312647 3300013105 Bacteria 1633
145 Ga0157374_10057282 3300013296 Bacteria 3640
146 Ga0157374_10382952 3300013296 Bacteria 1401
147 Ga0157378_10716571 3300013297 Bacteria 1021
148 Ga0163162_10256074 3300013306 Bacteria 1882
149 Ga0163162_10260067 3300013306 Bacteria 1867
150 Ga0157372_10930744 3300013307 Unclassified 1008
151 Ga0157375_10007341 3300013308 Bacteria 9651
152 Ga0163163_10021138 3300014325 Bacteria 6139
153 Ga0157377_10023385 3300014745 Bacteria 3274
154 Ga0157379_10039154 3300014968 Bacteria 4230
155 Ga0163161_10078590 3300017792 Bacteria 2425
156 Ga0206353_11845874 3300020082 Bacteria 1751
157 Ga0207656_10003567 3300025321 Bacteria 5365
158 Ga0207682_10002781 3300025893 Bacteria 7746
159 Ga0207710_10032135 3300025900 Bacteria 2299
160 Ga0207688_10006748 3300025901 Bacteria 6245
161 Ga0207688_10069542 3300025901 Bacteria 1995
162 Ga0207647_10000316 3300025904 Bacteria 40242
163 Ga0207647_10001296 3300025904 Bacteria 19244
164 Ga0207647_10021376 3300025904 Bacteria 4320
165 Ga0207647_10025516 3300025904 Bacteria 3881
166 Ga0207647_10176964 3300025904 Bacteria 1241
167 Ga0207645_10009613 3300025907 Bacteria 6681
168 Ga0207643_10030576 3300025908 Bacteria 2998
169 Ga0207705_10007602 3300025909 Bacteria 7968
170 Ga0207705_10011928 3300025909 Bacteria 6279
171 Ga0207705_10013566 3300025909 Bacteria 5882
172 Ga0207705_10024445 3300025909 Bacteria 4311
173 Ga0207705_10027057 3300025909 Bacteria 4087
174 Ga0207705_10047397 3300025909 Bacteria 3090
175 Ga0207705_10076375 3300025909 Bacteria 2435
176 Ga0207705_10113009 3300025909 Bacteria 2008
177 Ga0207705_10216942 3300025909 Bacteria 1452
178 Ga0207707_10087614 3300025912 Bacteria 2720
179 Ga0207707_10390222 3300025912 Bacteria 1196
180 Ga0207695_10063837 3300025913 Bacteria 3794
181 Ga0207695_10181153 3300025913 Bacteria 2027
182 Ga0207693_10091114 3300025915 Bacteria 2390
183 Ga0207660_10003723 3300025917 Bacteria 9938
184 Ga0207660_10027396 3300025917 Bacteria 3888
185 Ga0207660_10036958 3300025917 Bacteria 3399
186 Ga0207660_10076133 3300025917 Bacteria 2453
187 Ga0207660_10094568 3300025917 Bacteria 2221
188 Ga0207657_10002718 3300025919 Bacteria 19043
189 Ga0207657_10004197 3300025919 Bacteria 15264
190 Ga0207657_10028389 3300025919 Bacteria 5104
191 Ga0207657_10047102 3300025919 Bacteria 3773
192 Ga0207657_10118084 3300025919 Bacteria 2184
193 Ga0207657_10247999 3300025919 Bacteria 1420
194 Ga0207649_10109244 3300025920 Bacteria 1845
195 Ga0207649_10266554 3300025920 Bacteria 1240
196 Ga0207649_10401386 3300025920 Bacteria 1026
197 Ga0207652_10113414 3300025921 Bacteria 2406
198 Ga0207650_10004837 3300025925 Bacteria 9202
199 Ga0207659_10171250 3300025926 Bacteria 1713
200 Ga0207664_10332742 3300025929 Bacteria 1342
201 Ga0207690_10049224 3300025932 Bacteria 2808
202 Ga0207690_10200257 3300025932 Bacteria 1516
203 Ga0207706_10000576 3300025933 Bacteria 39094
204 Ga0207706_10018713 3300025933 Bacteria 6230
205 Ga0207706_10027488 3300025933 Bacteria 5086
206 Ga0207706_10031538 3300025933 Bacteria 4721
207 Ga0207706_10069389 3300025933 Bacteria 3100
208 Ga0207706_10094670 3300025933 Bacteria 2627
209 Ga0207706_10123565 3300025933 Bacteria 2277
210 Ga0207669_10330376 3300025937 Bacteria 1170
211 Ga0207704_10661345 3300025938 Bacteria 861
212 Ga0207691_10138426 3300025940 Bacteria 2146
213 Ga0207661_10170583 3300025944 Bacteria 1894
214 Ga0207661_10276906 3300025944 Bacteria 1499
215 Ga0207661_10503216 3300025944 Unclassified 1107
216 Ga0207679_10003185 3300025945 Bacteria 10122
217 Ga0207679_10118448 3300025945 Bacteria 2103
218 Ga0207667_10059329 3300025949 Bacteria 4007
219 Ga0207667_10162052 3300025949 Bacteria 2300
220 Ga0207667_10333857 3300025949 Bacteria 1547
221 Ga0207677_10504954 3300026023 Bacteria 1046
222 Ga0207703_10033833 3300026035 Unclassified 4053
223 Ga0207639_10041226 3300026041 Bacteria 3452
224 Ga0207639_10220274 3300026041 Bacteria 1638
225 Ga0207639_10376835 3300026041 Bacteria 1273
226 Ga0207678_10003211 3300026067 Bacteria 14775
227 Ga0207678_10006004 3300026067 Bacteria 10807
228 Ga0207678_10063883 3300026067 Bacteria 3163
229 Ga0207678_10089008 3300026067 Bacteria 2639
230 Ga0207678_10095011 3300026067 Bacteria 2547
231 Ga0207678_10224595 3300026067 Bacteria 1608
232 Ga0207678_10292614 3300026067 Bacteria 1399
233 Ga0207702_10000859 3300026078 Bacteria 31767
234 Ga0207702_10046091 3300026078 Bacteria 3669
235 Ga0207702_10046544 3300026078 Bacteria 3652
236 Ga0207702_10345115 3300026078 Bacteria 1423
237 Ga0207641_10107396 3300026088 Bacteria 2469
238 Ga0207648_10050136 3300026089 Bacteria 3651
239 Ga0207674_10052184 3300026116 Bacteria 4170
240 Ga0207674_10113480 3300026116 Bacteria 2683
241 Ga0207675_100025843 3300026118 Bacteria 5462
242 Ga0207683_10054767 3300026121 Bacteria 3497
243 Ga0207683_10066019 3300026121 Bacteria 3190
244 Ga0207683_10096792 3300026121 Bacteria 2631
245 Ga0207698_10044873 3300026142 Bacteria 3325
246 Ga0207698_10064986 3300026142 Bacteria 2863
247 Ga0207698_10065368 3300026142 Bacteria 2856
248 Ga0207698_10070344 3300026142 Bacteria 2772
249 Ga0207698_10121650 3300026142 Bacteria 2211
250 Ga0207698_10195545 3300026142 Bacteria 1806
251 Ga0307515_10005159 3300028794 Bacteria 26553
252 Ga0307515_10033135 3300028794 Bacteria 8519
253 Ga0307512_10003932 3300030522 Bacteria 16625
254 Ga0307513_10011704 3300031456 Bacteria 10885
255 Ga0307513_10099337 3300031456 Bacteria 2939
256 Ga0307408_100310765 3300031548 Bacteria 1324
257 Ga0307508_10029623 3300031616 Bacteria 4947
258 Ga0307405_10323756 3300031731 Bacteria 1178
259 Ga0307413_10000800 3300031824 Bacteria 10954
260 Ga0307413_10003571 3300031824 Bacteria 6579
261 Ga0307413_10069103 3300031824 Bacteria 2215
262 Ga0307413_10152228 3300031824 Bacteria 1613
263 Ga0307410_10001280 3300031852 Bacteria 11190
264 Ga0307410_10001493 3300031852 Bacteria 10607
265 Ga0307410_10020924 3300031852 Bacteria 4014
266 Ga0307410_10146813 3300031852 Bacteria 1751
267 Ga0307406_10110516 3300031901 Bacteria 1891
268 Ga0307407_10002484 3300031903 Bacteria 7230
269 Ga0307407_10003434 3300031903 Bacteria 6496
270 Ga0307412_10004071 3300031911 Bacteria 8142
271 Ga0307412_10005181 3300031911 Bacteria 7304
272 Ga0307412_10073074 3300031911 Bacteria 2345
273 Ga0307409_100002303 3300031995 Bacteria 9898
274 Ga0307409_100012072 3300031995 Bacteria 5486
275 Ga0307409_100029313 3300031995 Bacteria 3937
276 Ga0307409_100030125 3300031995 Bacteria 3894
277 Ga0307409_100057394 3300031995 Bacteria 3016
278 Ga0307409_100086788 3300031995 Bacteria 2548
279 Ga0307416_100002520 3300032002 Bacteria 10536
280 Ga0307416_100008074 3300032002 Bacteria 6749
281 Ga0307416_100160080 3300032002 Bacteria 2079
282 Ga0307416_100519386 3300032002 Bacteria 1259
283 Ga0307414_10001585 3300032004 Bacteria 11798
284 Ga0307414_10027396 3300032004 Bacteria 3682
285 Ga0307414_10028589 3300032004 Bacteria 3618
286 Ga0307414_10050858 3300032004 Bacteria 2873
287 Ga0307411_10000176 3300032005 Bacteria 20455
288 Ga0307411_10003932 3300032005 Bacteria 7012
289 Ga0307411_10023814 3300032005 Bacteria 3636
290 Ga0307415_100003198 3300032126 Bacteria 8312
291 Ga0307415_100276143 3300032126 Bacteria 1379
292 Ga0373960_0046249 3300035121 Bacteria 1277
293 Ga0373931_0060637 3300035691 Bacteria 2037
294 Ga0395899_0003579 3300037312 Bacteria 12304
295 Ga0395899_0064087 3300037312 Bacteria 2702
296 Ga0395899_0108665 3300037312 Bacteria 1996
297 Ga0395900_0012059 3300037418 Bacteria 8833
298 Ga0395900_0058574 3300037418 Bacteria 3965
299 Ga0395900_0069249 3300037418 Bacteria 3626
300 Ga0395900_0096087 3300037418 Bacteria 3044
301 Ga0395900_0343514 3300037418 Bacteria 1467
302 Ga0395898_0008311 3300037466 Bacteria 10974
303 Ga0395898_0308551 3300037466 Bacteria 1509
304 Ga0395905_0005688 3300037471 Bacteria 12668
305 Ga0395905_0084624 3300037471 Bacteria 2972
306 Ga0395905_0219073 3300037471 Bacteria 1781
307 Ga0395901_0000086 3300038443 Bacteria 125359
308 Ga0395901_0009588 3300038443 Bacteria 9821
309 Ga0395901_0155647 3300038443 Bacteria 2400
310 Ga0395901_0496046 3300038443 Bacteria 1243
311 Ga0436365_1487283 3300039437 Bacteria 2979
312 Ga0436363_0435808 3300039450 Bacteria 1057
313 Ga0439465_0062891 3300041413 Bacteria 1232
314 Ga0439432_015529 3300042006 Bacteria 2569
315 Ga0439449_0038548 3300042007 Bacteria 1777
316 Ga0450889_000034 3300042144 Bacteria 11809
317 Ga0466972_0033553 3300044658 Bacteria 2517
318 Ga0466965_0002894 3300044683 Bacteria 7412
319 Ga0466965_0003465 3300044683 Bacteria 6921
320 Ga0466961_0125091 3300044693 Bacteria 1613
321 Ga0466963_0011747 3300044694 Bacteria 5339
322 Ga0466968_0161403 3300044735 Bacteria 1034
323 Ga0466970_0001507 3300044765 Bacteria 11213
324 Ga0466957_0006527 3300044842 Bacteria 6587
325 Ga0466957_0116058 3300044842 Bacteria 1703
326 Ga0466957_0163100 3300044842 Bacteria 1448
327 Ga0466960_0090258 3300044901 Bacteria 1560
328 Ga0466959_0051736 3300045049 Bacteria 3010
329 Ga0466967_0111760 3300045976 Bacteria 2511
330 Ga0466967_0801537 3300045976 Bacteria 935
331 Ga0495629_0006769 3300046459 Bacteria 8470
332 Ga0495608_0044555 3300046511 Bacteria 2960
333 Ga0495657_0018201 3300046675 Bacteria 5089
334 Ga0495599_0271772 3300046678 Bacteria 1028
335 Ga0496101_0090891 3300048904 Bacteria 2271
336 Ga0496105_0105012 3300048908 Bacteria 2332
337 Ga0496107_0090288 3300048910 Bacteria 2238
338 Ga0496108_0013567 3300048911 Bacteria 6650
339 Ga0496108_0333176 3300048911 Bacteria 1324
340 Ga0496111_0189819 3300048914 Bacteria 1527
341 Ga0496112_0127922 3300048915 Bacteria 2511
342 Ga0496113_0460102 3300048916 Bacteria 1022
343 Ga0496113_0511893 3300048916 Bacteria 963
344 Ga0496114_0000084 3300048917 Bacteria 67352
345 Ga0496114_0055244 3300048917 Bacteria 3312
346 Ga0496115_0015861 3300048918 Bacteria 5724
347 Ga0496123_0014699 3300048926 Bacteria 6470
348 Ga0496125_0174705 3300048928 Bacteria 1439
349 Ga0496126_0003501 3300048929 Bacteria 19807
350 Ga0501032_0023283 3300049569 Bacteria 4284
351 Ga0501033_0098136 3300049570 Bacteria 2140
352 Ga0501033_0128407 3300049570 Bacteria 1837
353 Ga0501034_0001623 3300049571 Bacteria 29167
354 Ga0501036_0010896 3300049572 Bacteria 7515
355 Ga0501037_0033563 3300049573 Bacteria 3790
356 Ga0501038_0024615 3300049574 Bacteria 5369
357 Ga0501038_0444301 3300049574 Bacteria 998
358 Ga0501039_0067039 3300049575 Bacteria 2787
359 Ga0501040_0014692 3300049576 Bacteria 5165
360 Ga0501041_0006654 3300049577 Bacteria 6768
361 Ga0501042_0000727 3300049578 Bacteria 17844
362 Ga0501043_0361721 3300049579 Bacteria 1101
363 Ga0501046_0085879 3300049580 Bacteria 2426
364 Ga0501048_0003892 3300049582 Bacteria 11359
365 Ga0501069_0031312 3300049585 Bacteria 2925
366 Ga0501071_0007715 3300049587 Bacteria 7093
367 Ga0501072_0008195 3300049588 Bacteria 7934
368 Ga0501073_0031562 3300049589 Bacteria 3780
369 Ga0501075_0010017 3300049591 Bacteria 6649
370 Ga0501076_0018219 3300049592 Bacteria 5349
371 Ga0501202_014892 3300049652 Bacteria 1492
372 Ga0501227_025912 3300049665 Bacteria 1379
373 Ga0501235_001571 3300049669 Bacteria 4895
374 Ga0501257_002119 3300049686 Bacteria 4145
375 Ga0501257_004449 3300049686 Bacteria 3062
376 Ga0501080_0075911 3300049742 Bacteria 3126
377 Ga0501081_0069664 3300049743 Bacteria 2450
378 Ga0501083_0151281 3300049744 Bacteria 1519
379 Ga0501268_003113 3300049765 Bacteria 2246
380 Ga0501283_003306 3300049779 Bacteria 2127
381 Ga0501035_0028568 3300049822 Bacteria 5091
382 Ga0501044_0000776 3300049823 Bacteria 38704
383 Ga0501044_0482039 3300049823 Bacteria 1143
384 Ga0501045_0010487 3300049824 Bacteria 6491
385 nmdc:mga08y16_264229_c1 3300050511 Bacteria 1777
386 Ga0500646_0003973 3300053090 Bacteria 3760
387 Ga0500641_0022062 3300053096 Bacteria 2434
388 Ga0500650_0050713 3300053098 Bacteria 1927
389 Ga0500556_0034455 3300053104 Bacteria 1743
390 Ga0501084_0061702 3300054114 Bacteria 3139
391 Ga0501082_0096183 3300060353 Bacteria 2560
392 Ga0530510_0052219 3300061734 Bacteria 2954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0125091 Ga0466961_0125091_391_1317 242
2 3300046678 Ga0495599_0271772 Ga0495599_0271772_259_1014 249
3 3300044683 Ga0466965_0003465 Ga0466965_0003465_1577_2338 253
4 3300044735 Ga0466968_0161403 Ga0466968_0161403_69_830 253
5 3300044842 Ga0466957_0006527 Ga0466957_0006527_4190_4951 253
6 3300044901 Ga0466960_0090258 Ga0466960_0090258_204_965 253
7 3300045049 Ga0466959_0051736 Ga0466959_0051736_177_938 253
8 3300048904 Ga0496101_0090891 Ga0496101_0090891_676_1443 253
9 3300048914 Ga0496111_0189819 Ga0496111_0189819_17_781 253
10 3300048916 Ga0496113_0511893 Ga0496113_0511893_30_797 253
11 3300048926 Ga0496123_0014699 Ga0496123_0014699_2296_3063 253
12 3300048928 Ga0496125_0174705 Ga0496125_0174705_61_828 253
13 3300048929 Ga0496126_0003501 Ga0496126_0003501_6019_6786 253
14 3300005337 Ga0070682_100017104 Ga0070682_1000171046 257
15 3300005347 Ga0070668_100050604 Ga0070668_1000506044 257
16 3300005366 Ga0070659_100135659 Ga0070659_1001356592 257
17 3300005441 Ga0070700_100124037 Ga0070700_1001240372 257
18 3300005455 Ga0070663_100077748 Ga0070663_1000777483 257
19 3300005459 Ga0068867_100100087 Ga0068867_1001000873 257
20 3300005466 Ga0070685_10045673 Ga0070685_100456732 257
21 3300005535 Ga0070684_100230928 Ga0070684_1002309282 257
22 3300005578 Ga0068854_100023490 Ga0068854_1000234903 257
23 3300005616 Ga0068852_100216090 Ga0068852_1002160903 257
24 3300005617 Ga0068859_100634624 Ga0068859_1006346242 257
25 3300006881 Ga0068865_100588740 Ga0068865_1005887402 257
26 3300006931 Ga0097620_100634643 Ga0097620_1006346431 257
27 3300009148 Ga0105243_10021985 Ga0105243_100219855 257
28 3300009553 Ga0105249_10401649 Ga0105249_104016492 257
29 3300010375 Ga0105239_10172640 Ga0105239_101726402 257
30 3300013102 Ga0157371_10040275 Ga0157371_100402755 257
31 3300013297 Ga0157378_10716571 Ga0157378_107165712 257
32 3300014745 Ga0157377_10023385 Ga0157377_100233853 257
33 3300014968 Ga0157379_10039154 Ga0157379_100391545 257
34 3300017792 Ga0163161_10078590 Ga0163161_100785904 257
35 3300025900 Ga0207710_10032135 Ga0207710_100321353 257
36 3300025901 Ga0207688_10006748 Ga0207688_100067487 257
37 3300025904 Ga0207647_10176964 Ga0207647_101769642 257
38 3300025907 Ga0207645_10009613 Ga0207645_100096134 257
39 3300025933 Ga0207706_10031538 Ga0207706_100315386 257
40 3300025937 Ga0207669_10330376 Ga0207669_103303762 257
41 3300025938 Ga0207704_10661345 Ga0207704_106613451 257
42 3300025940 Ga0207691_10138426 Ga0207691_101384262 257
43 3300025949 Ga0207667_10333857 Ga0207667_103338571 257
44 3300026041 Ga0207639_10220274 Ga0207639_102202742 257
45 3300026078 Ga0207702_10345115 Ga0207702_103451153 257
46 3300026089 Ga0207648_10050136 Ga0207648_100501365 257
47 3300026116 Ga0207674_10052184 Ga0207674_100521844 257
48 3300026118 Ga0207675_100025843 Ga0207675_1000258436 257
49 3300026121 Ga0207683_10096792 Ga0207683_100967922 257
50 3300026142 Ga0207698_10195545 Ga0207698_101955452 257
51 3300050511 nmdc:mga08y16_264229_c1 nmdc:mga08y16_264229_c1_631_1410 257
52 3300005329 Ga0070683_100485712 Ga0070683_1004857121 258
53 3300005334 Ga0068869_100073241 Ga0068869_1000732413 258
54 3300005337 Ga0070682_100081579 Ga0070682_1000815792 258
55 3300005338 Ga0068868_100178109 Ga0068868_1001781092 258
56 3300005340 Ga0070689_100099243 Ga0070689_1000992432 258
57 3300005436 Ga0070713_100309761 Ga0070713_1003097612 258
58 3300005457 Ga0070662_100209477 Ga0070662_1002094772 258
59 3300005466 Ga0070685_10041727 Ga0070685_100417272 258
60 3300005543 Ga0070672_100332522 Ga0070672_1003325222 258
61 3300005618 Ga0068864_100094741 Ga0068864_1000947415 258
62 3300005843 Ga0068860_100424225 Ga0068860_1004242252 258
63 3300006028 Ga0070717_10104251 Ga0070717_101042512 258
64 3300009551 Ga0105238_10566236 Ga0105238_105662361 258
65 3300010375 Ga0105239_10723618 Ga0105239_107236181 258
66 3300013105 Ga0157369_10194517 Ga0157369_101945172 258
67 3300013296 Ga0157374_10382952 Ga0157374_103829522 258
68 3300025908 Ga0207643_10030576 Ga0207643_100305762 258
69 3300025919 Ga0207657_10118084 Ga0207657_101180841 258
70 3300026088 Ga0207641_10107396 Ga0207641_101073963 258
71 3300026121 Ga0207683_10054767 Ga0207683_100547672 258
72 3300048911 Ga0496108_0333176 Ga0496108_0333176_166_951 258
73 3300028794 Ga0307515_10005159 Ga0307515_100051592 259
74 3300030522 Ga0307512_10003932 Ga0307512_1000393214 259
75 3300031456 Ga0307513_10011704 Ga0307513_100117045 259
76 3300031616 Ga0307508_10029623 Ga0307508_100296232 259
77 3300053090 Ga0500646_0003973 Ga0500646_0003973_1234_2088 259
78 3300053096 Ga0500641_0022062 Ga0500641_0022062_727_1581 259
79 3300053098 Ga0500650_0050713 Ga0500650_0050713_198_1052 259
80 3300053104 Ga0500556_0034455 Ga0500556_0034455_818_1672 259
81 3300005327 Ga0070658_10195196 Ga0070658_101951962 260
82 3300005339 Ga0070660_100110453 Ga0070660_1001104532 260
83 3300005344 Ga0070661_100024487 Ga0070661_1000244873 260
84 3300005366 Ga0070659_100010450 Ga0070659_1000104505 260
85 3300028794 Ga0307515_10033135 Ga0307515_100331353 262
86 3300031456 Ga0307513_10099337 Ga0307513_100993372 262
87 3300009098 Ga0105245_10127784 Ga0105245_101277843 264
88 3300009177 Ga0105248_10440234 Ga0105248_104402342 264
89 3300013306 Ga0163162_10260067 Ga0163162_102600672 264
90 3300013308 Ga0157375_10007341 Ga0157375_100073412 264
91 3300014325 Ga0163163_10021138 Ga0163163_100211387 264
92 3300048908 Ga0496105_0105012 Ga0496105_0105012_227_1024 264
93 3300048910 Ga0496107_0090288 Ga0496107_0090288_774_1571 264
94 3300048911 Ga0496108_0013567 Ga0496108_0013567_4975_5772 264
95 3300048915 Ga0496112_0127922 Ga0496112_0127922_1540_2337 264
96 3300048916 Ga0496113_0460102 Ga0496113_0460102_173_970 264
97 3300048917 Ga0496114_0055244 Ga0496114_0055244_1413_2210 264
98 3300003203 JGI25406J46586_10029776 JGI25406J46586_100297762 265
99 3300005985 Ga0081539_10000205 Ga0081539_10000205116 265
100 3300044658 Ga0466972_0033553 Ga0466972_0033553_1303_2148 266
101 3300044683 Ga0466965_0002894 Ga0466965_0002894_2500_3345 266
102 3300044765 Ga0466970_0001507 Ga0466970_0001507_3209_4054 266
103 3300044842 Ga0466957_0163100 Ga0466957_0163100_270_1115 266
104 3300009093 Ga0105240_10244302 Ga0105240_102443023 267
105 3300013102 Ga0157371_10022761 Ga0157371_100227612 267
106 3300013104 Ga0157370_10138346 Ga0157370_101383461 267
107 3300013105 Ga0157369_10148583 Ga0157369_101485832 267
108 3300037418 Ga0395900_0058574 Ga0395900_0058574_306_1112 267
109 3300037466 Ga0395898_0308551 Ga0395898_0308551_520_1326 267
110 3300039450 Ga0436363_0435808 Ga0436363_0435808_27_872 267
111 3300044842 Ga0466957_0116058 Ga0466957_0116058_61_867 267
112 3300045976 Ga0466967_0801537 Ga0466967_0801537_118_924 267
113 3300049579 Ga0501043_0361721 Ga0501043_0361721_17_823 267
114 3300005331 Ga0070670_100035221 Ga0070670_1000352213 268
115 3300005333 Ga0070677_10111730 Ga0070677_101117302 268
116 3300005336 Ga0070680_100171704 Ga0070680_1001717042 268
117 3300005344 Ga0070661_100124215 Ga0070661_1001242152 268
118 3300005354 Ga0070675_100256435 Ga0070675_1002564352 268
119 3300005356 Ga0070674_100031146 Ga0070674_1000311463 268
120 3300005456 Ga0070678_100044403 Ga0070678_1000444033 268
121 3300005457 Ga0070662_100115688 Ga0070662_1001156882 268
122 3300005458 Ga0070681_10022967 Ga0070681_100229676 268
123 3300005564 Ga0070664_100021723 Ga0070664_1000217232 268
124 3300005578 Ga0068854_100125265 Ga0068854_1001252652 268
125 3300005616 Ga0068852_100168568 Ga0068852_1001685682 268
126 3300005618 Ga0068864_100026115 Ga0068864_1000261152 268
127 3300009177 Ga0105248_10190206 Ga0105248_101902063 268
128 3300013104 Ga0157370_10633014 Ga0157370_106330142 268
129 3300013306 Ga0163162_10256074 Ga0163162_102560742 268
130 3300020082 Ga0206353_11845874 Ga0206353_118458741 268
131 3300025901 Ga0207688_10069542 Ga0207688_100695422 268
132 3300025912 Ga0207707_10390222 Ga0207707_103902222 268
133 3300025917 Ga0207660_10036958 Ga0207660_100369582 268
134 3300025925 Ga0207650_10004837 Ga0207650_100048375 268
135 3300025926 Ga0207659_10171250 Ga0207659_101712502 268
136 3300025933 Ga0207706_10069389 Ga0207706_100693892 268
137 3300025944 Ga0207661_10276906 Ga0207661_102769062 268
138 3300025945 Ga0207679_10003185 Ga0207679_100031856 268
139 3300026121 Ga0207683_10066019 Ga0207683_100660194 268
140 3300026142 Ga0207698_10070344 Ga0207698_100703442 268
141 3300026142 Ga0207698_10121650 Ga0207698_101216502 268
142 3300031731 Ga0307405_10323756 Ga0307405_103237561 268
143 3300031852 Ga0307410_10020924 Ga0307410_100209242 268
144 3300031903 Ga0307407_10002484 Ga0307407_100024847 268
145 3300031911 Ga0307412_10004071 Ga0307412_100040715 268
146 3300031995 Ga0307409_100057394 Ga0307409_1000573941 268
147 3300032002 Ga0307416_100002520 Ga0307416_1000025208 268
148 3300032004 Ga0307414_10028589 Ga0307414_100285894 268
149 3300035691 Ga0373931_0060637 Ga0373931_0060637_1212_2024 268
150 3300041413 Ga0439465_0062891 Ga0439465_0062891_352_1161 268
151 3300042006 Ga0439432_015529 Ga0439432_015529_1416_2225 268
152 3300042007 Ga0439449_0038548 Ga0439449_0038548_486_1295 268
153 3300042144 Ga0450889_000034 Ga0450889_000034_7214_8023 268
154 3300044694 Ga0466963_0011747 Ga0466963_0011747_2763_3569 268
155 3300045976 Ga0466967_0111760 Ga0466967_0111760_643_1449 268
156 3300049574 Ga0501038_0444301 Ga0501038_0444301_126_935 268
157 3300049652 Ga0501202_014892 Ga0501202_014892_29_838 268
158 3300049665 Ga0501227_025912 Ga0501227_025912_487_1296 268
159 3300049669 Ga0501235_001571 Ga0501235_001571_3918_4727 268
160 3300049686 Ga0501257_004449 Ga0501257_004449_2138_2947 268
161 3300049765 Ga0501268_003113 Ga0501268_003113_54_863 268
162 3300049779 Ga0501283_003306 Ga0501283_003306_290_1099 268
163 3300035121 Ga0373960_0046249 Ga0373960_0046249_411_1250 271
164 3300031995 Ga0307409_100029313 Ga0307409_1000293132 273
165 3300046459 Ga0495629_0006769 Ga0495629_0006769_5616_6461 273
166 3300046511 Ga0495608_0044555 Ga0495608_0044555_124_969 273
167 3300046675 Ga0495657_0018201 Ga0495657_0018201_4215_5060 273
168 3300003316 rootH1_10015619 rootH1_100156192 274
169 3300005339 Ga0070660_100114758 Ga0070660_1001147581 274
170 3300005366 Ga0070659_100225649 Ga0070659_1002256492 274
171 3300005457 Ga0070662_100000934 Ga0070662_10000093413 274
172 3300005458 Ga0070681_10170236 Ga0070681_101702362 274
173 3300005530 Ga0070679_100392989 Ga0070679_1003929892 274
174 3300005539 Ga0068853_100184576 Ga0068853_1001845762 274
175 3300005564 Ga0070664_100036193 Ga0070664_1000361932 274
176 3300006175 Ga0070712_100050011 Ga0070712_1000500113 274
177 3300013100 Ga0157373_10045630 Ga0157373_100456302 274
178 3300025915 Ga0207693_10091114 Ga0207693_100911143 274
179 3300025917 Ga0207660_10076133 Ga0207660_100761332 274
180 3300025920 Ga0207649_10109244 Ga0207649_101092443 274
181 3300025932 Ga0207690_10049224 Ga0207690_100492242 274
182 3300025933 Ga0207706_10000576 Ga0207706_100005762 274
183 3300025945 Ga0207679_10118448 Ga0207679_101184483 274
184 3300026067 Ga0207678_10224595 Ga0207678_102245952 274
185 3300049686 Ga0501257_002119 Ga0501257_002119_1919_2770 274
186 iso_pu_bacteria 649633069 649812176 274
187 3300005366 Ga0070659_100073640 Ga0070659_1000736401 278
188 3300025919 Ga0207657_10247999 Ga0207657_102479992 278
189 3300031995 Ga0307409_100086788 Ga0307409_1000867882 278
190 3300005435 Ga0070714_100143070 Ga0070714_1001430702 279
191 3300005614 Ga0068856_100301588 Ga0068856_1003015882 279
192 3300009551 Ga0105238_10138752 Ga0105238_101387522 279
193 3300009551 Ga0105238_10450809 Ga0105238_104508092 279
194 3300011119 Ga0105246_10225552 Ga0105246_102255522 279
195 3300013102 Ga0157371_10059222 Ga0157371_100592222 279
196 3300013102 Ga0157371_10317985 Ga0157371_103179852 279
197 3300013104 Ga0157370_10053017 Ga0157370_100530172 279
198 3300013104 Ga0157370_10232147 Ga0157370_102321472 279
199 3300013104 Ga0157370_10283699 Ga0157370_102836992 279
200 3300013105 Ga0157369_10186843 Ga0157369_101868432 279
201 3300013105 Ga0157369_10312647 Ga0157369_103126472 279
202 3300013296 Ga0157374_10057282 Ga0157374_100572822 279
203 3300013307 Ga0157372_10930744 Ga0157372_109307442 279
204 3300037418 Ga0395900_0069249 Ga0395900_0069249_66_905 279
205 3300037418 Ga0395900_0096087 Ga0395900_0096087_115_954 279
206 3300037471 Ga0395905_0005688 Ga0395905_0005688_2677_3516 279
207 3300038443 Ga0395901_0000086 Ga0395901_0000086_54833_55672 279
208 3300039437 Ga0436365_1487283 Ga0436365_1487283_80_931 279
209 3300048917 Ga0496114_0000084 Ga0496114_0000084_60514_61365 279
210 3300048918 Ga0496115_0015861 Ga0496115_0015861_870_1721 279
211 3300032002 Ga0307416_100519386 Ga0307416_1005193861 280
212 3300005339 Ga0070660_100120943 Ga0070660_1001209432 281
213 3300005366 Ga0070659_100062138 Ga0070659_1000621383 281
214 3300005455 Ga0070663_100124106 Ga0070663_1001241061 281
215 3300005614 Ga0068856_100009582 Ga0068856_1000095825 281
216 3300025904 Ga0207647_10001296 Ga0207647_100012964 281
217 3300025909 Ga0207705_10076375 Ga0207705_100763754 281
218 3300025913 Ga0207695_10181153 Ga0207695_101811532 281
219 3300026067 Ga0207678_10089008 Ga0207678_100890083 281
220 3300026078 Ga0207702_10000859 Ga0207702_100008596 281
221 3300031824 Ga0307413_10069103 Ga0307413_100691032 281
222 3300032002 Ga0307416_100160080 Ga0307416_1001600802 281
223 3300032004 Ga0307414_10050858 Ga0307414_100508582 281
224 3300032005 Ga0307411_10023814 Ga0307411_100238141 281
225 3300032126 Ga0307415_100276143 Ga0307415_1002761431 281
226 3300049569 Ga0501032_0023283 Ga0501032_0023283_3190_4038 281
227 3300049570 Ga0501033_0098136 Ga0501033_0098136_656_1504 281
228 3300049572 Ga0501036_0010896 Ga0501036_0010896_645_1493 281
229 3300049573 Ga0501037_0033563 Ga0501037_0033563_1336_2184 281
230 3300049574 Ga0501038_0024615 Ga0501038_0024615_2878_3726 281
231 3300049575 Ga0501039_0067039 Ga0501039_0067039_747_1595 281
232 3300049576 Ga0501040_0014692 Ga0501040_0014692_2599_3447 281
233 3300049577 Ga0501041_0006654 Ga0501041_0006654_2198_3046 281
234 3300049578 Ga0501042_0000727 Ga0501042_0000727_14976_15824 281
235 3300049580 Ga0501046_0085879 Ga0501046_0085879_654_1502 281
236 3300049582 Ga0501048_0003892 Ga0501048_0003892_6326_7174 281
237 3300049585 Ga0501069_0031312 Ga0501069_0031312_1526_2374 281
238 3300049587 Ga0501071_0007715 Ga0501071_0007715_5337_6185 281
239 3300049588 Ga0501072_0008195 Ga0501072_0008195_5156_6004 281
240 3300049589 Ga0501073_0031562 Ga0501073_0031562_1776_2624 281
241 3300049591 Ga0501075_0010017 Ga0501075_0010017_4155_5003 281
242 3300049592 Ga0501076_0018219 Ga0501076_0018219_1732_2580 281
243 3300049742 Ga0501080_0075911 Ga0501080_0075911_1302_2150 281
244 3300049743 Ga0501081_0069664 Ga0501081_0069664_1038_1886 281
245 3300049744 Ga0501083_0151281 Ga0501083_0151281_359_1207 281
246 3300049822 Ga0501035_0028568 Ga0501035_0028568_3166_4014 281
247 3300049823 Ga0501044_0482039 Ga0501044_0482039_41_889 281
248 3300049824 Ga0501045_0010487 Ga0501045_0010487_1775_2623 281
249 3300054114 Ga0501084_0061702 Ga0501084_0061702_1947_2795 281
250 3300060353 Ga0501082_0096183 Ga0501082_0096183_1235_2083 281
251 3300061734 Ga0530510_0052219 Ga0530510_0052219_38_886 281
252 iso_pu_bacteria 2831935698 2831936206 281
253 iso_pu_bacteria 2867507094 2867507190 281
254 3300001989 JGI24739J22299_10000268 JGI24739J22299_100002684 282
255 3300001990 JGI24737J22298_10000441 JGI24737J22298_1000044113 282
256 3300002067 JGI24735J21928_10001442 JGI24735J21928_100014424 282
257 3300002075 JGI24738J21930_10000543 JGI24738J21930_1000054312 282
258 3300005327 Ga0070658_10048161 Ga0070658_100481611 282
259 3300005328 Ga0070676_10160064 Ga0070676_101600642 282
260 3300005329 Ga0070683_100050448 Ga0070683_1000504483 282
261 3300005329 Ga0070683_100117009 Ga0070683_1001170092 282
262 3300005329 Ga0070683_100147365 Ga0070683_1001473652 282
263 3300005329 Ga0070683_100244895 Ga0070683_1002448951 282
264 3300005336 Ga0070680_100000498 Ga0070680_10000049818 282
265 3300005336 Ga0070680_100007601 Ga0070680_1000076013 282
266 3300005336 Ga0070680_100396943 Ga0070680_1003969432 282
267 3300005336 Ga0070680_100409537 Ga0070680_1004095371 282
268 3300005338 Ga0068868_100244762 Ga0068868_1002447621 282
269 3300005339 Ga0070660_100034039 Ga0070660_1000340393 282
270 3300005339 Ga0070660_100067154 Ga0070660_1000671542 282
271 3300005339 Ga0070660_100204934 Ga0070660_1002049341 282
272 3300005339 Ga0070660_100309922 Ga0070660_1003099223 282
273 3300005339 Ga0070660_100596922 Ga0070660_1005969221 282
274 3300005344 Ga0070661_100009426 Ga0070661_1000094265 282
275 3300005344 Ga0070661_100032005 Ga0070661_1000320054 282
276 3300005344 Ga0070661_100163228 Ga0070661_1001632281 282
277 3300005344 Ga0070661_100238059 Ga0070661_1002380592 282
278 3300005345 Ga0070692_10170570 Ga0070692_101705702 282
279 3300005366 Ga0070659_100008405 Ga0070659_1000084055 282
280 3300005366 Ga0070659_100104835 Ga0070659_1001048354 282
281 3300005366 Ga0070659_100567753 Ga0070659_1005677531 282
282 3300005444 Ga0070694_100008270 Ga0070694_1000082708 282
283 3300005445 Ga0070708_100000450 Ga0070708_10000045019 282
284 3300005455 Ga0070663_100030876 Ga0070663_1000308763 282
285 3300005455 Ga0070663_100185852 Ga0070663_1001858522 282
286 3300005457 Ga0070662_100026273 Ga0070662_1000262734 282
287 3300005458 Ga0070681_10095796 Ga0070681_100957962 282
288 3300005458 Ga0070681_10297988 Ga0070681_102979882 282
289 3300005536 Ga0070697_100240091 Ga0070697_1002400911 282
290 3300005539 Ga0068853_100028472 Ga0068853_1000284722 282
291 3300005545 Ga0070695_100061398 Ga0070695_1000613981 282
292 3300005546 Ga0070696_100146902 Ga0070696_1001469022 282
293 3300005547 Ga0070693_100032603 Ga0070693_1000326034 282
294 3300005564 Ga0070664_100162806 Ga0070664_1001628062 282
295 3300005564 Ga0070664_100564886 Ga0070664_1005648862 282
296 3300005577 Ga0068857_100307116 Ga0068857_1003071162 282
297 3300005578 Ga0068854_100031688 Ga0068854_1000316884 282
298 3300005614 Ga0068856_100123583 Ga0068856_1001235831 282
299 3300005614 Ga0068856_100692880 Ga0068856_1006928802 282
300 3300005616 Ga0068852_100019340 Ga0068852_1000193406 282
301 3300005616 Ga0068852_100064024 Ga0068852_1000640242 282
302 3300005842 Ga0068858_100018190 Ga0068858_1000181905 282
303 3300009098 Ga0105245_10399438 Ga0105245_103994381 282
304 3300009551 Ga0105238_10068201 Ga0105238_100682013 282
305 3300010375 Ga0105239_10111021 Ga0105239_101110212 282
306 3300010375 Ga0105239_10395389 Ga0105239_103953892 282
307 3300013102 Ga0157371_10391800 Ga0157371_103918002 282
308 3300013104 Ga0157370_10019732 Ga0157370_100197322 282
309 3300013105 Ga0157369_10010995 Ga0157369_100109953 282
310 3300013105 Ga0157369_10169640 Ga0157369_101696402 282
311 3300025321 Ga0207656_10003567 Ga0207656_100035673 282
312 3300025893 Ga0207682_10002781 Ga0207682_100027813 282
313 3300025904 Ga0207647_10000316 Ga0207647_100003167 282
314 3300025904 Ga0207647_10021376 Ga0207647_100213763 282
315 3300025904 Ga0207647_10025516 Ga0207647_100255163 282
316 3300025909 Ga0207705_10007602 Ga0207705_1000760210 282
317 3300025909 Ga0207705_10011928 Ga0207705_100119281 282
318 3300025909 Ga0207705_10013566 Ga0207705_100135663 282
319 3300025909 Ga0207705_10024445 Ga0207705_100244453 282
320 3300025909 Ga0207705_10027057 Ga0207705_100270572 282
321 3300025909 Ga0207705_10047397 Ga0207705_100473973 282
322 3300025909 Ga0207705_10113009 Ga0207705_101130091 282
323 3300025909 Ga0207705_10216942 Ga0207705_102169422 282
324 3300025912 Ga0207707_10087614 Ga0207707_100876142 282
325 3300025913 Ga0207695_10063837 Ga0207695_100638372 282
326 3300025917 Ga0207660_10003723 Ga0207660_1000372311 282
327 3300025917 Ga0207660_10027396 Ga0207660_100273963 282
328 3300025917 Ga0207660_10094568 Ga0207660_100945682 282
329 3300025919 Ga0207657_10002718 Ga0207657_1000271818 282
330 3300025919 Ga0207657_10004197 Ga0207657_100041973 282
331 3300025919 Ga0207657_10028389 Ga0207657_100283895 282
332 3300025919 Ga0207657_10047102 Ga0207657_100471023 282
333 3300025920 Ga0207649_10266554 Ga0207649_102665542 282
334 3300025920 Ga0207649_10401386 Ga0207649_104013861 282
335 3300025921 Ga0207652_10113414 Ga0207652_101134142 282
336 3300025929 Ga0207664_10332742 Ga0207664_103327422 282
337 3300025932 Ga0207690_10200257 Ga0207690_102002572 282
338 3300025933 Ga0207706_10018713 Ga0207706_100187135 282
339 3300025933 Ga0207706_10027488 Ga0207706_100274886 282
340 3300025933 Ga0207706_10094670 Ga0207706_100946704 282
341 3300025933 Ga0207706_10123565 Ga0207706_101235652 282
342 3300025944 Ga0207661_10170583 Ga0207661_101705832 282
343 3300025944 Ga0207661_10503216 Ga0207661_105032162 282
344 3300025949 Ga0207667_10059329 Ga0207667_100593293 282
345 3300025949 Ga0207667_10162052 Ga0207667_101620522 282
346 3300026023 Ga0207677_10504954 Ga0207677_105049541 282
347 3300026035 Ga0207703_10033833 Ga0207703_100338333 282
348 3300026041 Ga0207639_10041226 Ga0207639_100412264 282
349 3300026041 Ga0207639_10376835 Ga0207639_103768352 282
350 3300026067 Ga0207678_10003211 Ga0207678_100032114 282
351 3300026067 Ga0207678_10006004 Ga0207678_1000600412 282
352 3300026067 Ga0207678_10063883 Ga0207678_100638832 282
353 3300026067 Ga0207678_10095011 Ga0207678_100950111 282
354 3300026067 Ga0207678_10292614 Ga0207678_102926142 282
355 3300026078 Ga0207702_10046091 Ga0207702_100460914 282
356 3300026078 Ga0207702_10046544 Ga0207702_100465442 282
357 3300026116 Ga0207674_10113480 Ga0207674_101134803 282
358 3300026142 Ga0207698_10044873 Ga0207698_100448732 282
359 3300026142 Ga0207698_10064986 Ga0207698_100649862 282
360 3300026142 Ga0207698_10065368 Ga0207698_100653682 282
361 3300031548 Ga0307408_100310765 Ga0307408_1003107652 282
362 3300031824 Ga0307413_10000800 Ga0307413_100008003 282
363 3300031824 Ga0307413_10003571 Ga0307413_100035711 282
364 3300031824 Ga0307413_10152228 Ga0307413_101522282 282
365 3300031852 Ga0307410_10001280 Ga0307410_1000128012 282
366 3300031852 Ga0307410_10001493 Ga0307410_1000149314 282
367 3300031852 Ga0307410_10146813 Ga0307410_101468131 282
368 3300031901 Ga0307406_10110516 Ga0307406_101105163 282
369 3300031903 Ga0307407_10003434 Ga0307407_1000343410 282
370 3300031911 Ga0307412_10005181 Ga0307412_100051816 282
371 3300031911 Ga0307412_10073074 Ga0307412_100730741 282
372 3300031995 Ga0307409_100002303 Ga0307409_1000023032 282
373 3300031995 Ga0307409_100012072 Ga0307409_1000120723 282
374 3300031995 Ga0307409_100030125 Ga0307409_1000301252 282
375 3300032002 Ga0307416_100008074 Ga0307416_1000080742 282
376 3300032004 Ga0307414_10001585 Ga0307414_1000158514 282
377 3300032004 Ga0307414_10027396 Ga0307414_100273963 282
378 3300032005 Ga0307411_10000176 Ga0307411_1000017615 282
379 3300032005 Ga0307411_10003932 Ga0307411_1000393210 282
380 3300032126 Ga0307415_100003198 Ga0307415_1000031982 282
381 3300037312 Ga0395899_0003579 Ga0395899_0003579_3259_4113 282
382 3300037312 Ga0395899_0064087 Ga0395899_0064087_1483_2331 282
383 3300037312 Ga0395899_0108665 Ga0395899_0108665_956_1804 282
384 3300037418 Ga0395900_0012059 Ga0395900_0012059_3883_4737 282
385 3300037418 Ga0395900_0343514 Ga0395900_0343514_569_1417 282
386 3300037466 Ga0395898_0008311 Ga0395898_0008311_1928_2782 282
387 3300037471 Ga0395905_0084624 Ga0395905_0084624_1050_1904 282
388 3300037471 Ga0395905_0219073 Ga0395905_0219073_51_899 282
389 3300038443 Ga0395901_0009588 Ga0395901_0009588_2243_3097 282
390 3300038443 Ga0395901_0155647 Ga0395901_0155647_838_1686 282
391 3300038443 Ga0395901_0496046 Ga0395901_0496046_168_1016 282
392 3300049570 Ga0501033_0128407 Ga0501033_0128407_402_1259 282
393 3300049571 Ga0501034_0001623 Ga0501034_0001623_5024_5881 282
394 3300049823 Ga0501044_0000776 Ga0501044_0000776_6519_7451 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

6

249

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8733 4 257
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8665 4 257
7txy-assembly2.cif.gz_E crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.7846 4 255
3vsj-assembly1.cif.gz_D crystal structure of 1,6-apd (2-animophenol-1,6-dioxygenase) complexed with intermediate products 0.7406 4 255
5hee-assembly1.cif.gz_B crystal structure of the tk2203 protein 0.7327 4 256
ID Description Score Start End Superfamily
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9183 2 257 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8834 1 256 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8668 2 257 3.40.830.10
2pw6A00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8608 5 257 3.40.830.10
2pw6A00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.854 5 257 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A845A672-F1-model_v4 4,5-DOPA dioxygenase extradiol (EC 1.13.11.29) 0.9396 1 257 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A254N974-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9356 117 245 GO:0008198
GO:0008270
GO:0016701
AF-A0A2S0LW63-F1-model_v4 4,5-DOPA dioxygenase extradiol 0.9353 1 256 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A1A0SAQ4-F1-model_v4 deleted 0.9338 4 256
AF-A0A1Q4UH87-F1-model_v4 deleted 0.9335 4 255

Feature Viewer

pLDDT pTM Quality
87.32 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map