F432897

General Info

Members Datasets Scaffolds Average Seq Length
394 264 355 268

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10003409|Ga0182008_100034093
Length 295
Sequence MLPPVIFSHGNSFPASTYRVMLDSLRNRGFDVDAVEKFGHDPKYPVTDNWPHLVQQLADFAQARADRAGAPVLLVGHSLGGFLSLMCAALHPALARGVVLLDSPLIGGWRAGTINLMKRTPLMKSVSPGMISRKRRNTWEHREAVFEHFRSKKAFAKWDERVLRDYIEHGTFDLDDASDAGPPQGARAPAGGSEDTSVPSVGASSRALSFDRDVETAIYDTIPHNLGALLRAHPLKCRAAFVGGRQSVEMKRVGMAMTQQVTKGRIMMLDGTHLFPMEKPIATAAAVEAALRNLL

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2818991446 Variovorax sp. 1180 Isolate Unclassified
12 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
13 2842677519 Variovorax sp. R-72495 Isolate Unclassified
14 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
15 2842733646 Variovorax sp. R-72446 Isolate Unclassified
16 2842747753 Variovorax sp. R-72060 Isolate Unclassified
17 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
18 2885198086 Variovorax sp. 679 Isolate Unclassified
19 2885211737 Variovorax sp. 553 Isolate Unclassified
20 2899924645 Variovorax sp. 369 Isolate Unclassified
21 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
22 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
23 2904456579 Variovorax sp. 2002 Isolate Unclassified
24 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
25 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
26 2928037797 Variovorax sp. 1126 Isolate Unclassified
27 2928044640 Variovorax sp. 1128 Isolate Unclassified
28 2928051484 Variovorax sp. 1133 Isolate Unclassified
29 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
30 2928070936 Variovorax gossypii 1167 Isolate Unclassified
31 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
32 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
33 2929520902 Variovorax beijingensis 502 Isolate Unclassified
34 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
35 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
36 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
37 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
38 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
39 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
40 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
41 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
50 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
51 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
54 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
55 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
152 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
158 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
159 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
160 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
161 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
183 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
189 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
190 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
191 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
192 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
253 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
254 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
255 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
256 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
260 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
264 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.1
Metatranscriptomes 0
Isolates 9.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.55
Nodule 2.28
Rhizoplane 4.31
Rhizosphere 44.42
Stem 0
Stem Tuber 0
Unclassified 12.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10032542 3300001989 Bacteria 1792
2 JGI25152J39213_1022920 3300002773 Bacteria 1072
3 JGI25150J39212_1005272 3300002774 Bacteria 2778
4 JGI25159J45721_1007873 3300002987 Bacteria 2996
5 JGI25159J45721_1014782 3300002987 Bacteria 1742
6 JGI25151J46595_10004697 3300003187 Bacteria 7180
7 JGI25151J46595_10040746 3300003187 Bacteria 1697
8 Ga0055535_1000609 3300003761 Bacteria 29464
9 Ga0055542_1000052 3300003762 Bacteria 173583
10 Ga0055526_1011759 3300003771 Bacteria 3896
11 Ga0055526_1011788 3300003771 Bacteria 3889
12 Ga0055537_1000050 3300003773 Bacteria 86738
13 Ga0055537_1013119 3300003773 Bacteria 1573
14 Ga0055537_1017251 3300003773 Bacteria 1193
15 Ga0055537_1019850 3300003773 Bacteria 1034
16 Ga0055524_1000080 3300003775 Bacteria 120203
17 Ga0055524_1000360 3300003775 Bacteria 40907
18 Ga0055524_1018160 3300003775 Bacteria 2451
19 Ga0055536_1000588 3300003781 Bacteria 24780
20 Ga0055536_1015809 3300003781 Bacteria 2561
21 Ga0055536_1033187 3300003781 Bacteria 1322
22 Ga0055534_1000035 3300003784 Bacteria 114162
23 Ga0055534_1000386 3300003784 Bacteria 27590
24 Ga0055534_1004610 3300003784 Bacteria 3928
25 Ga0055534_1006608 3300003784 Bacteria 2894
26 Ga0055534_1010613 3300003784 Bacteria 1917
27 Ga0055528_1000484 3300003790 Bacteria 31520
28 Ga0055528_1027878 3300003790 Bacteria 1574
29 Ga0055528_1041134 3300003790 Bacteria 1034
30 Ga0055530_10000284 3300003791 Bacteria 46103
31 Ga0055530_10008410 3300003791 Bacteria 4142
32 Ga0055540_1000656 3300003792 Bacteria 24287
33 Ga0055540_1008637 3300003792 Bacteria 3642
34 Ga0055531_10014167 3300003794 Bacteria 3612
35 Ga0055543_1005790 3300004625 Bacteria 3098
36 Ga0055543_1006004 3300004625 Bacteria 3011
37 Ga0065165_1011284 3300005262 Bacteria 3749
38 Ga0065714_10074537 3300005288 Bacteria 3025
39 Ga0065714_10083936 3300005288 Bacteria 2217
40 Ga0065714_10132422 3300005288 Bacteria 1237
41 Ga0068869_100068830 3300005334 Bacteria 2616
42 Ga0068869_100130078 3300005334 Bacteria 1934
43 Ga0068869_100151435 3300005334 Bacteria 1799
44 Ga0070668_100362217 3300005347 Bacteria 1230
45 Ga0070668_100481222 3300005347 Bacteria 1072
46 Ga0070659_100281409 3300005366 Bacteria 1384
47 Ga0070667_100077071 3300005367 Bacteria 2846
48 Ga0070700_100057696 3300005441 Bacteria 2436
49 Ga0070678_100620567 3300005456 Bacteria 967
50 Ga0070662_100104891 3300005457 Bacteria 2145
51 Ga0068867_100006697 3300005459 Bacteria 8144
52 Ga0068867_100183500 3300005459 Bacteria 1665
53 Ga0068853_100250928 3300005539 Bacteria 1623
54 Ga0068853_100403574 3300005539 Bacteria 1280
55 Ga0070665_100024038 3300005548 Bacteria 6136
56 Ga0070665_100406476 3300005548 Bacteria 1370
57 Ga0070664_100033460 3300005564 Bacteria 4305
58 Ga0068857_100257080 3300005577 Bacteria 1602
59 Ga0068854_100298960 3300005578 Bacteria 1301
60 Ga0068852_100038538 3300005616 Bacteria 4017
61 Ga0068866_10064249 3300005718 Bacteria 1916
62 Ga0068861_100006546 3300005719 Bacteria 7948
63 Ga0068851_10002279 3300005834 Bacteria 8430
64 Ga0068863_100214435 3300005841 Bacteria 1854
65 Ga0068860_100006423 3300005843 Bacteria 11803
66 Ga0068862_100031390 3300005844 Bacteria 4484
67 Ga0075365_10041689 3300006038 Bacteria 3000
68 Ga0075363_100191238 3300006048 Bacteria 1167
69 Ga0075364_10012436 3300006051 Bacteria 5205
70 Ga0075364_10035996 3300006051 Bacteria 3200
71 Ga0075364_10096092 3300006051 Bacteria 1970
72 Ga0075432_10009536 3300006058 Bacteria 3306
73 Ga0075432_10057635 3300006058 Bacteria 1379
74 Ga0075362_10075454 3300006177 Bacteria 1546
75 Ga0075367_10240541 3300006178 Bacteria 1134
76 Ga0075367_10273767 3300006178 Bacteria 1061
77 Ga0075366_10078347 3300006195 Bacteria 1972
78 Ga0097621_100150006 3300006237 Bacteria 1999
79 Ga0075370_10000344 3300006353 Bacteria 16799
80 Ga0075370_10020958 3300006353 Bacteria 3579
81 Ga0075370_10053591 3300006353 Bacteria 2289
82 Ga0075370_10067168 3300006353 Bacteria 2046
83 Ga0068865_100003868 3300006881 Bacteria 8978
84 Ga0099826_10000004 3300006948 Bacteria 802669
85 Ga0099826_10000128 3300006948 Bacteria 33186
86 Ga0105244_10049016 3300009036 Bacteria 2160
87 Ga0105245_10275140 3300009098 Bacteria 1644
88 Ga0105243_10144422 3300009148 Bacteria 2034
89 Ga0105243_10306298 3300009148 Bacteria 1442
90 Ga0105242_10319896 3300009176 Bacteria 1423
91 Ga0105237_10185283 3300009545 Bacteria 2082
92 Ga0105238_10140908 3300009551 Bacteria 2388
93 Ga0105249_10085815 3300009553 Bacteria 2934
94 Ga0105246_10133609 3300011119 Bacteria 1857
95 Ga0105246_10147146 3300011119 Bacteria 1779
96 Ga0157373_10029689 3300013100 Bacteria 3936
97 Ga0157371_10013712 3300013102 Bacteria 6147
98 Ga0157369_10611329 3300013105 Bacteria 1125
99 Ga0157378_10035276 3300013297 Bacteria 4424
100 Ga0163162_10019015 3300013306 Bacteria 6737
101 Ga0163162_10026162 3300013306 Bacteria 5766
102 Ga0163162_10033248 3300013306 Bacteria 5123
103 Ga0157375_10287371 3300013308 Bacteria 1807
104 Ga0157380_10019050 3300014326 Bacteria 5109
105 Ga0182008_10003409 3300014497 Bacteria 9603
106 Ga0182008_10004852 3300014497 Bacteria 7768
107 Ga0182008_10012709 3300014497 Bacteria 4441
108 Ga0182008_10021593 3300014497 Bacteria 3305
109 Ga0157379_10053392 3300014968 Bacteria 3609
110 Ga0182006_1077111 3300015261 Bacteria 1223
111 Ga0182007_10001590 3300015262 Bacteria 12094
112 Ga0182007_10002372 3300015262 Bacteria 9423
113 Ga0182005_1050452 3300015265 Bacteria 1131
114 Ga0183362_10001 3300015683 Bacteria 2046624
115 Ga0163161_10000180 3300017792 Bacteria 57748
116 Ga0163161_10005252 3300017792 Bacteria 9014
117 Ga0213872_10028812 3300021361 Bacteria 2546
118 Ga0209436_107120 3300025208 Bacteria 2375
119 Ga0209147_102622 3300025229 Bacteria 4239
120 Ga0209258_100009 3300025242 Bacteria 996276
121 Ga0207425_1000294 3300025245 Bacteria 36412
122 Ga0209148_1000007 3300025254 Bacteria 1592273
123 Ga0209129_1000083 3300025258 Bacteria 183270
124 Ga0209129_1005578 3300025258 Bacteria 4390
125 Ga0209129_1006898 3300025258 Bacteria 3529
126 Ga0209565_1000115 3300025263 Bacteria 115272
127 Ga0209565_1000194 3300025263 Bacteria 73024
128 Ga0209565_1000235 3300025263 Bacteria 60351
129 Ga0209565_1000614 3300025263 Bacteria 23607
130 Ga0209565_1002072 3300025263 Bacteria 7671
131 Ga0209565_1011548 3300025263 Bacteria 2143
132 Ga0209673_1000089 3300025273 Bacteria 202240
133 Ga0209673_1000412 3300025273 Bacteria 75374
134 Ga0209673_1000751 3300025273 Bacteria 44268
135 Ga0209673_1002306 3300025273 Bacteria 13549
136 Ga0209673_1015799 3300025273 Bacteria 2849
137 Ga0209673_1044475 3300025273 Bacteria 1228
138 Ga0209130_1002627 3300025284 Bacteria 8638
139 Ga0209130_1008866 3300025284 Bacteria 2925
140 Ga0209130_1010715 3300025284 Bacteria 2504
141 Ga0209675_1000110 3300025291 Bacteria 115272
142 Ga0209675_1000125 3300025291 Bacteria 105527
143 Ga0209675_1000304 3300025291 Bacteria 44374
144 Ga0209675_1000312 3300025291 Bacteria 43634
145 Ga0209675_1008266 3300025291 Bacteria 3852
146 Ga0209675_1010167 3300025291 Bacteria 3239
147 Ga0209676_1000004 3300025292 Bacteria 1138360
148 Ga0209676_1000014 3300025292 Bacteria 793514
149 Ga0209676_1000206 3300025292 Bacteria 132202
150 Ga0209676_1018209 3300025292 Bacteria 2457
151 Ga0209676_1054600 3300025292 Bacteria 1028
152 Ga0209025_1000155 3300025294 Bacteria 169116
153 Ga0209025_1000379 3300025294 Bacteria 92457
154 Ga0209025_1000423 3300025294 Bacteria 84180
155 Ga0209025_1000492 3300025294 Bacteria 75894
156 Ga0209025_1001571 3300025294 Bacteria 28912
157 Ga0209025_1001709 3300025294 Bacteria 26726
158 Ga0209025_1007214 3300025294 Bacteria 8368
159 Ga0209025_1057582 3300025294 Bacteria 1484
160 Ga0209564_1000244 3300025295 Bacteria 117606
161 Ga0209564_1000314 3300025295 Bacteria 95107
162 Ga0209564_1001235 3300025295 Bacteria 28797
163 Ga0209564_1001259 3300025295 Bacteria 27998
164 Ga0209564_1011107 3300025295 Bacteria 4069
165 Ga0209564_1047373 3300025295 Bacteria 1084
166 Ga0209758_1000132 3300025297 Bacteria 183273
167 Ga0209758_1030982 3300025297 Bacteria 2204
168 Ga0209050_1000002 3300025298 Bacteria 1792849
169 Ga0209050_1000766 3300025298 Bacteria 46104
170 Ga0209256_1000011 3300025299 Bacteria 865309
171 Ga0209256_1000192 3300025299 Bacteria 117606
172 Ga0209256_1000251 3300025299 Bacteria 95107
173 Ga0209256_1000291 3300025299 Bacteria 88153
174 Ga0209256_1000700 3300025299 Bacteria 44602
175 Ga0207426_1000095 3300025302 Bacteria 274234
176 Ga0207426_1000385 3300025302 Bacteria 75897
177 Ga0209051_1000002 3300025303 Bacteria 1631846
178 Ga0209051_1000113 3300025303 Bacteria 152417
179 Ga0209051_1000216 3300025303 Bacteria 97590
180 Ga0209051_1000443 3300025303 Bacteria 56293
181 Ga0209051_1012727 3300025303 Bacteria 4051
182 Ga0209257_1000002 3300025304 Bacteria 1767052
183 Ga0209257_1000312 3300025304 Bacteria 102739
184 Ga0209257_1018970 3300025304 Bacteria 2613
185 Ga0207655_1033338 3300025728 Bacteria 2336
186 Ga0207642_10279835 3300025899 Bacteria 959
187 Ga0207694_10285324 3300025924 Bacteria 1357
188 Ga0207687_10125599 3300025927 Bacteria 1925
189 Ga0207706_10028313 3300025933 Bacteria 5004
190 Ga0207686_10219989 3300025934 Bacteria 1371
191 Ga0207709_10009102 3300025935 Bacteria 5475
192 Ga0207704_10083771 3300025938 Bacteria 2070
193 Ga0207691_10487186 3300025940 Bacteria 1048
194 Ga0207689_10041454 3300025942 Bacteria 3810
195 Ga0207689_10084831 3300025942 Bacteria 2603
196 Ga0207679_10049083 3300025945 Bacteria 3077
197 Ga0207668_10044481 3300025972 Bacteria 3021
198 Ga0207640_10145430 3300025981 Bacteria 1734
199 Ga0207639_10283974 3300026041 Bacteria 1457
200 Ga0207678_10166928 3300026067 Bacteria 1880
201 Ga0207641_10104324 3300026088 Bacteria 2503
202 Ga0207648_10001269 3300026089 Bacteria 28173
203 Ga0207674_10057095 3300026116 Bacteria 3958
204 Ga0207675_100008466 3300026118 Bacteria 9691
205 Ga0207698_10153172 3300026142 Bacteria 2004
206 Ga0209281_1017292 3300027111 Bacteria 1465
207 Ga0209282_1000027 3300027666 Bacteria 159842
208 Ga0209282_1000191 3300027666 Bacteria 32855
209 Ga0268266_10120265 3300028379 Bacteria 2337
210 Ga0268264_10013207 3300028381 Bacteria 6797
211 Ga0265334_10030933 3300028573 Bacteria 2141
212 Ga0307515_10001137 3300028794 Bacteria 61003
213 Ga0307515_10007242 3300028794 Bacteria 21968
214 Ga0265324_10012502 3300029957 Bacteria 3198
215 Ga0316177_1138627 3300030731 Bacteria 2546
216 Ga0316176_1145617 3300030732 Bacteria 2124
217 Ga0314311_1035404 3300030733 Bacteria 4221
218 Ga0316183_1062795 3300030742 Bacteria 4151
219 Ga0316182_1073729 3300030745 Bacteria 2692
220 Ga0316182_1173201 3300030745 Bacteria 3653
221 Ga0265330_10000334 3300031235 Bacteria 33914
222 Ga0265332_10000011 3300031238 Bacteria 284299
223 Ga0265325_10017635 3300031241 Bacteria 3967
224 Ga0265327_10001170 3300031251 Bacteria 35598
225 Ga0265327_10004830 3300031251 Bacteria 11678
226 Ga0265327_10017387 3300031251 Bacteria 4515
227 Ga0265316_10000176 3300031344 Bacteria 72297
228 Ga0307408_100003976 3300031548 Bacteria 10070
229 Ga0307408_100129777 3300031548 Bacteria 1965
230 Ga0307408_100324246 3300031548 Bacteria 1298
231 Ga0307514_10014112 3300031649 Bacteria 6617
232 Ga0265314_10000026 3300031711 Bacteria 284299
233 Ga0307516_10018771 3300031730 Bacteria 7181
234 Ga0307405_10191230 3300031731 Bacteria 1478
235 Ga0307413_10043354 3300031824 Bacteria 2651
236 Ga0307406_10016059 3300031901 Bacteria 4343
237 Ga0307412_10003874 3300031911 Bacteria 8325
238 Ga0307412_10053013 3300031911 Bacteria 2688
239 Ga0307409_100105897 3300031995 Bacteria 2346
240 Ga0307414_10056219 3300032004 Bacteria 2759
241 Ga0307411_10059187 3300032005 Bacteria 2538
242 Ga0395900_0000109 3300037418 Bacteria 146053
243 Ga0395905_0003713 3300037471 Bacteria 16174
244 Ga0436361_0720340 3300039447 Bacteria 6926
245 Ga0439436_0050471 3300041404 Bacteria 1177
246 Ga0439466_0036688 3300041411 Bacteria 1654
247 Ga0439465_0007894 3300041413 Bacteria 3372
248 Ga0451791_0705228 3300041451 Bacteria 1216
249 Ga0451802_0549080 3300041460 Bacteria 957
250 Ga0451833_0670342 3300041491 Bacteria 932
251 Ga0439442_002191 3300042002 Bacteria 3850
252 Ga0439462_0016019 3300042015 Bacteria 1934
253 Ga0450921_001457 3300042123 Bacteria 1432
254 Ga0450906_022228 3300042145 Bacteria 1131
255 Ga0450908_001932 3300042184 Bacteria 4054
256 Ga0451577_0006402 3300042876 Bacteria 11751
257 Ga0451577_0339613 3300042876 Bacteria 1362
258 Ga0453683_0001872 3300044673 Bacteria 17242
259 Ga0453684_0031950 3300044712 Bacteria 7381
260 Ga0451576_0072801 3300045051 Bacteria 3575
261 Ga0495605_0031245 3300046474 Bacteria 2721
262 Ga0495664_0198814 3300046477 Bacteria 1215
263 Ga0495596_0008624 3300046500 Bacteria 4527
264 Ga0495607_0047149 3300046501 Bacteria 2526
265 Ga0495610_0014229 3300046512 Bacteria 4685
266 Ga0495616_0005799 3300046513 Bacteria 7550
267 Ga0495620_0040688 3300046515 Bacteria 2043
268 Ga0495637_0020142 3300046520 Bacteria 3072
269 Ga0495654_0002079 3300046530 Bacteria 13124
270 Ga0495609_0015204 3300046538 Bacteria 3606
271 Ga0495645_0236899 3300046543 Bacteria 1220
272 Ga0495656_0000078 3300046615 Bacteria 43221
273 Ga0495625_0000057 3300046660 Bacteria 181623
274 Ga0495658_0011434 3300046683 Bacteria 4465
275 Ga0495669_0089448 3300046684 Bacteria 1420
276 Ga0495624_0248081 3300046690 Bacteria 1077
277 Ga0495670_0005352 3300046691 Bacteria 6311
278 Ga0495670_0166994 3300046691 Bacteria 1158
279 Ga0495671_0017964 3300046692 Bacteria 3760
280 Ga0495589_0140316 3300046794 Bacteria 1157
281 Ga0495660_0125811 3300046810 Bacteria 1291
282 Ga0495636_0085093 3300047318 Bacteria 1366
283 Ga0495674_0003080 3300047319 Bacteria 16205
284 Ga0495672_0013491 3300047320 Bacteria 5637
285 Ga0495672_0021505 3300047320 Bacteria 4207
286 Ga0495676_0020510 3300047321 Bacteria 5796
287 Ga0495686_0000002 3300047472 Bacteria 1050777
288 Ga0495602_0084623 3300048088 Bacteria 2653
289 Ga0495602_0190574 3300048088 Bacteria 1573
290 Ga0495614_0000442 3300048089 Bacteria 17061
291 Ga0496100_0147705 3300048903 Bacteria 1673
292 Ga0496101_0006744 3300048904 Bacteria 7405
293 Ga0496101_0024252 3300048904 Bacteria 4196
294 Ga0496102_0030377 3300048905 Bacteria 4836
295 Ga0496102_0217932 3300048905 Bacteria 1799
296 Ga0496102_0260811 3300048905 Bacteria 1634
297 Ga0496103_0128903 3300048906 Bacteria 1615
298 Ga0496105_0014612 3300048908 Bacteria 6253
299 Ga0496108_0179838 3300048911 Bacteria 1831
300 Ga0496109_0579074 3300048912 Bacteria 1058
301 Ga0496109_0726866 3300048912 Bacteria 931
302 Ga0496110_0162838 3300048913 Bacteria 2022
303 Ga0496116_0003117 3300048919 Bacteria 16661
304 Ga0496116_0036889 3300048919 Bacteria 3415
305 Ga0496117_0000622 3300048920 Bacteria 57400
306 Ga0496117_0124942 3300048920 Bacteria 1572
307 Ga0496118_0016834 3300048921 Bacteria 6682
308 Ga0496118_0019726 3300048921 Bacteria 6013
309 Ga0496118_0063615 3300048921 Bacteria 2713
310 Ga0496121_0037838 3300048924 Bacteria 4280
311 Ga0496121_0130515 3300048924 Bacteria 1881
312 Ga0496121_0203671 3300048924 Bacteria 1408
313 Ga0496122_0000985 3300048925 Bacteria 50829
314 Ga0496122_0038895 3300048925 Bacteria 3801
315 Ga0496123_0000176 3300048926 Bacteria 130010
316 Ga0496123_0034328 3300048926 Bacteria 3635
317 Ga0496124_0000317 3300048927 Bacteria 89188
318 Ga0496124_0070042 3300048927 Bacteria 2910
319 Ga0496124_0075214 3300048927 Bacteria 2790
320 Ga0496124_0159970 3300048927 Bacteria 1756
321 Ga0496124_0280766 3300048927 Bacteria 1214
322 Ga0496125_0009263 3300048928 Bacteria 10166
323 Ga0496125_0119035 3300048928 Bacteria 1889
324 Ga0496125_0175170 3300048928 Bacteria 1436
325 Ga0496126_0000031 3300048929 Bacteria 373371
326 Ga0501034_0002488 3300049571 Bacteria 22135
327 Ga0501034_0874231 3300049571 Bacteria 788
328 Ga0501262_000768 3300049759 Bacteria 3705
329 nmdc:mga03683_84302_c1 3300050489 Bacteria 1377
330 nmdc:mga03683_87672_c1 3300050489 Bacteria 1353
331 nmdc:mga03n38_50909_c1 3300050490 Bacteria 1848
332 nmdc:mga00v17_225427_c1 3300050491 Bacteria 1214
333 nmdc:mga00v17_280039_c1 3300050491 Bacteria 1083
334 nmdc:mga00v17_44611_c1 3300050491 Bacteria 2674
335 nmdc:mga0k408_90715_c1 3300050493 Bacteria 1795
336 nmdc:mga06z11_198753_c1 3300050494 Bacteria 1163
337 nmdc:mga06z11_235010_c1 3300050494 Bacteria 1075
338 nmdc:mga07m45_285_c1 3300050496 Bacteria 20375
339 nmdc:mga07m45_70030_c1 3300050496 Bacteria 1995
340 Ga0500610_0000322 3300053079 Bacteria 14408
341 Ga0500651_0000059 3300053093 Bacteria 71552
342 Ga0500566_0207836 3300053094 Bacteria 982
343 Ga0500571_001325 3300053110 Bacteria 11468
344 Ga0500597_112023 3300053120 Bacteria 1184
345 Ga0500607_000736 3300053121 Bacteria 31568
346 Ga0500608_080411 3300053122 Bacteria 1538
347 Ga0500618_002510 3300053125 Bacteria 6850
348 Ga0500658_0000220 3300053134 Bacteria 27258
349 Ga0500559_0005390 3300053136 Bacteria 5890
350 Ga0500559_0106820 3300053136 Bacteria 1294
351 Ga0500561_0062079 3300053137 Bacteria 1049
352 Ga0500573_0028086 3300053140 Bacteria 3239
353 Ga0500622_0092015 3300053156 Bacteria 1504
354 Ga0500627_0001872 3300053158 Bacteria 6025
355 Ga0500634_0001742 3300053161 Bacteria 8720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0579074 Ga0496109_0579074_49_759 217
2 iso_pu_bacteria 2901300506 2901310227 226
3 3300031649 Ga0307514_10014112 Ga0307514_100141126 236
4 iso_pu_bacteria 2858688981 2858695161 244
5 3300049571 Ga0501034_0874231 Ga0501034_0874231_14_775 247
6 iso_pu_bacteria 2511231026 2511385130 247
7 3300005288 Ga0065714_10083936 Ga0065714_100839363 248
8 3300005367 Ga0070667_100077071 Ga0070667_1000770713 248
9 3300042015 Ga0439462_0016019 Ga0439462_0016019_783_1571 248
10 3300048903 Ga0496100_0147705 Ga0496100_0147705_513_1259 248
11 3300048904 Ga0496101_0006744 Ga0496101_0006744_2344_3090 248
12 3300048908 Ga0496105_0014612 Ga0496105_0014612_4079_4825 248
13 3300048911 Ga0496108_0179838 Ga0496108_0179838_76_822 248
14 iso_pu_bacteria 2513237150 2513952907 258
15 iso_pu_bacteria 2513237165 2514042422 258
16 iso_pu_bacteria 644736347 644747478 258
17 3300028794 Ga0307515_10007242 Ga0307515_1000724220 259
18 3300006058 Ga0075432_10057635 Ga0075432_100576352 261
19 3300009545 Ga0105237_10185283 Ga0105237_101852831 261
20 3300025294 Ga0209025_1000423 Ga0209025_100042366 261
21 3300047318 Ga0495636_0085093 Ga0495636_0085093_149_955 261
22 3300048919 Ga0496116_0036889 Ga0496116_0036889_2432_3238 261
23 3300049571 Ga0501034_0002488 Ga0501034_0002488_308_1111 261
24 3300053125 Ga0500618_002510 Ga0500618_002510_2029_2874 261
25 iso_pu_bacteria 2919704043 2919707587 261
26 iso_pu_bacteria 2939631187 2939632850 261
27 3300042876 Ga0451577_0339613 Ga0451577_0339613_107_913 262
28 3300048924 Ga0496121_0037838 Ga0496121_0037838_2247_3044 262
29 3300048927 Ga0496124_0000317 Ga0496124_0000317_17004_17801 262
30 3300048928 Ga0496125_0009263 Ga0496125_0009263_648_1445 262
31 iso_pu_bacteria 2513020051 2513229373 262
32 iso_pu_bacteria 2599185214 2599622799 262
33 iso_pu_bacteria 2599185226 2599671278 262
34 iso_pu_bacteria 2599185227 2599679685 262
35 iso_pu_bacteria 2599185229 2599691701 262
36 iso_pu_bacteria 2643221672 2644400303 262
37 iso_pu_bacteria 2818991446 2819599868 262
38 iso_pu_bacteria 2838054893 2838056350 262
39 iso_pu_bacteria 2842718218 2842721263 262
40 iso_pu_bacteria 2885198086 2885204708 262
41 iso_pu_bacteria 2885211737 2885218605 262
42 iso_pu_bacteria 2899924645 2899926608 262
43 iso_pu_bacteria 2928037797 2928044308 262
44 iso_pu_bacteria 2928044640 2928051395 262
45 iso_pu_bacteria 2928051484 2928052407 262
46 iso_pu_bacteria 2928064002 2928064926 262
47 iso_pu_bacteria 2928070936 2928074594 262
48 iso_pu_bacteria 2974320154 2974322644 262
49 3300031251 Ga0265327_10004830 Ga0265327_100048303 263
50 3300031344 Ga0265316_10000176 Ga0265316_1000017657 263
51 3300031548 Ga0307408_100129777 Ga0307408_1001297772 263
52 3300031730 Ga0307516_10018771 Ga0307516_100187712 263
53 3300031911 Ga0307412_10053013 Ga0307412_100530133 263
54 3300037418 Ga0395900_0000109 Ga0395900_0000109_90730_91560 263
55 3300037471 Ga0395905_0003713 Ga0395905_0003713_7649_8506 263
56 3300048905 Ga0496102_0260811 Ga0496102_0260811_276_1079 263
57 3300048912 Ga0496109_0726866 Ga0496109_0726866_12_848 263
58 3300048920 Ga0496117_0000622 Ga0496117_0000622_42242_43045 263
59 3300048921 Ga0496118_0019726 Ga0496118_0019726_1353_2156 263
60 3300048929 Ga0496126_0000031 Ga0496126_0000031_207100_207903 263
61 iso_pu_bacteria 2643221628 2644160318 263
62 iso_pu_bacteria 2842677519 2842680511 263
63 iso_pu_bacteria 2929160207 2929164588 263
64 3300003187 JGI25151J46595_10040746 JGI25151J46595_100407462 264
65 3300003771 Ga0055526_1011759 Ga0055526_10117591 264
66 3300003771 Ga0055526_1011788 Ga0055526_10117881 264
67 3300003773 Ga0055537_1017251 Ga0055537_10172511 264
68 3300003775 Ga0055524_1000080 Ga0055524_100008067 264
69 3300003775 Ga0055524_1000360 Ga0055524_100036018 264
70 3300003775 Ga0055524_1018160 Ga0055524_10181602 264
71 3300003781 Ga0055536_1000588 Ga0055536_10005889 264
72 3300003784 Ga0055534_1000386 Ga0055534_10003865 264
73 3300003784 Ga0055534_1004610 Ga0055534_10046103 264
74 3300006948 Ga0099826_10000004 Ga0099826_10000004458 264
75 3300013306 Ga0163162_10026162 Ga0163162_100261622 264
76 3300025263 Ga0209565_1000235 Ga0209565_100023532 264
77 3300025263 Ga0209565_1002072 Ga0209565_10020725 264
78 3300025263 Ga0209565_1011548 Ga0209565_10115482 264
79 3300025273 Ga0209673_1044475 Ga0209673_10444752 264
80 3300025284 Ga0209130_1008866 Ga0209130_10088662 264
81 3300025291 Ga0209675_1000125 Ga0209675_100012518 264
82 3300025291 Ga0209675_1000312 Ga0209675_100031218 264
83 3300025291 Ga0209675_1010167 Ga0209675_10101673 264
84 3300025292 Ga0209676_1000014 Ga0209676_100001476 264
85 3300025294 Ga0209025_1000379 Ga0209025_10003795 264
86 3300025294 Ga0209025_1001571 Ga0209025_10015711 264
87 3300025294 Ga0209025_1001709 Ga0209025_100170922 264
88 3300025294 Ga0209025_1057582 Ga0209025_10575822 264
89 3300025295 Ga0209564_1001235 Ga0209564_10012352 264
90 3300025295 Ga0209564_1001259 Ga0209564_10012595 264
91 3300025295 Ga0209564_1011107 Ga0209564_10111074 264
92 3300025297 Ga0209758_1030982 Ga0209758_10309822 264
93 3300025299 Ga0209256_1000011 Ga0209256_1000011634 264
94 3300025299 Ga0209256_1000291 Ga0209256_100029121 264
95 3300025299 Ga0209256_1000700 Ga0209256_100070020 264
96 3300025303 Ga0209051_1012727 Ga0209051_10127274 264
97 3300027666 Ga0209282_1000027 Ga0209282_100002731 264
98 3300046474 Ga0495605_0031245 Ga0495605_0031245_555_1373 264
99 3300046477 Ga0495664_0198814 Ga0495664_0198814_261_1109 264
100 3300046500 Ga0495596_0008624 Ga0495596_0008624_3446_4264 264
101 3300046501 Ga0495607_0047149 Ga0495607_0047149_1237_2055 264
102 3300046512 Ga0495610_0014229 Ga0495610_0014229_3653_4471 264
103 3300046513 Ga0495616_0005799 Ga0495616_0005799_217_1035 264
104 3300046538 Ga0495609_0015204 Ga0495609_0015204_2544_3362 264
105 3300046684 Ga0495669_0089448 Ga0495669_0089448_356_1174 264
106 3300046691 Ga0495670_0166994 Ga0495670_0166994_255_1073 264
107 3300046692 Ga0495671_0017964 Ga0495671_0017964_2713_3531 264
108 3300046794 Ga0495589_0140316 Ga0495589_0140316_166_993 264
109 3300047319 Ga0495674_0003080 Ga0495674_0003080_14818_15666 264
110 3300047320 Ga0495672_0013491 Ga0495672_0013491_792_1619 264
111 3300047320 Ga0495672_0021505 Ga0495672_0021505_229_1047 264
112 3300047472 Ga0495686_0000002 Ga0495686_0000002_551531_552358 264
113 3300048919 Ga0496116_0003117 Ga0496116_0003117_15602_16420 264
114 3300048924 Ga0496121_0130515 Ga0496121_0130515_259_1077 264
115 3300048925 Ga0496122_0038895 Ga0496122_0038895_2711_3529 264
116 3300048926 Ga0496123_0034328 Ga0496123_0034328_2568_3386 264
117 3300048927 Ga0496124_0280766 Ga0496124_0280766_154_972 264
118 3300048928 Ga0496125_0175170 Ga0496125_0175170_249_1067 264
119 iso_pu_bacteria 2842733646 2842735332 264
120 iso_pu_bacteria 2945984333 2945987014 264
121 iso_pu_bacteria 2842747753 2842749104 265
122 iso_pu_bacteria 2904449895 2904452361 265
123 iso_pu_bacteria 2904456579 2904458491 265
124 iso_pu_bacteria 2919462493 2919466403 265
125 iso_pu_bacteria 2929520902 2929522283 265
126 iso_pu_bacteria 2945945610 2945946683 265
127 iso_pu_bacteria 2945972063 2945976400 265
128 3300002773 JGI25152J39213_1022920 JGI25152J39213_10229201 266
129 3300002774 JGI25150J39212_1005272 JGI25150J39212_10052722 266
130 3300002987 JGI25159J45721_1007873 JGI25159J45721_10078733 266
131 3300002987 JGI25159J45721_1014782 JGI25159J45721_10147821 266
132 3300003187 JGI25151J46595_10004697 JGI25151J46595_100046972 266
133 3300003761 Ga0055535_1000609 Ga0055535_10006092 266
134 3300003762 Ga0055542_1000052 Ga0055542_100005222 266
135 3300003773 Ga0055537_1013119 Ga0055537_10131192 266
136 3300003773 Ga0055537_1019850 Ga0055537_10198502 266
137 3300003781 Ga0055536_1015809 Ga0055536_10158092 266
138 3300003781 Ga0055536_1033187 Ga0055536_10331872 266
139 3300003784 Ga0055534_1006608 Ga0055534_10066083 266
140 3300003784 Ga0055534_1010613 Ga0055534_10106132 266
141 3300003790 Ga0055528_1027878 Ga0055528_10278782 266
142 3300003790 Ga0055528_1041134 Ga0055528_10411342 266
143 3300003791 Ga0055530_10000284 Ga0055530_100002842 266
144 3300003791 Ga0055530_10008410 Ga0055530_100084102 266
145 3300003792 Ga0055540_1008637 Ga0055540_10086372 266
146 3300003794 Ga0055531_10014167 Ga0055531_100141673 266
147 3300004625 Ga0055543_1005790 Ga0055543_10057903 266
148 3300004625 Ga0055543_1006004 Ga0055543_10060042 266
149 3300005262 Ga0065165_1011284 Ga0065165_10112843 266
150 3300005334 Ga0068869_100068830 Ga0068869_1000688303 266
151 3300005334 Ga0068869_100151435 Ga0068869_1001514352 266
152 3300005347 Ga0070668_100362217 Ga0070668_1003622171 266
153 3300005366 Ga0070659_100281409 Ga0070659_1002814092 266
154 3300005441 Ga0070700_100057696 Ga0070700_1000576962 266
155 3300005457 Ga0070662_100104891 Ga0070662_1001048912 266
156 3300005459 Ga0068867_100006697 Ga0068867_1000066976 266
157 3300005539 Ga0068853_100250928 Ga0068853_1002509282 266
158 3300005539 Ga0068853_100403574 Ga0068853_1004035742 266
159 3300005564 Ga0070664_100033460 Ga0070664_1000334604 266
160 3300005577 Ga0068857_100257080 Ga0068857_1002570802 266
161 3300005578 Ga0068854_100298960 Ga0068854_1002989602 266
162 3300005616 Ga0068852_100038538 Ga0068852_1000385382 266
163 3300005718 Ga0068866_10064249 Ga0068866_100642492 266
164 3300005719 Ga0068861_100006546 Ga0068861_1000065468 266
165 3300005834 Ga0068851_10002279 Ga0068851_100022797 266
166 3300005841 Ga0068863_100214435 Ga0068863_1002144353 266
167 3300005843 Ga0068860_100006423 Ga0068860_10000642311 266
168 3300005844 Ga0068862_100031390 Ga0068862_1000313902 266
169 3300006051 Ga0075364_10035996 Ga0075364_100359962 266
170 3300006051 Ga0075364_10096092 Ga0075364_100960922 266
171 3300006237 Ga0097621_100150006 Ga0097621_1001500062 266
172 3300006353 Ga0075370_10020958 Ga0075370_100209583 266
173 3300006881 Ga0068865_100003868 Ga0068865_1000038689 266
174 3300009036 Ga0105244_10049016 Ga0105244_100490162 266
175 3300009098 Ga0105245_10275140 Ga0105245_102751402 266
176 3300009148 Ga0105243_10144422 Ga0105243_101444222 266
177 3300009176 Ga0105242_10319896 Ga0105242_103198962 266
178 3300009551 Ga0105238_10140908 Ga0105238_101409082 266
179 3300009553 Ga0105249_10085815 Ga0105249_100858153 266
180 3300011119 Ga0105246_10133609 Ga0105246_101336092 266
181 3300013102 Ga0157371_10013712 Ga0157371_100137123 266
182 3300013105 Ga0157369_10611329 Ga0157369_106113292 266
183 3300013297 Ga0157378_10035276 Ga0157378_100352763 266
184 3300013306 Ga0163162_10019015 Ga0163162_100190157 266
185 3300013308 Ga0157375_10287371 Ga0157375_102873712 266
186 3300014326 Ga0157380_10019050 Ga0157380_100190503 266
187 3300014497 Ga0182008_10003409 Ga0182008_100034093 266
188 3300014497 Ga0182008_10004852 Ga0182008_100048526 266
189 3300014497 Ga0182008_10012709 Ga0182008_100127093 266
190 3300014968 Ga0157379_10053392 Ga0157379_100533923 266
191 3300015261 Ga0182006_1077111 Ga0182006_10771112 266
192 3300015262 Ga0182007_10001590 Ga0182007_100015903 266
193 3300015262 Ga0182007_10002372 Ga0182007_100023722 266
194 3300015265 Ga0182005_1050452 Ga0182005_10504521 266
195 3300017792 Ga0163161_10000180 Ga0163161_1000018017 266
196 3300017792 Ga0163161_10005252 Ga0163161_100052523 266
197 3300021361 Ga0213872_10028812 Ga0213872_100288122 266
198 3300025208 Ga0209436_107120 Ga0209436_1071202 266
199 3300025229 Ga0209147_102622 Ga0209147_1026223 266
200 3300025242 Ga0209258_100009 Ga0209258_100009143 266
201 3300025245 Ga0207425_1000294 Ga0207425_10002949 266
202 3300025254 Ga0209148_1000007 Ga0209148_1000007143 266
203 3300025258 Ga0209129_1000083 Ga0209129_100008327 266
204 3300025258 Ga0209129_1005578 Ga0209129_10055783 266
205 3300025258 Ga0209129_1006898 Ga0209129_10068983 266
206 3300025263 Ga0209565_1000194 Ga0209565_100019444 266
207 3300025263 Ga0209565_1000614 Ga0209565_100061410 266
208 3300025273 Ga0209673_1000089 Ga0209673_100008946 266
209 3300025273 Ga0209673_1000412 Ga0209673_100041227 266
210 3300025273 Ga0209673_1002306 Ga0209673_10023063 266
211 3300025284 Ga0209130_1002627 Ga0209130_10026278 266
212 3300025284 Ga0209130_1010715 Ga0209130_10107153 266
213 3300025291 Ga0209675_1000304 Ga0209675_100030426 266
214 3300025291 Ga0209675_1008266 Ga0209675_10082662 266
215 3300025292 Ga0209676_1000004 Ga0209676_1000004370 266
216 3300025292 Ga0209676_1000206 Ga0209676_100020669 266
217 3300025292 Ga0209676_1054600 Ga0209676_10546002 266
218 3300025294 Ga0209025_1000155 Ga0209025_100015566 266
219 3300025294 Ga0209025_1000492 Ga0209025_100049227 266
220 3300025294 Ga0209025_1007214 Ga0209025_10072144 266
221 3300025295 Ga0209564_1000244 Ga0209564_1000244102 266
222 3300025295 Ga0209564_1000314 Ga0209564_100031448 266
223 3300025297 Ga0209758_1000132 Ga0209758_100013227 266
224 3300025298 Ga0209050_1000002 Ga0209050_1000002880 266
225 3300025298 Ga0209050_1000766 Ga0209050_100076641 266
226 3300025299 Ga0209256_1000192 Ga0209256_100019227 266
227 3300025299 Ga0209256_1000251 Ga0209256_100025148 266
228 3300025302 Ga0207426_1000095 Ga0207426_1000095218 266
229 3300025302 Ga0207426_1000385 Ga0207426_100038527 266
230 3300025303 Ga0209051_1000002 Ga0209051_1000002649 266
231 3300025303 Ga0209051_1000216 Ga0209051_100021683 266
232 3300025303 Ga0209051_1000443 Ga0209051_10004432 266
233 3300025304 Ga0209257_1000002 Ga0209257_1000002790 266
234 3300025304 Ga0209257_1000312 Ga0209257_100031267 266
235 3300025304 Ga0209257_1018970 Ga0209257_10189702 266
236 3300025728 Ga0207655_1033338 Ga0207655_10333383 266
237 3300025899 Ga0207642_10279835 Ga0207642_102798351 266
238 3300025924 Ga0207694_10285324 Ga0207694_102853242 266
239 3300025927 Ga0207687_10125599 Ga0207687_101255992 266
240 3300025933 Ga0207706_10028313 Ga0207706_100283132 266
241 3300025934 Ga0207686_10219989 Ga0207686_102199892 266
242 3300025935 Ga0207709_10009102 Ga0207709_100091022 266
243 3300025938 Ga0207704_10083771 Ga0207704_100837712 266
244 3300025942 Ga0207689_10041454 Ga0207689_100414545 266
245 3300025942 Ga0207689_10084831 Ga0207689_100848312 266
246 3300025945 Ga0207679_10049083 Ga0207679_100490833 266
247 3300025972 Ga0207668_10044481 Ga0207668_100444813 266
248 3300025981 Ga0207640_10145430 Ga0207640_101454302 266
249 3300026041 Ga0207639_10283974 Ga0207639_102839742 266
250 3300026067 Ga0207678_10166928 Ga0207678_101669282 266
251 3300026088 Ga0207641_10104324 Ga0207641_101043243 266
252 3300026089 Ga0207648_10001269 Ga0207648_100012696 266
253 3300026116 Ga0207674_10057095 Ga0207674_100570952 266
254 3300026118 Ga0207675_100008466 Ga0207675_1000084666 266
255 3300026142 Ga0207698_10153172 Ga0207698_101531722 266
256 3300028381 Ga0268264_10013207 Ga0268264_100132075 266
257 3300028573 Ga0265334_10030933 Ga0265334_100309332 266
258 3300029957 Ga0265324_10012502 Ga0265324_100125023 266
259 3300030745 Ga0316182_1173201 Ga0316182_11732014 266
260 3300031235 Ga0265330_10000334 Ga0265330_1000033422 266
261 3300031238 Ga0265332_10000011 Ga0265332_10000011246 266
262 3300031241 Ga0265325_10017635 Ga0265325_100176352 266
263 3300031711 Ga0265314_10000026 Ga0265314_1000002622 266
264 3300032005 Ga0307411_10059187 Ga0307411_100591873 266
265 3300039447 Ga0436361_0720340 Ga0436361_0720340_1329_2165 266
266 3300046515 Ga0495620_0040688 Ga0495620_0040688_1084_1902 266
267 3300046520 Ga0495637_0020142 Ga0495637_0020142_172_990 266
268 3300046530 Ga0495654_0002079 Ga0495654_0002079_1037_1891 266
269 3300046683 Ga0495658_0011434 Ga0495658_0011434_3471_4283 266
270 3300046690 Ga0495624_0248081 Ga0495624_0248081_93_911 266
271 3300046691 Ga0495670_0005352 Ga0495670_0005352_3884_4702 266
272 3300046810 Ga0495660_0125811 Ga0495660_0125811_308_1126 266
273 3300047321 Ga0495676_0020510 Ga0495676_0020510_3767_4579 266
274 3300048088 Ga0495602_0084623 Ga0495602_0084623_932_1744 266
275 3300048089 Ga0495614_0000442 Ga0495614_0000442_13109_13921 266
276 3300048904 Ga0496101_0024252 Ga0496101_0024252_478_1290 266
277 3300048905 Ga0496102_0217932 Ga0496102_0217932_799_1599 266
278 3300048906 Ga0496103_0128903 Ga0496103_0128903_350_1150 266
279 3300048920 Ga0496117_0124942 Ga0496117_0124942_556_1356 266
280 3300048921 Ga0496118_0016834 Ga0496118_0016834_4441_5241 266
281 3300048921 Ga0496118_0063615 Ga0496118_0063615_1516_2316 266
282 3300048924 Ga0496121_0203671 Ga0496121_0203671_403_1203 266
283 3300048925 Ga0496122_0000985 Ga0496122_0000985_24245_25060 266
284 3300048926 Ga0496123_0000176 Ga0496123_0000176_8487_9302 266
285 3300048927 Ga0496124_0075214 Ga0496124_0075214_174_974 266
286 3300048927 Ga0496124_0159970 Ga0496124_0159970_222_1022 266
287 3300048928 Ga0496125_0119035 Ga0496125_0119035_231_1031 266
288 3300050491 nmdc:mga00v17_44611_c1 nmdc:mga00v17_44611_c1_1538_2353 266
289 3300050494 nmdc:mga06z11_235010_c1 nmdc:mga06z11_235010_c1_105_905 266
290 3300053079 Ga0500610_0000322 Ga0500610_0000322_2517_3335 266
291 3300053093 Ga0500651_0000059 Ga0500651_0000059_31521_32333 266
292 3300053094 Ga0500566_0207836 Ga0500566_0207836_10_822 266
293 3300053110 Ga0500571_001325 Ga0500571_001325_3129_3941 266
294 3300053120 Ga0500597_112023 Ga0500597_112023_41_853 266
295 3300053121 Ga0500607_000736 Ga0500607_000736_19296_20114 266
296 3300053122 Ga0500608_080411 Ga0500608_080411_247_1059 266
297 3300053134 Ga0500658_0000220 Ga0500658_0000220_26100_26912 266
298 3300053136 Ga0500559_0005390 Ga0500559_0005390_4718_5524 266
299 3300053136 Ga0500559_0106820 Ga0500559_0106820_250_1056 266
300 3300053137 Ga0500561_0062079 Ga0500561_0062079_155_967 266
301 3300053140 Ga0500573_0028086 Ga0500573_0028086_2131_2937 266
302 3300053156 Ga0500622_0092015 Ga0500622_0092015_458_1264 266
303 3300053158 Ga0500627_0001872 Ga0500627_0001872_565_1383 266
304 3300053161 Ga0500634_0001742 Ga0500634_0001742_7655_8473 266
305 iso_pu_bacteria 2928115317 2928120853 266
306 3300001989 JGI24739J22299_10032542 JGI24739J22299_100325422 267
307 3300003773 Ga0055537_1000050 Ga0055537_100005025 267
308 3300003784 Ga0055534_1000035 Ga0055534_100003553 267
309 3300003790 Ga0055528_1000484 Ga0055528_10004848 267
310 3300003792 Ga0055540_1000656 Ga0055540_10006562 267
311 3300005288 Ga0065714_10074537 Ga0065714_100745373 267
312 3300005288 Ga0065714_10132422 Ga0065714_101324221 267
313 3300005334 Ga0068869_100130078 Ga0068869_1001300782 267
314 3300005347 Ga0070668_100481222 Ga0070668_1004812221 267
315 3300005456 Ga0070678_100620567 Ga0070678_1006205671 267
316 3300005459 Ga0068867_100183500 Ga0068867_1001835002 267
317 3300005548 Ga0070665_100024038 Ga0070665_1000240383 267
318 3300005548 Ga0070665_100406476 Ga0070665_1004064762 267
319 3300006038 Ga0075365_10041689 Ga0075365_100416893 267
320 3300006048 Ga0075363_100191238 Ga0075363_1001912382 267
321 3300006051 Ga0075364_10012436 Ga0075364_100124366 267
322 3300006058 Ga0075432_10009536 Ga0075432_100095364 267
323 3300006177 Ga0075362_10075454 Ga0075362_100754542 267
324 3300006178 Ga0075367_10240541 Ga0075367_102405412 267
325 3300006178 Ga0075367_10273767 Ga0075367_102737671 267
326 3300006195 Ga0075366_10078347 Ga0075366_100783472 267
327 3300006353 Ga0075370_10000344 Ga0075370_1000034414 267
328 3300006353 Ga0075370_10053591 Ga0075370_100535913 267
329 3300006353 Ga0075370_10067168 Ga0075370_100671682 267
330 3300006948 Ga0099826_10000128 Ga0099826_1000012810 267
331 3300009148 Ga0105243_10306298 Ga0105243_103062982 267
332 3300011119 Ga0105246_10147146 Ga0105246_101471462 267
333 3300013100 Ga0157373_10029689 Ga0157373_100296893 267
334 3300013306 Ga0163162_10033248 Ga0163162_100332483 267
335 3300014497 Ga0182008_10021593 Ga0182008_100215932 267
336 3300015683 Ga0183362_10001 Ga0183362_100011839 267
337 3300025263 Ga0209565_1000115 Ga0209565_100011555 267
338 3300025273 Ga0209673_1000751 Ga0209673_100075118 267
339 3300025273 Ga0209673_1015799 Ga0209673_10157992 267
340 3300025291 Ga0209675_1000110 Ga0209675_100011055 267
341 3300025292 Ga0209676_1018209 Ga0209676_10182092 267
342 3300025295 Ga0209564_1047373 Ga0209564_10473732 267
343 3300025303 Ga0209051_1000113 Ga0209051_100011395 267
344 3300025940 Ga0207691_10487186 Ga0207691_104871861 267
345 3300027111 Ga0209281_1017292 Ga0209281_10172922 267
346 3300027666 Ga0209282_1000191 Ga0209282_100019115 267
347 3300028379 Ga0268266_10120265 Ga0268266_101202652 267
348 3300028794 Ga0307515_10001137 Ga0307515_1000113710 267
349 3300030731 Ga0316177_1138627 Ga0316177_11386272 267
350 3300030732 Ga0316176_1145617 Ga0316176_11456171 267
351 3300030733 Ga0314311_1035404 Ga0314311_10354043 267
352 3300030742 Ga0316183_1062795 Ga0316183_10627953 267
353 3300030745 Ga0316182_1073729 Ga0316182_10737291 267
354 3300031251 Ga0265327_10001170 Ga0265327_100011703 267
355 3300031251 Ga0265327_10017387 Ga0265327_100173873 267
356 3300031548 Ga0307408_100003976 Ga0307408_1000039767 267
357 3300031548 Ga0307408_100324246 Ga0307408_1003242462 267
358 3300031731 Ga0307405_10191230 Ga0307405_101912302 267
359 3300031824 Ga0307413_10043354 Ga0307413_100433542 267
360 3300031901 Ga0307406_10016059 Ga0307406_100160593 267
361 3300031911 Ga0307412_10003874 Ga0307412_100038747 267
362 3300031995 Ga0307409_100105897 Ga0307409_1001058972 267
363 3300032004 Ga0307414_10056219 Ga0307414_100562193 267
364 3300041404 Ga0439436_0050471 Ga0439436_0050471_289_1098 267
365 3300041411 Ga0439466_0036688 Ga0439466_0036688_352_1161 267
366 3300041413 Ga0439465_0007894 Ga0439465_0007894_2179_2988 267
367 3300041451 Ga0451791_0705228 Ga0451791_0705228_277_1092 267
368 3300041460 Ga0451802_0549080 Ga0451802_0549080_66_884 267
369 3300041491 Ga0451833_0670342 Ga0451833_0670342_105_908 267
370 3300042002 Ga0439442_002191 Ga0439442_002191_86_895 267
371 3300042123 Ga0450921_001457 Ga0450921_001457_537_1346 267
372 3300042145 Ga0450906_022228 Ga0450906_022228_156_965 267
373 3300042184 Ga0450908_001932 Ga0450908_001932_2052_2861 267
374 3300042876 Ga0451577_0006402 Ga0451577_0006402_10788_11615 267
375 3300044673 Ga0453683_0001872 Ga0453683_0001872_16015_16842 267
376 3300044712 Ga0453684_0031950 Ga0453684_0031950_692_1519 267
377 3300045051 Ga0451576_0072801 Ga0451576_0072801_447_1274 267
378 3300046543 Ga0495645_0236899 Ga0495645_0236899_104_910 267
379 3300046615 Ga0495656_0000078 Ga0495656_0000078_31579_32385 267
380 3300046660 Ga0495625_0000057 Ga0495625_0000057_78031_78834 267
381 3300048088 Ga0495602_0190574 Ga0495602_0190574_407_1297 267
382 3300048905 Ga0496102_0030377 Ga0496102_0030377_1512_2318 267
383 3300048913 Ga0496110_0162838 Ga0496110_0162838_462_1268 267
384 3300048927 Ga0496124_0070042 Ga0496124_0070042_17_838 267
385 3300049759 Ga0501262_000768 Ga0501262_000768_2108_2917 267
386 3300050489 nmdc:mga03683_84302_c1 nmdc:mga03683_84302_c1_403_1212 267
387 3300050489 nmdc:mga03683_87672_c1 nmdc:mga03683_87672_c1_279_1082 267
388 3300050490 nmdc:mga03n38_50909_c1 nmdc:mga03n38_50909_c1_305_1114 267
389 3300050491 nmdc:mga00v17_225427_c1 nmdc:mga00v17_225427_c1_155_964 267
390 3300050491 nmdc:mga00v17_280039_c1 nmdc:mga00v17_280039_c1_237_1040 267
391 3300050493 nmdc:mga0k408_90715_c1 nmdc:mga0k408_90715_c1_331_1134 267
392 3300050494 nmdc:mga06z11_198753_c1 nmdc:mga06z11_198753_c1_262_1065 267
393 3300050496 nmdc:mga07m45_285_c1 nmdc:mga07m45_285_c1_17045_17854 267
394 3300050496 nmdc:mga07m45_70030_c1 nmdc:mga07m45_70030_c1_982_1791 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

20

169

0.81

PF12146

Hydrolase_4

Serine aminopeptidase, S33

3

163

0.81

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

3

188

0.7

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

5

286

0.49

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k5q-assembly1.cif.gz_A crystal structure of calb mutant dglm from candida antarctica 0.7662 2 100
4k6k-assembly1.cif.gz_A crystal structure of calb mutant d223g from candida antarctica 0.7615 2 100
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.758 2 263
2y6v-assembly1.cif.gz_A peroxisomal alpha-beta-hydrolase lpx1 (yor084w) from saccharomyces cerevisiae (crystal form i) 0.7486 3 266
2y6v-assembly1.cif.gz_B peroxisomal alpha-beta-hydrolase lpx1 (yor084w) from saccharomyces cerevisiae (crystal form i) 0.7436 3 267
ID Description Score Start End Superfamily
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7932 2 99 3.40.50.1820
3kxpG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7824 3 263 3.40.50.1820
af_Q9FN84_30_307_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.772 1 109 3.40.50.1820
af_Q59LU6_1_344_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7646 3 262 3.40.50.1820
af_Q19462_39_266_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7638 1 102 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1N6XFL3-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9934 21 265
AF-A0A1N6XFL3-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9815 21 265
AF-A0A2H4I8A5-F1-model_v4 Alpha/beta hydrolase family 0.9737 98 263
AF-A0A096FIM3-F1-model_v4 Alpha/beta hydrolase 0.9694 3 266 GO:0016020
GO:0016787
AF-A0A2M6VHU9-F1-model_v4 Alpha/beta hydrolase 0.9691 2 267 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.6 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map