F432873

General Info

Members Datasets Scaffolds Average Seq Length
394 209 394 174

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100003693|Ga0075435_1000036932
Length 185
Sequence MTIDVLLDALRGTLNDVSKWAIPLMLVGIPLIGVVRKVKVYDVFIDGAKEGFDVAVKIIPFLVGILVAIGMFRGSGAMDLLTAGLRPLLARIGFPPEIFPLAVLRTLSGSGSLGLATDIIKTHGPDSFLGRTAATMYGSSETTFYVLAVYFGAIGVKRTRHAVPAALIGDVVAAITAVAVCVWLF

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
124 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
125 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
126 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
127 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
152 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
175 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
176 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
184 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
185 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 3.3
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10991150 2162886012 Bacteria 822
2 Ga0065714_10225442 3300005288 Bacteria 830
3 Ga0065712_10000653 3300005290 Bacteria 10430
4 Ga0065712_10084694 3300005290 Bacteria 2746
5 Ga0065712_10216887 3300005290 Bacteria 1054
6 Ga0065715_10133166 3300005293 Bacteria 1977
7 Ga0065715_10151465 3300005293 Bacteria 1724
8 Ga0065715_10174786 3300005293 Bacteria 1520
9 Ga0065715_10202336 3300005293 Bacteria 1355
10 Ga0070683_100000081 3300005329 Bacteria 64788
11 Ga0070683_100304452 3300005329 Bacteria 1516
12 Ga0070670_100000077 3300005331 Bacteria 94670
13 Ga0070670_100002418 3300005331 Bacteria 15382
14 Ga0070670_100028879 3300005331 Bacteria 4774
15 Ga0070670_100621823 3300005331 Bacteria 967
16 Ga0070677_10133894 3300005333 Unclassified 1135
17 Ga0070680_100013351 3300005336 Bacteria 6396
18 Ga0068868_100001168 3300005338 Bacteria 17977
19 Ga0070689_100276540 3300005340 Bacteria 1392
20 Ga0070687_100004612 3300005343 Bacteria 5507
21 Ga0070661_100043933 3300005344 Bacteria 3264
22 Ga0070661_100326327 3300005344 Bacteria 1200
23 Ga0070692_10000431 3300005345 Bacteria 12718
24 Ga0070692_10200323 3300005345 Unclassified 1169
25 Ga0070668_100140580 3300005347 Bacteria 1945
26 Ga0070668_100235219 3300005347 Bacteria 1516
27 Ga0070669_100002411 3300005353 Bacteria 13536
28 Ga0070675_100000005 3300005354 Bacteria 295918
29 Ga0070675_100175168 3300005354 Unclassified 1852
30 Ga0070675_101381780 3300005354 Bacteria 649
31 Ga0070671_100038083 3300005355 Unclassified 3992
32 Ga0070671_100964638 3300005355 Bacteria 746
33 Ga0070674_100000713 3300005356 Bacteria 16928
34 Ga0070674_100614428 3300005356 Bacteria 920
35 Ga0070673_100528819 3300005364 Bacteria 1069
36 Ga0070688_100096304 3300005365 Unclassified 1944
37 Ga0070659_100175742 3300005366 Bacteria 1756
38 Ga0070701_10000607 3300005438 Bacteria 12521
39 Ga0070701_10112548 3300005438 Unclassified 1523
40 Ga0070701_10505306 3300005438 Bacteria 785
41 Ga0070700_100000096 3300005441 Bacteria 58388
42 Ga0070678_100916027 3300005456 Bacteria 802
43 Ga0070662_100031737 3300005457 Bacteria 3710
44 Ga0070662_100204900 3300005457 Bacteria 1567
45 Ga0070685_10013123 3300005466 Bacteria 4362
46 Ga0070707_100180390 3300005468 Unclassified 2058
47 Ga0070698_100149788 3300005471 Unclassified 2281
48 Ga0070698_100646350 3300005471 Unclassified 999
49 Ga0070699_100006505 3300005518 Bacteria 10173
50 Ga0070684_100000695 3300005535 Bacteria 23208
51 Ga0070684_100000818 3300005535 Bacteria 21749
52 Ga0068853_100232704 3300005539 Unclassified 1686
53 Ga0070672_100365160 3300005543 Bacteria 1233
54 Ga0070693_100210273 3300005547 Bacteria 1269
55 Ga0070664_100000565 3300005564 Bacteria 28314
56 Ga0070664_101718107 3300005564 Bacteria 595
57 Ga0068857_100035271 3300005577 Bacteria 4430
58 Ga0068854_100007057 3300005578 Bacteria 7170
59 Ga0070702_100165107 3300005615 Bacteria 1435
60 Ga0070702_100179099 3300005615 Bacteria 1385
61 Ga0070702_100270140 3300005615 Bacteria 1162
62 Ga0070702_100442021 3300005615 Bacteria 941
63 Ga0068852_100521179 3300005616 Bacteria 1186
64 Ga0068861_100038986 3300005719 Bacteria 3544
65 Ga0068861_100126391 3300005719 Bacteria 2069
66 Ga0068870_10306496 3300005840 Unclassified 1004
67 Ga0068863_100655489 3300005841 Bacteria 1041
68 Ga0068862_100111883 3300005844 Unclassified 2398
69 Ga0068862_100564947 3300005844 Bacteria 1088
70 Ga0070717_10003437 3300006028 Bacteria 11329
71 Ga0070717_10045223 3300006028 Bacteria 3599
72 Ga0075367_10038524 3300006178 Bacteria 2783
73 Ga0075366_10144542 3300006195 Bacteria 1439
74 Ga0075366_10621058 3300006195 Unclassified 670
75 Ga0097621_100085084 3300006237 Bacteria 2637
76 Ga0075428_100012188 3300006844 Bacteria 9559
77 Ga0075428_100012230 3300006844 Bacteria 9544
78 Ga0075428_100014102 3300006844 Bacteria 8892
79 Ga0075428_100019855 3300006844 Bacteria 7439
80 Ga0075428_100022849 3300006844 Bacteria 6919
81 Ga0075428_100527203 3300006844 Bacteria 1263
82 Ga0075430_100000708 3300006846 Bacteria 25454
83 Ga0075430_100028728 3300006846 Bacteria 4723
84 Ga0075430_100033924 3300006846 Bacteria 4331
85 Ga0075430_100483696 3300006846 Bacteria 1021
86 Ga0075431_100008614 3300006847 Bacteria 10214
87 Ga0075431_100020628 3300006847 Bacteria 6734
88 Ga0075431_100074980 3300006847 Bacteria 3491
89 Ga0075431_100103924 3300006847 Bacteria 2932
90 Ga0075431_100347039 3300006847 Bacteria 1493
91 Ga0075433_10768975 3300006852 Bacteria 842
92 Ga0075434_100002588 3300006871 Bacteria 15973
93 Ga0075434_100137918 3300006871 Bacteria 2459
94 Ga0075434_100191094 3300006871 Bacteria 2068
95 Ga0075429_100003000 3300006880 Bacteria 14318
96 Ga0075429_100010295 3300006880 Bacteria 8092
97 Ga0075429_101063528 3300006880 Bacteria 707
98 Ga0075436_100014984 3300006914 Bacteria 5315
99 Ga0075435_100003693 3300007076 Bacteria 10428
100 Ga0075435_100003735 3300007076 Bacteria 10375
101 Ga0075435_100041404 3300007076 Bacteria 3682
102 Ga0075435_100248583 3300007076 Bacteria 1514
103 Ga0111539_10000206 3300009094 Bacteria 69598
104 Ga0111539_10001319 3300009094 Bacteria 33146
105 Ga0111539_10002382 3300009094 Bacteria 24956
106 Ga0111539_10097325 3300009094 Bacteria 3457
107 Ga0105245_10001207 3300009098 Bacteria 23376
108 Ga0105245_10634588 3300009098 Bacteria 1097
109 Ga0114129_10001068 3300009147 Bacteria 36016
110 Ga0114129_10033182 3300009147 Bacteria 7295
111 Ga0114129_10075222 3300009147 Bacteria 4702
112 Ga0114129_10095249 3300009147 Bacteria 4123
113 Ga0114129_10340207 3300009147 Bacteria 1990
114 Ga0105243_10124398 3300009148 Bacteria 2179
115 Ga0105242_10000622 3300009176 Bacteria 27824
116 Ga0105248_10038642 3300009177 Bacteria 5343
117 Ga0105238_10000001 3300009551 Bacteria 2036163
118 Ga0105249_10000493 3300009553 Bacteria 36447
119 Ga0105249_11409972 3300009553 Bacteria 769
120 Ga0105246_10113679 3300011119 Bacteria 1993
121 Ga0105246_10245814 3300011119 Unclassified 1417
122 Ga0105246_10694900 3300011119 Unclassified 891
123 Ga0157369_10003533 3300013105 Bacteria 18579
124 Ga0157374_10000022 3300013296 Bacteria 270307
125 Ga0157374_10014817 3300013296 Bacteria 6829
126 Ga0157378_10000336 3300013297 Bacteria 46118
127 Ga0157378_10017780 3300013297 Bacteria 6242
128 Ga0163162_10005124 3300013306 Bacteria 12633
129 Ga0157375_10000008 3300013308 Bacteria 373560
130 Ga0157375_10000401 3300013308 Bacteria 39455
131 Ga0157375_11173133 3300013308 Bacteria 900
132 Ga0163163_10045909 3300014325 Bacteria 4290
133 Ga0163163_10274991 3300014325 Bacteria 1735
134 Ga0157380_10037297 3300014326 Bacteria 3765
135 Ga0157380_10177879 3300014326 Unclassified 1866
136 Ga0157377_10000009 3300014745 Bacteria 385287
137 Ga0157377_10063822 3300014745 Bacteria 2111
138 Ga0157377_10078152 3300014745 Bacteria 1928
139 Ga0157377_10255573 3300014745 Unclassified 1138
140 Ga0157379_10330762 3300014968 Bacteria 1392
141 Ga0157376_10000025 3300014969 Bacteria 214212
142 Ga0213873_10000002 3300021358 Bacteria 1164195
143 Ga0213876_10000001 3300021384 Bacteria 1186326
144 Ga0213876_10000012 3300021384 Bacteria 396530
145 Ga0213876_10002531 3300021384 Bacteria 10702
146 Ga0207697_10031665 3300025315 Bacteria 2163
147 Ga0207697_10133641 3300025315 Bacteria 1073
148 Ga0207688_10037239 3300025901 Unclassified 2697
149 Ga0207688_10361723 3300025901 Bacteria 895
150 Ga0207680_10326627 3300025903 Unclassified 1074
151 Ga0207643_10277906 3300025908 Unclassified 1038
152 Ga0207705_10246490 3300025909 Unclassified 1362
153 Ga0207660_10047210 3300025917 Bacteria 3043
154 Ga0207660_10323165 3300025917 Bacteria 1233
155 Ga0207662_10064358 3300025918 Bacteria 2206
156 Ga0207649_10024473 3300025920 Bacteria 3510
157 Ga0207646_10320183 3300025922 Unclassified 1401
158 Ga0207681_10070043 3300025923 Unclassified 2441
159 Ga0207681_10897440 3300025923 Bacteria 742
160 Ga0207694_10000001 3300025924 Bacteria 4078485
161 Ga0207650_10000137 3300025925 Bacteria 88995
162 Ga0207650_10012028 3300025925 Bacteria 5965
163 Ga0207650_10058724 3300025925 Bacteria 2865
164 Ga0207659_10000019 3300025926 Bacteria 152016
165 Ga0207659_10367211 3300025926 Unclassified 1197
166 Ga0207687_10000003 3300025927 Bacteria 875159
167 Ga0207687_10001939 3300025927 Bacteria 14235
168 Ga0207700_10004306 3300025928 Bacteria 8366
169 Ga0207690_10143237 3300025932 Bacteria 1764
170 Ga0207706_10198275 3300025933 Bacteria 1761
171 Ga0207706_10287702 3300025933 Bacteria 1433
172 Ga0207686_10002223 3300025934 Bacteria 10667
173 Ga0207669_10017767 3300025937 Bacteria 3657
174 Ga0207669_10399493 3300025937 Bacteria 1076
175 Ga0207691_10349271 3300025940 Unclassified 1266
176 Ga0207661_10000001 3300025944 Bacteria 937688
177 Ga0207661_10017180 3300025944 Bacteria 5349
178 Ga0207679_10083195 3300025945 Bacteria 2452
179 Ga0207712_10077461 3300025961 Unclassified 2410
180 Ga0207712_11003085 3300025961 Bacteria 741
181 Ga0207668_10155136 3300025972 Bacteria 1778
182 Ga0207668_10518072 3300025972 Bacteria 1028
183 Ga0207640_10109690 3300025981 Bacteria 1953
184 Ga0207677_10000565 3300026023 Bacteria 23300
185 Ga0207708_10000034 3300026075 Bacteria 144931
186 Ga0207708_10101615 3300026075 Unclassified 2226
187 Ga0207641_10254382 3300026088 Bacteria 1642
188 Ga0207648_10346129 3300026089 Bacteria 1339
189 Ga0207648_10704147 3300026089 Bacteria 936
190 Ga0207648_11053363 3300026089 Unclassified 762
191 Ga0207674_10037242 3300026116 Bacteria 5061
192 Ga0207674_10096149 3300026116 Bacteria 2947
193 Ga0207675_100029143 3300026118 Bacteria 5145
194 Ga0207675_100170279 3300026118 Bacteria 2081
195 Ga0207683_10193601 3300026121 Bacteria 1847
196 Ga0207683_10363192 3300026121 Unclassified 1330
197 Ga0207428_10000061 3300027907 Bacteria 155152
198 Ga0207428_10004348 3300027907 Bacteria 13533
199 Ga0207428_10041333 3300027907 Unclassified 3733
200 Ga0207428_10374556 3300027907 Bacteria 1045
201 Ga0268265_10072935 3300028380 Unclassified 2679
202 Ga0268265_10468815 3300028380 Bacteria 1180
203 Ga0265316_10215824 3300031344 Unclassified 1417
204 Ga0307408_100004700 3300031548 Bacteria 9223
205 Ga0307408_100039574 3300031548 Bacteria 3333
206 Ga0307408_100186653 3300031548 Bacteria 1667
207 Ga0307405_10164152 3300031731 Bacteria 1577
208 Ga0307405_10516087 3300031731 Bacteria 961
209 Ga0307405_10753369 3300031731 Bacteria 811
210 Ga0307413_10148741 3300031824 Bacteria 1629
211 Ga0307413_10158425 3300031824 Bacteria 1587
212 Ga0307413_10359915 3300031824 Bacteria 1126
213 Ga0307410_10036746 3300031852 Bacteria 3193
214 Ga0307406_10004697 3300031901 Bacteria 7446
215 Ga0307406_10149750 3300031901 Bacteria 1663
216 Ga0307412_10116449 3300031911 Unclassified 1917
217 Ga0307412_10153893 3300031911 Bacteria 1700
218 Ga0307412_10916341 3300031911 Bacteria 769
219 Ga0307409_100023007 3300031995 Bacteria 4308
220 Ga0307409_100203558 3300031995 Bacteria 1773
221 Ga0307409_100385153 3300031995 Bacteria 1334
222 Ga0307416_100034475 3300032002 Bacteria 3852
223 Ga0307416_100070693 3300032002 Bacteria 2895
224 Ga0307416_100108079 3300032002 Bacteria 2443
225 Ga0307416_100445494 3300032002 Bacteria 1346
226 Ga0307416_100520963 3300032002 Bacteria 1257
227 Ga0307416_101154957 3300032002 Bacteria 880
228 Ga0307411_10083746 3300032005 Bacteria 2204
229 Ga0307411_10224777 3300032005 Bacteria 1459
230 Ga0307411_10399059 3300032005 Bacteria 1136
231 Ga0307411_10426140 3300032005 Bacteria 1103
232 Ga0307415_100027639 3300032126 Bacteria 3597
233 Ga0307415_100365643 3300032126 Unclassified 1220
234 Ga0436365_0774883 3300039437 Bacteria 390569
235 Ga0436365_1749406 3300039437 Bacteria 18798
236 Ga0436362_0660519 3300039453 Bacteria 832172
237 Ga0436362_0927290 3300039453 Bacteria 7602
238 Ga0439461_0024939 3300041410 Bacteria 1212
239 Ga0439437_038179 3300042000 Bacteria 618
240 Ga0439443_044856 3300042003 Unclassified 762
241 Ga0439450_020285 3300042008 Bacteria 1417
242 Ga0439452_079904 3300042010 Bacteria 713
243 Ga0439435_0000743 3300042436 Bacteria 5475
244 Ga0439435_0162414 3300042436 Bacteria 722
245 Ga0439464_0008082 3300042439 Bacteria 2759
246 Ga0439460_0102134 3300042461 Bacteria 922
247 Ga0439460_0294287 3300042461 Unclassified 567
248 Ga0451577_0001525 3300042876 Bacteria 30479
249 Ga0451577_0045292 3300042876 Bacteria 3938
250 Ga0439440_0039555 3300042993 Bacteria 1145
251 Ga0453683_0221107 3300044673 Bacteria 1204
252 Ga0453684_0002774 3300044712 Bacteria 41443
253 Ga0466960_0488519 3300044901 Bacteria 720
254 Ga0451576_0579742 3300045051 Bacteria 1179
255 Ga0495592_0425583 3300046454 Bacteria 836
256 Ga0495620_0020806 3300046515 Bacteria 3196
257 Ga0495615_0175245 3300048090 Bacteria 651
258 Ga0496100_0076484 3300048903 Bacteria 2248
259 Ga0496101_0162430 3300048904 Bacteria 1714
260 Ga0496101_0235268 3300048904 Unclassified 1425
261 Ga0496101_0244198 3300048904 Bacteria 1398
262 Ga0496104_0014586 3300048907 Bacteria 7098
263 Ga0496105_0108251 3300048908 Bacteria 2295
264 Ga0496108_0297694 3300048911 Bacteria 1405
265 Ga0496109_1461509 3300048912 Bacteria 619
266 Ga0496110_0104244 3300048913 Bacteria 2544
267 Ga0496111_0041063 3300048914 Bacteria 3319
268 Ga0496112_0045345 3300048915 Bacteria 4310
269 Ga0496113_0104031 3300048916 Bacteria 2203
270 Ga0496114_0302944 3300048917 Bacteria 1411
271 Ga0501298_029078 3300049521 Bacteria 1075
272 Ga0501299_033734 3300049522 Bacteria 999
273 Ga0501031_0169134 3300049568 Bacteria 1428
274 Ga0501033_0370275 3300049570 Bacteria 1002
275 Ga0501036_0079670 3300049572 Bacteria 2770
276 Ga0501036_0371175 3300049572 Bacteria 1194
277 Ga0501038_0342905 3300049574 Bacteria 1165
278 Ga0501038_0690984 3300049574 Bacteria 765
279 Ga0501039_0083953 3300049575 Bacteria 2481
280 Ga0501039_0879417 3300049575 Bacteria 698
281 Ga0501040_0039051 3300049576 Bacteria 3228
282 Ga0501040_0043352 3300049576 Bacteria 3067
283 Ga0501040_0151889 3300049576 Bacteria 1634
284 Ga0501040_0688056 3300049576 Bacteria 739
285 Ga0501041_0024633 3300049577 Bacteria 3612
286 Ga0501042_0182690 3300049578 Bacteria 1513
287 Ga0501043_0534346 3300049579 Bacteria 873
288 Ga0501046_0238418 3300049580 Bacteria 1342
289 Ga0501046_0625910 3300049580 Bacteria 762
290 Ga0501048_0094656 3300049582 Bacteria 2107
291 Ga0501048_0312317 3300049582 Bacteria 1119
292 Ga0501067_0068951 3300049583 Bacteria 1958
293 Ga0501068_0250304 3300049584 Bacteria 1129
294 Ga0501068_0368150 3300049584 Bacteria 925
295 Ga0501069_0068434 3300049585 Bacteria 1987
296 Ga0501071_0069108 3300049587 Bacteria 2571
297 Ga0501071_0084857 3300049587 Bacteria 2322
298 Ga0501071_0126596 3300049587 Bacteria 1896
299 Ga0501071_0249189 3300049587 Bacteria 1340
300 Ga0501072_0064711 3300049588 Bacteria 2883
301 Ga0501072_0068260 3300049588 Bacteria 2807
302 Ga0501073_0238145 3300049589 Bacteria 1257
303 Ga0501073_0545049 3300049589 Bacteria 802
304 Ga0501074_0237072 3300049590 Bacteria 1298
305 Ga0501074_0673726 3300049590 Bacteria 730
306 Ga0501075_0039836 3300049591 Bacteria 3517
307 Ga0501075_0069523 3300049591 Bacteria 2661
308 Ga0501075_0130667 3300049591 Bacteria 1913
309 Ga0501075_0517480 3300049591 Bacteria 910
310 Ga0501075_0658522 3300049591 Bacteria 798
311 Ga0501076_0075535 3300049592 Bacteria 2701
312 Ga0501076_0275062 3300049592 Bacteria 1379
313 Ga0501077_0121731 3300049593 Bacteria 1654
314 Ga0501077_0212184 3300049593 Bacteria 1230
315 Ga0501211_021604 3300049658 Bacteria 679
316 Ga0501216_025720 3300049660 Bacteria 1059
317 Ga0501248_046972 3300049678 Bacteria 545
318 Ga0501249_023459 3300049679 Bacteria 1355
319 Ga0501251_019860 3300049681 Bacteria 884
320 Ga0501079_0227691 3300049741 Bacteria 1456
321 Ga0501079_0237392 3300049741 Bacteria 1424
322 Ga0501080_0063978 3300049742 Bacteria 3423
323 Ga0501080_0232470 3300049742 Bacteria 1685
324 Ga0501080_0317191 3300049742 Bacteria 1412
325 Ga0501080_0345951 3300049742 Bacteria 1343
326 Ga0501080_0472600 3300049742 Bacteria 1122
327 Ga0501081_0035801 3300049743 Bacteria 3380
328 Ga0501081_0075392 3300049743 Bacteria 2355
329 Ga0501081_0138571 3300049743 Bacteria 1743
330 Ga0501081_0629500 3300049743 Bacteria 804
331 Ga0501081_0928801 3300049743 Bacteria 656
332 Ga0501083_0443538 3300049744 Bacteria 845
333 Ga0501265_045700 3300049762 Bacteria 675
334 Ga0501273_026084 3300049770 Bacteria 813
335 Ga0501283_009569 3300049779 Bacteria 1415
336 Ga0501035_0308520 3300049822 Bacteria 1332
337 Ga0501045_0078183 3300049824 Bacteria 2439
338 Ga0501045_0107028 3300049824 Bacteria 2072
339 Ga0501045_0117864 3300049824 Bacteria 1971
340 Ga0501204_046147 3300049850 Bacteria 654
341 nmdc:mga03683_485642_c1 3300050489 Bacteria 597
342 nmdc:mga00v17_541744_c1 3300050491 Bacteria 753
343 nmdc:mga0k408_102680_c1 3300050493 Bacteria 1686
344 nmdc:mga0k408_240296_c1 3300050493 Unclassified 1081
345 nmdc:mga0k408_398406_c1 3300050493 Bacteria 819
346 nmdc:mga06z11_77593_c2 3300050494 Bacteria 953
347 nmdc:mga05p37_7472_c1 3300050507 Bacteria 12885
348 nmdc:mga05p37_78767_c1 3300050507 Bacteria 4058
349 nmdc:mga05p37_8878_c1 3300050507 Bacteria 11873
350 nmdc:mga09592_15537_c1 3300050508 Bacteria 6223
351 nmdc:mga09592_25875_c1 3300050508 Bacteria 4860
352 nmdc:mga09592_517493_c1 3300050508 Bacteria 1026
353 nmdc:mga09592_519646_c1 3300050508 Bacteria 1024
354 nmdc:mga09592_610410_c1 3300050508 Unclassified 934
355 nmdc:mga09592_872551_c1 3300050508 Unclassified 758
356 nmdc:mga0qj67_17037_c1 3300050509 Bacteria 5520
357 nmdc:mga0qj67_5616_c1 3300050509 Bacteria 9168
358 nmdc:mga0qj67_6412_c1 3300050509 Bacteria 8646
359 nmdc:mga06r32_496089_c1 3300050510 Bacteria 1198
360 nmdc:mga06r32_521_c1 3300050510 Bacteria 33157
361 nmdc:mga06r32_84411_c1 3300050510 Bacteria 3095
362 nmdc:mga06r32_91870_c1 3300050510 Bacteria 2967
363 nmdc:mga06r32_93870_c1 3300050510 Bacteria 2935
364 nmdc:mga08y16_1281_c1 3300050511 Bacteria 24959
365 nmdc:mga08y16_229302_c1 3300050511 Bacteria 1921
366 nmdc:mga08y16_3241_c1 3300050511 Bacteria 16851
367 nmdc:mga08y16_4330_c1 3300050511 Bacteria 14828
368 nmdc:mga0n895_1585_c1 3300050512 Bacteria 17095
369 nmdc:mga0n895_201245_c1 3300050512 Bacteria 2022
370 nmdc:mga0n895_523434_c1 3300050512 Bacteria 1193
371 nmdc:mga0rr50_42801_c1 3300050513 Bacteria 3310
372 nmdc:mga0rr50_483_c1 3300050513 Bacteria 21140
373 nmdc:mga0rr50_514516_c1 3300050513 Bacteria 1018
374 nmdc:mga0rr50_6634_c1 3300050513 Bacteria 7073
375 nmdc:mga08x19_276_c1 3300050514 Bacteria 38795
376 nmdc:mga0a205_198137_c1 3300050515 Bacteria 1899
377 nmdc:mga0a205_200988_c1 3300050515 Bacteria 1883
378 Ga0500568_0007669 3300053139 Bacteria 5271
379 Ga0501084_0023683 3300054114 Bacteria 5121
380 Ga0501084_0028539 3300054114 Bacteria 4665
381 Ga0501084_0358475 3300054114 Bacteria 1232
382 Ga0501084_0539728 3300054114 Bacteria 985
383 Ga0590071_007842 3300059421 Bacteria 2523
384 Ga0590074_001195 3300059423 Bacteria 4094
385 Ga0590075_001967 3300059424 Bacteria 4969
386 Ga0590075_006508 3300059424 Bacteria 2769
387 Ga0590077_001299 3300059426 Bacteria 5940
388 Ga0590077_012148 3300059426 Bacteria 1783
389 Ga0590077_098977 3300059426 Bacteria 681
390 Ga0501082_0127446 3300060353 Bacteria 2208
391 Ga0501082_0130366 3300060353 Bacteria 2182
392 Ga0501082_0368444 3300060353 Bacteria 1253
393 Ga0501082_0726685 3300060353 Bacteria 869
394 Ga0530510_0286179 3300061734 Bacteria 1232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0371175 Ga0501036_0371175_595_1128 144
2 3300049574 Ga0501038_0690984 Ga0501038_0690984_95_628 144
3 3300049575 Ga0501039_0083953 Ga0501039_0083953_621_1154 144
4 3300049576 Ga0501040_0039051 Ga0501040_0039051_1478_2011 144
5 3300049580 Ga0501046_0625910 Ga0501046_0625910_105_638 144
6 3300049582 Ga0501048_0312317 Ga0501048_0312317_103_636 144
7 3300049587 Ga0501071_0126596 Ga0501071_0126596_1265_1798 144
8 3300049591 Ga0501075_0039836 Ga0501075_0039836_2887_3420 144
9 3300049592 Ga0501076_0275062 Ga0501076_0275062_595_1128 144
10 3300049741 Ga0501079_0237392 Ga0501079_0237392_95_628 144
11 3300049742 Ga0501080_0232470 Ga0501080_0232470_123_656 144
12 3300049743 Ga0501081_0928801 Ga0501081_0928801_80_613 144
13 3300054114 Ga0501084_0358475 Ga0501084_0358475_97_630 144
14 3300049578 Ga0501042_0182690 Ga0501042_0182690_76_609 145
15 3300005333 Ga0070677_10133894 Ga0070677_101338941 148
16 3300009553 Ga0105249_11409972 Ga0105249_114099722 148
17 3300025961 Ga0207712_11003085 Ga0207712_110030851 148
18 3300048917 Ga0496114_0302944 Ga0496114_0302944_178_711 148
19 3300050515 nmdc:mga0a205_198137_c1 nmdc:mga0a205_198137_c1_874_1407 148
20 3300059426 Ga0590077_098977 Ga0590077_098977_132_665 150
21 3300006195 Ga0075366_10621058 Ga0075366_106210582 152
22 3300050491 nmdc:mga00v17_541744_c1 nmdc:mga00v17_541744_c1_284_742 152
23 3300050493 nmdc:mga0k408_240296_c1 nmdc:mga0k408_240296_c1_123_656 152
24 3300005366 Ga0070659_100175742 Ga0070659_1001757421 154
25 3300005547 Ga0070693_100210273 Ga0070693_1002102732 154
26 3300006871 Ga0075434_100137918 Ga0075434_1001379181 154
27 3300007076 Ga0075435_100248583 Ga0075435_1002485831 154
28 3300025932 Ga0207690_10143237 Ga0207690_101432372 154
29 3300026121 Ga0207683_10363192 Ga0207683_103631922 154
30 3300050512 nmdc:mga0n895_523434_c1 nmdc:mga0n895_523434_c1_622_1155 154
31 3300050513 nmdc:mga0rr50_514516_c1 nmdc:mga0rr50_514516_c1_475_1008 154
32 3300042461 Ga0439460_0294287 Ga0439460_0294287_21_551 155
33 3300006178 Ga0075367_10038524 Ga0075367_100385244 156
34 3300006195 Ga0075366_10144542 Ga0075366_101445422 156
35 3300049762 Ga0501265_045700 Ga0501265_045700_21_491 156
36 3300050493 nmdc:mga0k408_398406_c1 nmdc:mga0k408_398406_c1_139_672 156
37 3300005438 Ga0070701_10000607 Ga0070701_100006073 158
38 3300045051 Ga0451576_0579742 Ga0451576_0579742_517_1050 158
39 3300049583 Ga0501067_0068951 Ga0501067_0068951_130_663 159
40 3300049585 Ga0501069_0068434 Ga0501069_0068434_495_1028 159
41 3300049589 Ga0501073_0238145 Ga0501073_0238145_630_1166 159
42 3300061734 Ga0530510_0286179 Ga0530510_0286179_437_970 159
43 3300042876 Ga0451577_0001525 Ga0451577_0001525_20937_21470 160
44 3300044673 Ga0453683_0221107 Ga0453683_0221107_402_935 160
45 3300044712 Ga0453684_0002774 Ga0453684_0002774_30887_31420 160
46 3300049678 Ga0501248_046972 Ga0501248_046972_15_500 161
47 3300049779 Ga0501283_009569 Ga0501283_009569_20_505 161
48 3300050489 nmdc:mga03683_485642_c1 nmdc:mga03683_485642_c1_19_513 164
49 3300050493 nmdc:mga0k408_102680_c1 nmdc:mga0k408_102680_c1_1177_1671 164
50 3300032002 Ga0307416_100520963 Ga0307416_1005209632 167
51 3300005615 Ga0070702_100179099 Ga0070702_1001790992 170
52 3300005616 Ga0068852_100521179 Ga0068852_1005211792 170
53 3300049568 Ga0501031_0169134 Ga0501031_0169134_850_1383 171
54 3300049576 Ga0501040_0043352 Ga0501040_0043352_203_736 171
55 3300049577 Ga0501041_0024633 Ga0501041_0024633_1887_2420 171
56 3300049580 Ga0501046_0238418 Ga0501046_0238418_106_639 171
57 3300049587 Ga0501071_0069108 Ga0501071_0069108_128_661 171
58 3300049587 Ga0501071_0084857 Ga0501071_0084857_988_1521 171
59 3300049588 Ga0501072_0068260 Ga0501072_0068260_1615_2148 171
60 3300049591 Ga0501075_0069523 Ga0501075_0069523_92_625 171
61 3300049591 Ga0501075_0517480 Ga0501075_0517480_331_864 171
62 3300049592 Ga0501076_0075535 Ga0501076_0075535_1262_1795 171
63 3300049593 Ga0501077_0121731 Ga0501077_0121731_414_947 171
64 3300049742 Ga0501080_0317191 Ga0501080_0317191_690_1223 171
65 3300049743 Ga0501081_0138571 Ga0501081_0138571_70_603 171
66 3300049824 Ga0501045_0117864 Ga0501045_0117864_466_999 171
67 3300054114 Ga0501084_0023683 Ga0501084_0023683_2304_2837 171
68 3300054114 Ga0501084_0028539 Ga0501084_0028539_1132_1665 171
69 3300060353 Ga0501082_0127446 Ga0501082_0127446_1100_1633 171
70 3300060353 Ga0501082_0130366 Ga0501082_0130366_1162_1719 171
71 3300059424 Ga0590075_006508 Ga0590075_006508_385_918 172
72 3300059426 Ga0590077_012148 Ga0590077_012148_346_879 172
73 3300006844 Ga0075428_100012230 Ga0075428_1000122307 176
74 3300006844 Ga0075428_100022849 Ga0075428_1000228498 176
75 3300006846 Ga0075430_100028728 Ga0075430_1000287283 176
76 3300006846 Ga0075430_100483696 Ga0075430_1004836961 176
77 3300006847 Ga0075431_100103924 Ga0075431_1001039242 176
78 3300006852 Ga0075433_10768975 Ga0075433_107689752 176
79 3300006914 Ga0075436_100014984 Ga0075436_1000149842 176
80 3300007076 Ga0075435_100003735 Ga0075435_1000037354 176
81 3300009147 Ga0114129_10033182 Ga0114129_100331825 176
82 3300032126 Ga0307415_100365643 Ga0307415_1003656432 176
83 3300048904 Ga0496101_0235268 Ga0496101_0235268_10_558 176
84 3300049584 Ga0501068_0250304 Ga0501068_0250304_115_648 176
85 3300050507 nmdc:mga05p37_8878_c1 nmdc:mga05p37_8878_c1_5158_5688 176
86 3300050509 nmdc:mga0qj67_6412_c1 nmdc:mga0qj67_6412_c1_4515_5045 176
87 3300050510 nmdc:mga06r32_93870_c1 nmdc:mga06r32_93870_c1_689_1219 176
88 3300050513 nmdc:mga0rr50_483_c1 nmdc:mga0rr50_483_c1_3893_4432 176
89 3300050514 nmdc:mga08x19_276_c1 nmdc:mga08x19_276_c1_26512_27051 176
90 3300050515 nmdc:mga0a205_200988_c1 nmdc:mga0a205_200988_c1_1143_1673 176
91 2162886012 MBSR1b_contig_10991150 MBSR1b_0959.00001340 177
92 3300005288 Ga0065714_10225442 Ga0065714_102254421 177
93 3300005290 Ga0065712_10000653 Ga0065712_100006536 177
94 3300005290 Ga0065712_10084694 Ga0065712_100846942 177
95 3300005290 Ga0065712_10216887 Ga0065712_102168871 177
96 3300005293 Ga0065715_10133166 Ga0065715_101331663 177
97 3300005293 Ga0065715_10151465 Ga0065715_101514653 177
98 3300005293 Ga0065715_10174786 Ga0065715_101747862 177
99 3300005293 Ga0065715_10202336 Ga0065715_102023362 177
100 3300005329 Ga0070683_100000081 Ga0070683_10000008112 177
101 3300005329 Ga0070683_100304452 Ga0070683_1003044523 177
102 3300005331 Ga0070670_100000077 Ga0070670_10000007760 177
103 3300005331 Ga0070670_100002418 Ga0070670_10000241811 177
104 3300005331 Ga0070670_100028879 Ga0070670_1000288793 177
105 3300005331 Ga0070670_100621823 Ga0070670_1006218232 177
106 3300005336 Ga0070680_100013351 Ga0070680_1000133517 177
107 3300005338 Ga0068868_100001168 Ga0068868_1000011682 177
108 3300005340 Ga0070689_100276540 Ga0070689_1002765402 177
109 3300005343 Ga0070687_100004612 Ga0070687_1000046126 177
110 3300005344 Ga0070661_100043933 Ga0070661_1000439332 177
111 3300005344 Ga0070661_100326327 Ga0070661_1003263272 177
112 3300005345 Ga0070692_10000431 Ga0070692_100004317 177
113 3300005345 Ga0070692_10200323 Ga0070692_102003232 177
114 3300005347 Ga0070668_100140580 Ga0070668_1001405803 177
115 3300005347 Ga0070668_100235219 Ga0070668_1002352192 177
116 3300005353 Ga0070669_100002411 Ga0070669_1000024113 177
117 3300005354 Ga0070675_100000005 Ga0070675_100000005104 177
118 3300005354 Ga0070675_100175168 Ga0070675_1001751682 177
119 3300005354 Ga0070675_101381780 Ga0070675_1013817801 177
120 3300005355 Ga0070671_100038083 Ga0070671_1000380833 177
121 3300005355 Ga0070671_100964638 Ga0070671_1009646381 177
122 3300005356 Ga0070674_100000713 Ga0070674_1000007139 177
123 3300005356 Ga0070674_100614428 Ga0070674_1006144282 177
124 3300005364 Ga0070673_100528819 Ga0070673_1005288191 177
125 3300005365 Ga0070688_100096304 Ga0070688_1000963043 177
126 3300005438 Ga0070701_10112548 Ga0070701_101125483 177
127 3300005438 Ga0070701_10505306 Ga0070701_105053062 177
128 3300005441 Ga0070700_100000096 Ga0070700_10000009610 177
129 3300005456 Ga0070678_100916027 Ga0070678_1009160271 177
130 3300005457 Ga0070662_100031737 Ga0070662_1000317373 177
131 3300005457 Ga0070662_100204900 Ga0070662_1002049001 177
132 3300005466 Ga0070685_10013123 Ga0070685_100131234 177
133 3300005468 Ga0070707_100180390 Ga0070707_1001803901 177
134 3300005471 Ga0070698_100149788 Ga0070698_1001497883 177
135 3300005471 Ga0070698_100646350 Ga0070698_1006463501 177
136 3300005518 Ga0070699_100006505 Ga0070699_1000065053 177
137 3300005535 Ga0070684_100000695 Ga0070684_10000069517 177
138 3300005535 Ga0070684_100000818 Ga0070684_10000081815 177
139 3300005539 Ga0068853_100232704 Ga0068853_1002327043 177
140 3300005543 Ga0070672_100365160 Ga0070672_1003651601 177
141 3300005564 Ga0070664_100000565 Ga0070664_10000056511 177
142 3300005564 Ga0070664_101718107 Ga0070664_1017181071 177
143 3300005577 Ga0068857_100035271 Ga0068857_1000352712 177
144 3300005578 Ga0068854_100007057 Ga0068854_1000070574 177
145 3300005615 Ga0070702_100165107 Ga0070702_1001651072 177
146 3300005615 Ga0070702_100270140 Ga0070702_1002701402 177
147 3300005615 Ga0070702_100442021 Ga0070702_1004420211 177
148 3300005719 Ga0068861_100038986 Ga0068861_1000389864 177
149 3300005719 Ga0068861_100126391 Ga0068861_1001263912 177
150 3300005840 Ga0068870_10306496 Ga0068870_103064962 177
151 3300005841 Ga0068863_100655489 Ga0068863_1006554892 177
152 3300005844 Ga0068862_100111883 Ga0068862_1001118833 177
153 3300005844 Ga0068862_100564947 Ga0068862_1005649472 177
154 3300006028 Ga0070717_10003437 Ga0070717_1000343710 177
155 3300006028 Ga0070717_10045223 Ga0070717_100452232 177
156 3300006237 Ga0097621_100085084 Ga0097621_1000850842 177
157 3300006844 Ga0075428_100012188 Ga0075428_1000121885 177
158 3300006844 Ga0075428_100014102 Ga0075428_1000141028 177
159 3300006844 Ga0075428_100019855 Ga0075428_1000198556 177
160 3300006844 Ga0075428_100527203 Ga0075428_1005272033 177
161 3300006846 Ga0075430_100000708 Ga0075430_10000070818 177
162 3300006846 Ga0075430_100033924 Ga0075430_1000339242 177
163 3300006847 Ga0075431_100008614 Ga0075431_1000086143 177
164 3300006847 Ga0075431_100020628 Ga0075431_1000206284 177
165 3300006847 Ga0075431_100074980 Ga0075431_1000749802 177
166 3300006847 Ga0075431_100347039 Ga0075431_1003470392 177
167 3300006871 Ga0075434_100002588 Ga0075434_10000258813 177
168 3300006871 Ga0075434_100191094 Ga0075434_1001910942 177
169 3300006880 Ga0075429_100003000 Ga0075429_10000300011 177
170 3300006880 Ga0075429_100010295 Ga0075429_1000102952 177
171 3300006880 Ga0075429_101063528 Ga0075429_1010635281 177
172 3300007076 Ga0075435_100003693 Ga0075435_1000036932 177
173 3300007076 Ga0075435_100041404 Ga0075435_1000414044 177
174 3300009094 Ga0111539_10000206 Ga0111539_1000020610 177
175 3300009094 Ga0111539_10001319 Ga0111539_100013193 177
176 3300009094 Ga0111539_10002382 Ga0111539_1000238213 177
177 3300009094 Ga0111539_10097325 Ga0111539_100973254 177
178 3300009098 Ga0105245_10001207 Ga0105245_100012072 177
179 3300009098 Ga0105245_10634588 Ga0105245_106345882 177
180 3300009147 Ga0114129_10001068 Ga0114129_100010686 177
181 3300009147 Ga0114129_10075222 Ga0114129_100752223 177
182 3300009147 Ga0114129_10095249 Ga0114129_100952493 177
183 3300009147 Ga0114129_10340207 Ga0114129_103402072 177
184 3300009148 Ga0105243_10124398 Ga0105243_101243983 177
185 3300009176 Ga0105242_10000622 Ga0105242_100006224 177
186 3300009177 Ga0105248_10038642 Ga0105248_100386424 177
187 3300009551 Ga0105238_10000001 Ga0105238_10000001915 177
188 3300009553 Ga0105249_10000493 Ga0105249_1000049336 177
189 3300011119 Ga0105246_10113679 Ga0105246_101136793 177
190 3300011119 Ga0105246_10245814 Ga0105246_102458141 177
191 3300011119 Ga0105246_10694900 Ga0105246_106949002 177
192 3300013105 Ga0157369_10003533 Ga0157369_1000353311 177
193 3300013296 Ga0157374_10000022 Ga0157374_1000002252 177
194 3300013296 Ga0157374_10014817 Ga0157374_100148176 177
195 3300013297 Ga0157378_10000336 Ga0157378_1000033613 177
196 3300013297 Ga0157378_10017780 Ga0157378_100177806 177
197 3300013306 Ga0163162_10005124 Ga0163162_100051249 177
198 3300013308 Ga0157375_10000008 Ga0157375_10000008278 177
199 3300013308 Ga0157375_10000401 Ga0157375_1000040114 177
200 3300013308 Ga0157375_11173133 Ga0157375_111731331 177
201 3300014325 Ga0163163_10045909 Ga0163163_100459092 177
202 3300014325 Ga0163163_10274991 Ga0163163_102749912 177
203 3300014326 Ga0157380_10037297 Ga0157380_100372976 177
204 3300014326 Ga0157380_10177879 Ga0157380_101778792 177
205 3300014745 Ga0157377_10000009 Ga0157377_1000000940 177
206 3300014745 Ga0157377_10063822 Ga0157377_100638222 177
207 3300014745 Ga0157377_10078152 Ga0157377_100781522 177
208 3300014745 Ga0157377_10255573 Ga0157377_102555732 177
209 3300014968 Ga0157379_10330762 Ga0157379_103307622 177
210 3300014969 Ga0157376_10000025 Ga0157376_10000025136 177
211 3300021358 Ga0213873_10000002 Ga0213873_10000002792 177
212 3300021384 Ga0213876_10000001 Ga0213876_10000001875 177
213 3300021384 Ga0213876_10000012 Ga0213876_10000012352 177
214 3300021384 Ga0213876_10002531 Ga0213876_1000253110 177
215 3300025315 Ga0207697_10031665 Ga0207697_100316652 177
216 3300025315 Ga0207697_10133641 Ga0207697_101336412 177
217 3300025901 Ga0207688_10037239 Ga0207688_100372393 177
218 3300025901 Ga0207688_10361723 Ga0207688_103617232 177
219 3300025903 Ga0207680_10326627 Ga0207680_103266271 177
220 3300025908 Ga0207643_10277906 Ga0207643_102779062 177
221 3300025909 Ga0207705_10246490 Ga0207705_102464902 177
222 3300025917 Ga0207660_10047210 Ga0207660_100472102 177
223 3300025917 Ga0207660_10323165 Ga0207660_103231652 177
224 3300025918 Ga0207662_10064358 Ga0207662_100643582 177
225 3300025920 Ga0207649_10024473 Ga0207649_100244735 177
226 3300025922 Ga0207646_10320183 Ga0207646_103201832 177
227 3300025923 Ga0207681_10070043 Ga0207681_100700431 177
228 3300025923 Ga0207681_10897440 Ga0207681_108974402 177
229 3300025924 Ga0207694_10000001 Ga0207694_100000011955 177
230 3300025925 Ga0207650_10000137 Ga0207650_1000013730 177
231 3300025925 Ga0207650_10012028 Ga0207650_100120285 177
232 3300025925 Ga0207650_10058724 Ga0207650_100587243 177
233 3300025926 Ga0207659_10000019 Ga0207659_10000019106 177
234 3300025926 Ga0207659_10367211 Ga0207659_103672112 177
235 3300025927 Ga0207687_10000003 Ga0207687_10000003153 177
236 3300025927 Ga0207687_10001939 Ga0207687_100019392 177
237 3300025928 Ga0207700_10004306 Ga0207700_100043062 177
238 3300025933 Ga0207706_10198275 Ga0207706_101982752 177
239 3300025933 Ga0207706_10287702 Ga0207706_102877021 177
240 3300025934 Ga0207686_10002223 Ga0207686_100022233 177
241 3300025937 Ga0207669_10017767 Ga0207669_100177674 177
242 3300025937 Ga0207669_10399493 Ga0207669_103994932 177
243 3300025940 Ga0207691_10349271 Ga0207691_103492712 177
244 3300025944 Ga0207661_10000001 Ga0207661_10000001255 177
245 3300025944 Ga0207661_10017180 Ga0207661_100171805 177
246 3300025945 Ga0207679_10083195 Ga0207679_100831952 177
247 3300025961 Ga0207712_10077461 Ga0207712_100774612 177
248 3300025972 Ga0207668_10155136 Ga0207668_101551362 177
249 3300025972 Ga0207668_10518072 Ga0207668_105180722 177
250 3300025981 Ga0207640_10109690 Ga0207640_101096902 177
251 3300026023 Ga0207677_10000565 Ga0207677_1000056512 177
252 3300026075 Ga0207708_10000034 Ga0207708_1000003464 177
253 3300026075 Ga0207708_10101615 Ga0207708_101016153 177
254 3300026088 Ga0207641_10254382 Ga0207641_102543821 177
255 3300026089 Ga0207648_10346129 Ga0207648_103461291 177
256 3300026089 Ga0207648_10704147 Ga0207648_107041472 177
257 3300026089 Ga0207648_11053363 Ga0207648_110533632 177
258 3300026116 Ga0207674_10037242 Ga0207674_100372422 177
259 3300026116 Ga0207674_10096149 Ga0207674_100961493 177
260 3300026118 Ga0207675_100029143 Ga0207675_1000291432 177
261 3300026118 Ga0207675_100170279 Ga0207675_1001702793 177
262 3300026121 Ga0207683_10193601 Ga0207683_101936012 177
263 3300027907 Ga0207428_10000061 Ga0207428_100000618 177
264 3300027907 Ga0207428_10004348 Ga0207428_100043488 177
265 3300027907 Ga0207428_10041333 Ga0207428_100413334 177
266 3300027907 Ga0207428_10374556 Ga0207428_103745561 177
267 3300028380 Ga0268265_10072935 Ga0268265_100729353 177
268 3300028380 Ga0268265_10468815 Ga0268265_104688152 177
269 3300031344 Ga0265316_10215824 Ga0265316_102158242 177
270 3300031548 Ga0307408_100004700 Ga0307408_1000047006 177
271 3300031548 Ga0307408_100039574 Ga0307408_1000395743 177
272 3300031548 Ga0307408_100186653 Ga0307408_1001866532 177
273 3300031731 Ga0307405_10164152 Ga0307405_101641523 177
274 3300031731 Ga0307405_10516087 Ga0307405_105160871 177
275 3300031731 Ga0307405_10753369 Ga0307405_107533692 177
276 3300031824 Ga0307413_10148741 Ga0307413_101487412 177
277 3300031824 Ga0307413_10158425 Ga0307413_101584251 177
278 3300031824 Ga0307413_10359915 Ga0307413_103599152 177
279 3300031852 Ga0307410_10036746 Ga0307410_100367462 177
280 3300031901 Ga0307406_10004697 Ga0307406_100046973 177
281 3300031901 Ga0307406_10149750 Ga0307406_101497502 177
282 3300031911 Ga0307412_10116449 Ga0307412_101164492 177
283 3300031911 Ga0307412_10153893 Ga0307412_101538932 177
284 3300031911 Ga0307412_10916341 Ga0307412_109163412 177
285 3300031995 Ga0307409_100023007 Ga0307409_1000230074 177
286 3300031995 Ga0307409_100203558 Ga0307409_1002035583 177
287 3300031995 Ga0307409_100385153 Ga0307409_1003851532 177
288 3300032002 Ga0307416_100034475 Ga0307416_1000344753 177
289 3300032002 Ga0307416_100070693 Ga0307416_1000706932 177
290 3300032002 Ga0307416_100108079 Ga0307416_1001080792 177
291 3300032002 Ga0307416_100445494 Ga0307416_1004454942 177
292 3300032002 Ga0307416_101154957 Ga0307416_1011549572 177
293 3300032005 Ga0307411_10083746 Ga0307411_100837462 177
294 3300032005 Ga0307411_10224777 Ga0307411_102247773 177
295 3300032005 Ga0307411_10399059 Ga0307411_103990592 177
296 3300032005 Ga0307411_10426140 Ga0307411_104261402 177
297 3300032126 Ga0307415_100027639 Ga0307415_1000276393 177
298 3300039437 Ga0436365_0774883 Ga0436365_0774883_345756_346289 177
299 3300039437 Ga0436365_1749406 Ga0436365_1749406_8566_9099 177
300 3300039453 Ga0436362_0660519 Ga0436362_0660519_136992_137525 177
301 3300039453 Ga0436362_0927290 Ga0436362_0927290_183_719 177
302 3300041410 Ga0439461_0024939 Ga0439461_0024939_518_1051 177
303 3300042000 Ga0439437_038179 Ga0439437_038179_40_573 177
304 3300042003 Ga0439443_044856 Ga0439443_044856_140_673 177
305 3300042008 Ga0439450_020285 Ga0439450_020285_178_711 177
306 3300042010 Ga0439452_079904 Ga0439452_079904_117_650 177
307 3300042436 Ga0439435_0000743 Ga0439435_0000743_1200_1733 177
308 3300042436 Ga0439435_0162414 Ga0439435_0162414_70_603 177
309 3300042439 Ga0439464_0008082 Ga0439464_0008082_1938_2471 177
310 3300042461 Ga0439460_0102134 Ga0439460_0102134_120_653 177
311 3300042876 Ga0451577_0045292 Ga0451577_0045292_1627_2160 177
312 3300042993 Ga0439440_0039555 Ga0439440_0039555_538_1074 177
313 3300044901 Ga0466960_0488519 Ga0466960_0488519_35_568 177
314 3300046454 Ga0495592_0425583 Ga0495592_0425583_27_605 177
315 3300046515 Ga0495620_0020806 Ga0495620_0020806_2502_3035 177
316 3300048090 Ga0495615_0175245 Ga0495615_0175245_31_564 177
317 3300048903 Ga0496100_0076484 Ga0496100_0076484_761_1312 177
318 3300048904 Ga0496101_0162430 Ga0496101_0162430_485_1018 177
319 3300048904 Ga0496101_0244198 Ga0496101_0244198_342_875 177
320 3300048907 Ga0496104_0014586 Ga0496104_0014586_3619_4152 177
321 3300048908 Ga0496105_0108251 Ga0496105_0108251_1602_2135 177
322 3300048911 Ga0496108_0297694 Ga0496108_0297694_701_1234 177
323 3300048912 Ga0496109_1461509 Ga0496109_1461509_34_585 177
324 3300048913 Ga0496110_0104244 Ga0496110_0104244_1977_2510 177
325 3300048914 Ga0496111_0041063 Ga0496111_0041063_988_1521 177
326 3300048915 Ga0496112_0045345 Ga0496112_0045345_2559_3092 177
327 3300048916 Ga0496113_0104031 Ga0496113_0104031_1459_1992 177
328 3300049521 Ga0501298_029078 Ga0501298_029078_414_947 177
329 3300049522 Ga0501299_033734 Ga0501299_033734_200_733 177
330 3300049570 Ga0501033_0370275 Ga0501033_0370275_444_977 177
331 3300049572 Ga0501036_0079670 Ga0501036_0079670_384_917 177
332 3300049574 Ga0501038_0342905 Ga0501038_0342905_605_1138 177
333 3300049575 Ga0501039_0879417 Ga0501039_0879417_97_630 177
334 3300049576 Ga0501040_0151889 Ga0501040_0151889_881_1414 177
335 3300049576 Ga0501040_0688056 Ga0501040_0688056_161_694 177
336 3300049579 Ga0501043_0534346 Ga0501043_0534346_55_588 177
337 3300049582 Ga0501048_0094656 Ga0501048_0094656_630_1163 177
338 3300049584 Ga0501068_0368150 Ga0501068_0368150_144_677 177
339 3300049587 Ga0501071_0249189 Ga0501071_0249189_159_692 177
340 3300049588 Ga0501072_0064711 Ga0501072_0064711_406_939 177
341 3300049589 Ga0501073_0545049 Ga0501073_0545049_63_599 177
342 3300049590 Ga0501074_0237072 Ga0501074_0237072_96_629 177
343 3300049590 Ga0501074_0673726 Ga0501074_0673726_95_628 177
344 3300049591 Ga0501075_0130667 Ga0501075_0130667_16_549 177
345 3300049591 Ga0501075_0658522 Ga0501075_0658522_211_744 177
346 3300049593 Ga0501077_0212184 Ga0501077_0212184_16_549 177
347 3300049658 Ga0501211_021604 Ga0501211_021604_34_567 177
348 3300049660 Ga0501216_025720 Ga0501216_025720_23_556 177
349 3300049679 Ga0501249_023459 Ga0501249_023459_584_1117 177
350 3300049681 Ga0501251_019860 Ga0501251_019860_91_624 177
351 3300049741 Ga0501079_0227691 Ga0501079_0227691_704_1237 177
352 3300049742 Ga0501080_0063978 Ga0501080_0063978_220_753 177
353 3300049742 Ga0501080_0345951 Ga0501080_0345951_457_993 177
354 3300049742 Ga0501080_0472600 Ga0501080_0472600_416_949 177
355 3300049743 Ga0501081_0035801 Ga0501081_0035801_1675_2208 177
356 3300049743 Ga0501081_0075392 Ga0501081_0075392_1400_1933 177
357 3300049743 Ga0501081_0629500 Ga0501081_0629500_172_708 177
358 3300049744 Ga0501083_0443538 Ga0501083_0443538_128_661 177
359 3300049770 Ga0501273_026084 Ga0501273_026084_103_636 177
360 3300049822 Ga0501035_0308520 Ga0501035_0308520_96_629 177
361 3300049824 Ga0501045_0078183 Ga0501045_0078183_868_1401 177
362 3300049824 Ga0501045_0107028 Ga0501045_0107028_392_925 177
363 3300049850 Ga0501204_046147 Ga0501204_046147_100_633 177
364 3300050494 nmdc:mga06z11_77593_c2 nmdc:mga06z11_77593_c2_47_580 177
365 3300050507 nmdc:mga05p37_7472_c1 nmdc:mga05p37_7472_c1_4054_4587 177
366 3300050507 nmdc:mga05p37_78767_c1 nmdc:mga05p37_78767_c1_2587_3123 177
367 3300050508 nmdc:mga09592_15537_c1 nmdc:mga09592_15537_c1_2958_3491 177
368 3300050508 nmdc:mga09592_25875_c1 nmdc:mga09592_25875_c1_2053_2586 177
369 3300050508 nmdc:mga09592_517493_c1 nmdc:mga09592_517493_c1_154_711 177
370 3300050508 nmdc:mga09592_519646_c1 nmdc:mga09592_519646_c1_157_690 177
371 3300050508 nmdc:mga09592_610410_c1 nmdc:mga09592_610410_c1_170_703 177
372 3300050508 nmdc:mga09592_872551_c1 nmdc:mga09592_872551_c1_35_568 177
373 3300050509 nmdc:mga0qj67_17037_c1 nmdc:mga0qj67_17037_c1_1128_1661 177
374 3300050509 nmdc:mga0qj67_5616_c1 nmdc:mga0qj67_5616_c1_991_1524 177
375 3300050510 nmdc:mga06r32_496089_c1 nmdc:mga06r32_496089_c1_322_855 177
376 3300050510 nmdc:mga06r32_521_c1 nmdc:mga06r32_521_c1_8025_8558 177
377 3300050510 nmdc:mga06r32_84411_c1 nmdc:mga06r32_84411_c1_768_1301 177
378 3300050510 nmdc:mga06r32_91870_c1 nmdc:mga06r32_91870_c1_1475_2008 177
379 3300050511 nmdc:mga08y16_1281_c1 nmdc:mga08y16_1281_c1_10944_11477 177
380 3300050511 nmdc:mga08y16_229302_c1 nmdc:mga08y16_229302_c1_742_1275 177
381 3300050511 nmdc:mga08y16_3241_c1 nmdc:mga08y16_3241_c1_3626_4159 177
382 3300050511 nmdc:mga08y16_4330_c1 nmdc:mga08y16_4330_c1_2682_3215 177
383 3300050512 nmdc:mga0n895_1585_c1 nmdc:mga0n895_1585_c1_4090_4623 177
384 3300050512 nmdc:mga0n895_201245_c1 nmdc:mga0n895_201245_c1_577_1110 177
385 3300050513 nmdc:mga0rr50_42801_c1 nmdc:mga0rr50_42801_c1_2709_3266 177
386 3300050513 nmdc:mga0rr50_6634_c1 nmdc:mga0rr50_6634_c1_6371_6904 177
387 3300053139 Ga0500568_0007669 Ga0500568_0007669_637_1170 177
388 3300054114 Ga0501084_0539728 Ga0501084_0539728_388_921 177
389 3300059421 Ga0590071_007842 Ga0590071_007842_1877_2410 177
390 3300059423 Ga0590074_001195 Ga0590074_001195_1616_2149 177
391 3300059424 Ga0590075_001967 Ga0590075_001967_1178_1711 177
392 3300059426 Ga0590077_001299 Ga0590077_001299_3356_3889 177
393 3300060353 Ga0501082_0368444 Ga0501082_0368444_63_596 177
394 3300060353 Ga0501082_0726685 Ga0501082_0726685_237_770 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07670

Gate

Nucleoside recognition

55

157

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wf1-assembly1.cif.gz_A tepsin vhs/enthlike domain semet 0.4478 88 165
7qij-assembly1.cif.gz_EC complex of the yersinia enterocolitica type iii secretion export gate yscv with substrate:chaperone complex yscx:yscy 0.422 54 149
4gpk-assembly2.cif.gz_H crystal structure of nprr in complex with its cognate peptide nprx 0.4096 57 150
1xt0-assembly1.cif.gz_B the structure of n-terminal sec7 domain of ralf 0.4014 47 134
7qij-assembly1.cif.gz_EC complex of the yersinia enterocolitica type iii secretion export gate yscv with substrate:chaperone complex yscx:yscy 0.3983 54 149
ID Description Score Start End Superfamily
af_Q8NB12_302_376_1.25.40.970 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.6562 89 147 1.25.40.970
af_A4HSS4_1054_1183_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6184 89 149 1.25.40.10
af_Q9SF38_515_586_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5752 88 145 1.25.40.10
af_Q6ZLD6_610_707_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5646 89 172 1.25.40.10
af_Q9LIL5_237_310_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.564 88 145 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0P1M4I7-F1-model_v4 Spore maturation protein B 0.7092 1 164 GO:0005886
AF-A0A3D5ZNN6-F1-model_v4 Spore maturation protein 0.7044 36 164 GO:0005886
AF-A0A2E1K140-F1-model_v4 Spore maturation protein 0.702 1 163 GO:0005886
AF-A0A7V3T128-F1-model_v4 Spore maturation protein 0.697 35 164 GO:0005886
AF-A0A7C6QB52-F1-model_v4 Nucleoside recognition protein 0.697 33 129 GO:0016020

Feature Viewer

pLDDT pTM Quality
77.69 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map