F432908

General Info

Members Datasets Scaffolds Average Seq Length
394 177 392 163

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10068048|Ga0207695_100680482
Length 179
Sequence VRQVAGCVRKAARVAPMPLSANQRRTLLGHPAGWIATGFGSGLSPVAPGTAGSLAALLPWLALRELPLSGYALAVAAAFALGVWACGWVVAALRLEDPGAAVWDEFVGLWIALAPLLPHASGWPWVAAGFILFRIFDIWKPWPVSWADRRVGGGFGVMLDDVLAGIYAALLLGLLLRWQ

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
119 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
120 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
121 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
122 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
123 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.51
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0
Rhizoplane 3.05
Rhizosphere 89.85
Stem 0
Stem Tuber 0
Unclassified 4.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1028662 3300003214 Bacteria 719
2 Ga0070658_10067073 3300005327 Bacteria 2932
3 Ga0070658_10411700 3300005327 Bacteria 1162
4 Ga0070676_10034479 3300005328 Bacteria 2907
5 Ga0070676_10271780 3300005328 Bacteria 1139
6 Ga0070676_10529041 3300005328 Unclassified 841
7 Ga0070676_10560477 3300005328 Bacteria 819
8 Ga0070683_100275779 3300005329 Bacteria 1600
9 Ga0070690_100075575 3300005330 Bacteria 2196
10 Ga0070690_100101101 3300005330 Bacteria 1912
11 Ga0068869_100017096 3300005334 Bacteria 4909
12 Ga0068869_100446211 3300005334 Bacteria 1072
13 Ga0070666_10321660 3300005335 Bacteria 1104
14 Ga0070666_10477921 3300005335 Bacteria 902
15 Ga0068868_100028729 3300005338 Bacteria 4255
16 Ga0068868_100537861 3300005338 Bacteria 1028
17 Ga0068868_101360549 3300005338 Bacteria 661
18 Ga0070668_100620468 3300005347 Bacteria 948
19 Ga0070668_100960725 3300005347 Bacteria 766
20 Ga0070668_101140476 3300005347 Archaea 705
21 Ga0070669_100011125 3300005353 Bacteria 6387
22 Ga0070675_100019138 3300005354 Bacteria 5454
23 Ga0070671_100148860 3300005355 Bacteria 1976
24 Ga0070671_100386778 3300005355 Unclassified 1196
25 Ga0070674_101106537 3300005356 Bacteria 700
26 Ga0070673_100110803 3300005364 Bacteria 2276
27 Ga0070673_100219911 3300005364 Bacteria 1643
28 Ga0070673_100314647 3300005364 Unclassified 1382
29 Ga0070688_100362450 3300005365 Bacteria 1064
30 Ga0070667_100029970 3300005367 Bacteria 4538
31 Ga0070667_100060896 3300005367 Bacteria 3195
32 Ga0070667_100146783 3300005367 Bacteria 2069
33 Ga0070667_100419611 3300005367 Unclassified 1220
34 Ga0070663_100777936 3300005455 Bacteria 819
35 Ga0070678_100384736 3300005456 Bacteria 1215
36 Ga0070662_100530112 3300005457 Bacteria 985
37 Ga0070681_10000827 3300005458 Bacteria 25852
38 Ga0070681_10051428 3300005458 Bacteria 4109
39 Ga0070681_10184126 3300005458 Bacteria 2009
40 Ga0070681_10563075 3300005458 Bacteria 1053
41 Ga0068867_100110505 3300005459 Bacteria 2112
42 Ga0068867_100246680 3300005459 Bacteria 1451
43 Ga0068867_100300517 3300005459 Bacteria 1323
44 Ga0070685_10291872 3300005466 Bacteria 1096
45 Ga0070679_100163509 3300005530 Bacteria 2200
46 Ga0070679_100419037 3300005530 Bacteria 1284
47 Ga0070679_100500564 3300005530 Bacteria 1159
48 Ga0070679_100569722 3300005530 Bacteria 1076
49 Ga0068853_100016385 3300005539 Bacteria 6099
50 Ga0068853_100046040 3300005539 Bacteria 3739
51 Ga0068853_100141705 3300005539 Bacteria 2158
52 Ga0068853_100295307 3300005539 Bacteria 1496
53 Ga0068853_100438438 3300005539 Bacteria 1227
54 Ga0068853_100503451 3300005539 Bacteria 1144
55 Ga0068853_100551735 3300005539 Bacteria 1092
56 Ga0068853_100674306 3300005539 Bacteria 985
57 Ga0070672_100504789 3300005543 Bacteria 1047
58 Ga0070672_100754454 3300005543 Bacteria 854
59 Ga0070665_100027998 3300005548 Bacteria 5676
60 Ga0070665_100052873 3300005548 Bacteria 4073
61 Ga0070665_100054782 3300005548 Bacteria 3999
62 Ga0070665_100056191 3300005548 Bacteria 3947
63 Ga0070665_100078432 3300005548 Bacteria 3309
64 Ga0070665_100142782 3300005548 Bacteria 2397
65 Ga0070665_100282763 3300005548 Bacteria 1661
66 Ga0070665_100584532 3300005548 Bacteria 1130
67 Ga0068855_100187743 3300005563 Bacteria 2333
68 Ga0068855_100237593 3300005563 Bacteria 2037
69 Ga0068855_100322660 3300005563 Bacteria 1707
70 Ga0070664_101111334 3300005564 Bacteria 745
71 Ga0068857_100165728 3300005577 Bacteria 2007
72 Ga0068857_100828113 3300005577 Bacteria 885
73 Ga0068856_100488333 3300005614 Bacteria 1252
74 Ga0068856_100820501 3300005614 Bacteria 949
75 Ga0068852_100003822 3300005616 Bacteria 10577
76 Ga0068852_100348483 3300005616 Bacteria 1445
77 Ga0068852_101318785 3300005616 Bacteria 744
78 Ga0068859_100011964 3300005617 Bacteria 8716
79 Ga0068859_100210703 3300005617 Bacteria 2029
80 Ga0068859_100294107 3300005617 Bacteria 1717
81 Ga0068859_100506628 3300005617 Bacteria 1302
82 Ga0068861_100408177 3300005719 Unclassified 1207
83 Ga0068851_10198389 3300005834 Bacteria 1119
84 Ga0068851_10224025 3300005834 Unclassified 1058
85 Ga0068870_10026205 3300005840 Bacteria 2905
86 Ga0068863_100104067 3300005841 Bacteria 2700
87 Ga0068863_100311238 3300005841 Bacteria 1529
88 Ga0068863_100467090 3300005841 Bacteria 1240
89 Ga0068858_100058548 3300005842 Bacteria 3562
90 Ga0068858_100730600 3300005842 Bacteria 964
91 Ga0068858_101369535 3300005842 Bacteria 697
92 Ga0068860_100116032 3300005843 Bacteria 2561
93 Ga0068860_100553817 3300005843 Bacteria 1152
94 Ga0068860_101185843 3300005843 Bacteria 784
95 Ga0068862_100000355 3300005844 Bacteria 49697
96 Ga0068862_100336568 3300005844 Bacteria 1397
97 Ga0081540_1008619 3300005983 Bacteria 7106
98 Ga0097621_100022549 3300006237 Unclassified 4888
99 Ga0097621_100115545 3300006237 Bacteria 2271
100 Ga0097621_100179809 3300006237 Bacteria 1827
101 Ga0097621_100492053 3300006237 Bacteria 1110
102 Ga0068871_100310814 3300006358 Bacteria 1385
103 Ga0068871_100460375 3300006358 Bacteria 1141
104 Ga0068865_100020929 3300006881 Bacteria 4248
105 Ga0068865_100034699 3300006881 Bacteria 3387
106 Ga0068865_100243586 3300006881 Bacteria 1416
107 Ga0068865_100650166 3300006881 Bacteria 896
108 Ga0068865_101043829 3300006881 Bacteria 717
109 Ga0097620_100011964 3300006931 Bacteria 8716
110 Ga0097620_100210711 3300006931 Bacteria 2029
111 Ga0097620_100294086 3300006931 Bacteria 1717
112 Ga0097620_100506585 3300006931 Bacteria 1302
113 Ga0105240_10130083 3300009093 Bacteria 3020
114 Ga0105240_10404168 3300009093 Bacteria 1538
115 Ga0105240_10443544 3300009093 Bacteria 1454
116 Ga0105245_10410118 3300009098 Bacteria 1356
117 Ga0105247_10106458 3300009101 Bacteria 1799
118 Ga0105242_10399768 3300009176 Bacteria 1282
119 Ga0105242_11006410 3300009176 Bacteria 841
120 Ga0105242_11192363 3300009176 Bacteria 780
121 Ga0105242_11777972 3300009176 Bacteria 654
122 Ga0105248_10125596 3300009177 Bacteria 2894
123 Ga0105248_10150362 3300009177 Bacteria 2627
124 Ga0105237_10058007 3300009545 Bacteria 3874
125 Ga0105237_10342159 3300009545 Bacteria 1500
126 Ga0105237_10585238 3300009545 Bacteria 1123
127 Ga0105249_10000084 3300009553 Bacteria 134869
128 Ga0105249_10038177 3300009553 Bacteria 4357
129 Ga0105239_10004920 3300010375 Bacteria 15793
130 Ga0105239_10050230 3300010375 Bacteria 4575
131 Ga0105239_10103831 3300010375 Bacteria 3146
132 Ga0105239_10107408 3300010375 Bacteria 3092
133 Ga0105239_10451675 3300010375 Bacteria 1458
134 Ga0157370_10088936 3300013104 Bacteria 2901
135 Ga0157370_10715709 3300013104 Bacteria 913
136 Ga0157370_10907313 3300013104 Bacteria 799
137 Ga0157369_10000001 3300013105 Bacteria 554908
138 Ga0157369_10954919 3300013105 Bacteria 878
139 Ga0157374_10029173 3300013296 Bacteria 4992
140 Ga0157374_10220035 3300013296 Bacteria 1863
141 Ga0157374_10479341 3300013296 Bacteria 1247
142 Ga0157378_10000475 3300013297 Bacteria 38166
143 Ga0157378_10236666 3300013297 Bacteria 1743
144 Ga0157378_10556240 3300013297 Bacteria 1153
145 Ga0157378_11112108 3300013297 Bacteria 827
146 Ga0163162_10000017 3300013306 Bacteria 233474
147 Ga0163162_10126666 3300013306 Bacteria 2661
148 Ga0163162_10147599 3300013306 Bacteria 2468
149 Ga0163162_10180752 3300013306 Bacteria 2235
150 Ga0163162_11110255 3300013306 Unclassified 896
151 Ga0157372_10169396 3300013307 Unclassified 2526
152 Ga0157372_10832477 3300013307 Bacteria 1072
153 Ga0157375_10019086 3300013308 Bacteria 6227
154 Ga0157375_10037087 3300013308 Bacteria 4668
155 Ga0157375_10848909 3300013308 Bacteria 1060
156 Ga0157375_10879487 3300013308 Unclassified 1041
157 Ga0163163_10307802 3300014325 Bacteria 1637
158 Ga0182008_10064311 3300014497 Bacteria 1806
159 Ga0182008_10398758 3300014497 Bacteria 739
160 Ga0157379_10118724 3300014968 Bacteria 2379
161 Ga0157379_10230115 3300014968 Unclassified 1680
162 Ga0157376_10006564 3300014969 Bacteria 8233
163 Ga0157376_10030153 3300014969 Bacteria 4327
164 Ga0157376_10425968 3300014969 Bacteria 1289
165 Ga0157376_10489429 3300014969 Bacteria 1207
166 Ga0157376_11472405 3300014969 Bacteria 713
167 Ga0163161_10040787 3300017792 Bacteria 3334
168 Ga0206356_11062190 3300020070 Bacteria 947
169 Ga0206353_10884708 3300020082 Bacteria 913
170 Ga0209233_1009632 3300025261 Bacteria 2933
171 Ga0209673_1067645 3300025273 Bacteria 864
172 Ga0207656_10129633 3300025321 Bacteria 1180
173 Ga0207680_10069818 3300025903 Bacteria 2172
174 Ga0207680_10110990 3300025903 Bacteria 1778
175 Ga0207680_10244823 3300025903 Unclassified 1237
176 Ga0207645_10070471 3300025907 Bacteria 2236
177 Ga0207654_10446269 3300025911 Bacteria 906
178 Ga0207654_10536968 3300025911 Bacteria 829
179 Ga0207707_10000075 3300025912 Bacteria 101459
180 Ga0207707_10730634 3300025912 Bacteria 829
181 Ga0207695_10068048 3300025913 Bacteria 3650
182 Ga0207671_10007138 3300025914 Bacteria 9746
183 Ga0207671_10279533 3300025914 Bacteria 1316
184 Ga0207671_10295860 3300025914 Bacteria 1278
185 Ga0207671_10713749 3300025914 Bacteria 797
186 Ga0207660_10075549 3300025917 Bacteria 2462
187 Ga0207649_10444206 3300025920 Bacteria 978
188 Ga0207652_10135299 3300025921 Bacteria 2201
189 Ga0207652_10471464 3300025921 Bacteria 1131
190 Ga0207652_10663407 3300025921 Bacteria 932
191 Ga0207681_10060885 3300025923 Bacteria 2593
192 Ga0207694_10276712 3300025924 Bacteria 1378
193 Ga0207694_10307326 3300025924 Bacteria 1306
194 Ga0207650_11150720 3300025925 Bacteria 660
195 Ga0207687_10142203 3300025927 Bacteria 1821
196 Ga0207644_10412497 3300025931 Unclassified 1105
197 Ga0207644_10613644 3300025931 Unclassified 904
198 Ga0207706_10790030 3300025933 Bacteria 807
199 Ga0207686_10072598 3300025934 Bacteria 2218
200 Ga0207704_10041977 3300025938 Bacteria 2688
201 Ga0207704_10070128 3300025938 Bacteria 2218
202 Ga0207704_10910076 3300025938 Bacteria 740
203 Ga0207691_10181212 3300025940 Bacteria 1841
204 Ga0207691_10298958 3300025940 Bacteria 1383
205 Ga0207691_10635962 3300025940 Bacteria 902
206 Ga0207711_10153233 3300025941 Bacteria 2081
207 Ga0207711_10739284 3300025941 Unclassified 917
208 Ga0207689_10330463 3300025942 Bacteria 1266
209 Ga0207667_10016160 3300025949 Bacteria 8439
210 Ga0207667_10161554 3300025949 Bacteria 2304
211 Ga0207667_10230144 3300025949 Bacteria 1898
212 Ga0207667_10405098 3300025949 Bacteria 1389
213 Ga0207651_10132634 3300025960 Bacteria 1910
214 Ga0207651_10165650 3300025960 Bacteria 1738
215 Ga0207712_10041733 3300025961 Bacteria 3154
216 Ga0207668_10043032 3300025972 Bacteria 3061
217 Ga0207668_11239940 3300025972 Archaea 671
218 Ga0207668_11927793 3300025972 Bacteria 533
219 Ga0207640_10332769 3300025981 Unclassified 1213
220 Ga0207640_10569719 3300025981 Bacteria 954
221 Ga0207658_10023690 3300025986 Bacteria 4288
222 Ga0207658_10086476 3300025986 Bacteria 2418
223 Ga0207658_10159033 3300025986 Bacteria 1850
224 Ga0207658_10232302 3300025986 Bacteria 1558
225 Ga0207658_10294041 3300025986 Bacteria 1397
226 Ga0207658_10341621 3300025986 Bacteria 1301
227 Ga0207658_10543026 3300025986 Unclassified 1039
228 Ga0207677_10077485 3300026023 Bacteria 2371
229 Ga0207677_10747523 3300026023 Bacteria 871
230 Ga0207639_10000176 3300026041 Bacteria 49992
231 Ga0207639_10007555 3300026041 Bacteria 7414
232 Ga0207639_10227950 3300026041 Bacteria 1613
233 Ga0207639_10230109 3300026041 Bacteria 1606
234 Ga0207639_10281998 3300026041 Bacteria 1461
235 Ga0207639_10361019 3300026041 Bacteria 1300
236 Ga0207639_10363940 3300026041 Bacteria 1295
237 Ga0207639_10381241 3300026041 Bacteria 1266
238 Ga0207639_11000349 3300026041 Bacteria 783
239 Ga0207639_11123613 3300026041 Bacteria 737
240 Ga0207678_10086814 3300026067 Bacteria 2673
241 Ga0207678_10940135 3300026067 Bacteria 765
242 Ga0207641_10035690 3300026088 Bacteria 4145
243 Ga0207641_10051194 3300026088 Bacteria 3498
244 Ga0207641_10152444 3300026088 Bacteria 2094
245 Ga0207641_10659856 3300026088 Bacteria 1028
246 Ga0207641_10826630 3300026088 Bacteria 917
247 Ga0207648_10073868 3300026089 Bacteria 2971
248 Ga0207648_10462768 3300026089 Bacteria 1156
249 Ga0207676_10089497 3300026095 Bacteria 2523
250 Ga0207674_10145061 3300026116 Bacteria 2332
251 Ga0207674_10353405 3300026116 Bacteria 1421
252 Ga0207675_100545956 3300026118 Unclassified 1158
253 Ga0207683_10008323 3300026121 Bacteria 8872
254 Ga0207698_10017962 3300026142 Bacteria 4809
255 Ga0207698_10177323 3300026142 Bacteria 1883
256 Ga0207698_10806124 3300026142 Bacteria 941
257 Ga0268266_10128009 3300028379 Bacteria 2268
258 Ga0268266_10162018 3300028379 Bacteria 2024
259 Ga0268266_10421544 3300028379 Bacteria 1265
260 Ga0268265_10000236 3300028380 Bacteria 63286
261 Ga0268264_10144377 3300028381 Bacteria 2126
262 Ga0268264_11080007 3300028381 Bacteria 811
263 Ga0307508_10062799 3300031616 Bacteria 3278
264 Ga0307508_10203752 3300031616 Bacteria 1579
265 Ga0307516_10047423 3300031730 Bacteria 4233
266 Ga0307516_10179698 3300031730 Bacteria 1850
267 Ga0307507_10428847 3300033179 Bacteria 739
268 Ga0373937_0417691 3300036401 Bacteria 1273
269 Ga0395899_0482420 3300037312 Bacteria 807
270 Ga0395900_0000060 3300037418 Bacteria 205509
271 Ga0395900_0005310 3300037418 Bacteria 13500
272 Ga0395900_0149594 3300037418 Bacteria 2386
273 Ga0395900_0310599 3300037418 Bacteria 1560
274 Ga0395905_0281344 3300037471 Bacteria 1550
275 Ga0395905_0555668 3300037471 Bacteria 1049
276 Ga0451787_295017 3300041441 Bacteria 751
277 Ga0451791_1047663 3300041451 Bacteria 933
278 Ga0451793_1133516 3300041452 Bacteria 5606
279 Ga0451793_1691990 3300041452 Bacteria 1401
280 Ga0451795_0015813 3300041456 Bacteria 841
281 Ga0451800_0655674 3300041459 Bacteria 2316
282 Ga0451802_0077970 3300041460 Bacteria 6860
283 Ga0451807_1421545 3300041486 Bacteria 6014
284 Ga0451807_2472610 3300041486 Bacteria 2598
285 Ga0451833_1413619 3300041491 Bacteria 720
286 Ga0451835_0625179 3300041492 Bacteria 785
287 Ga0451837_1208518 3300041494 Bacteria 596
288 Ga0451845_0405586 3300041501 Bacteria 693
289 Ga0451843_1196645 3300041509 Bacteria 1183
290 Ga0451853_1261072 3300041512 Bacteria 699
291 Ga0451853_1276493 3300041512 Bacteria 618
292 Ga0451853_2163128 3300041512 Bacteria 619
293 Ga0451577_0505352 3300042876 Bacteria 1097
294 Ga0453684_0000316 3300044712 Bacteria 204457
295 Ga0466959_0017172 3300045049 Bacteria 5299
296 Ga0451576_0000128 3300045051 Bacteria 192071
297 Ga0466958_0861077 3300045836 Bacteria 591
298 Ga0495653_0842311 3300046463 Unclassified 549
299 Ga0495622_0375691 3300046557 Bacteria 614
300 Ga0496100_0323710 3300048903 Bacteria 1159
301 Ga0496101_0259567 3300048904 Bacteria 1355
302 Ga0496115_0189147 3300048918 Bacteria 1701
303 Ga0496117_0004194 3300048920 Bacteria 16097
304 Ga0496117_0029156 3300048920 Bacteria 4259
305 Ga0496118_0001472 3300048921 Bacteria 35272
306 Ga0496118_0010512 3300048921 Bacteria 9159
307 Ga0496121_0335239 3300048924 Bacteria 1013
308 Ga0496126_0062906 3300048929 Bacteria 3328
309 Ga0501031_0138149 3300049568 Bacteria 1592
310 Ga0501031_0264849 3300049568 Bacteria 1116
311 Ga0501032_0003925 3300049569 Bacteria 11289
312 Ga0501032_0075349 3300049569 Unclassified 2247
313 Ga0501033_0007392 3300049570 Bacteria 8553
314 Ga0501033_0088366 3300049570 Unclassified 2267
315 Ga0501034_0152351 3300049571 Unclassified 2287
316 Ga0501034_0422619 3300049571 Bacteria 1253
317 Ga0501034_0462030 3300049571 Bacteria 1186
318 Ga0501034_0527191 3300049571 Bacteria 1092
319 Ga0501034_0601876 3300049571 Bacteria 1005
320 Ga0501036_0018039 3300049572 Bacteria 5907
321 Ga0501036_0043644 3300049572 Bacteria 3797
322 Ga0501037_0012728 3300049573 Bacteria 6197
323 Ga0501037_0075851 3300049573 Bacteria 2441
324 Ga0501037_0082213 3300049573 Bacteria 2334
325 Ga0501038_0003076 3300049574 Bacteria 15552
326 Ga0501038_0090857 3300049574 Unclassified 2558
327 Ga0501039_0005931 3300049575 Bacteria 9255
328 Ga0501042_0303631 3300049578 Bacteria 1153
329 Ga0501043_0010472 3300049579 Bacteria 7263
330 Ga0501043_0069047 3300049579 Bacteria 2775
331 Ga0501043_0131714 3300049579 Bacteria 1959
332 Ga0501043_0331654 3300049579 Bacteria 1158
333 Ga0501046_0003886 3300049580 Bacteria 13666
334 Ga0501046_0051059 3300049580 Bacteria 3265
335 Ga0501047_0234866 3300049581 Bacteria 1685
336 Ga0501047_0247359 3300049581 Bacteria 1632
337 Ga0501047_0552321 3300049581 Bacteria 976
338 Ga0501047_0725491 3300049581 Bacteria 810
339 Ga0501047_0876284 3300049581 Bacteria 711
340 Ga0501048_0042444 3300049582 Bacteria 3256
341 Ga0501067_0049500 3300049583 Bacteria 2328
342 Ga0501069_0013764 3300049585 Bacteria 4316
343 Ga0501069_0022289 3300049585 Bacteria 3443
344 Ga0501070_0052567 3300049586 Bacteria 3381
345 Ga0501070_0095553 3300049586 Bacteria 2459
346 Ga0501070_0449169 3300049586 Bacteria 1039
347 Ga0501070_0580031 3300049586 Bacteria 895
348 Ga0501070_0637885 3300049586 Bacteria 846
349 Ga0501071_0138832 3300049587 Bacteria 1809
350 Ga0501071_0143533 3300049587 Bacteria 1779
351 Ga0501073_0005524 3300049589 Bacteria 9467
352 Ga0501073_0040860 3300049589 Bacteria 3279
353 Ga0501073_0099732 3300049589 Bacteria 2016
354 Ga0501073_0166109 3300049589 Bacteria 1528
355 Ga0501073_0373150 3300049589 Bacteria 985
356 Ga0501073_0475336 3300049589 Bacteria 864
357 Ga0501074_0071012 3300049590 Bacteria 2503
358 Ga0501074_0241914 3300049590 Bacteria 1283
359 Ga0501074_0522734 3300049590 Bacteria 840
360 Ga0501076_0390092 3300049592 Bacteria 1145
361 Ga0501079_0023751 3300049741 Bacteria 4704
362 Ga0501079_0061390 3300049741 Bacteria 2899
363 Ga0501080_0008868 3300049742 Bacteria 9143
364 Ga0501080_0075006 3300049742 Bacteria 3146
365 Ga0501080_0097338 3300049742 Bacteria 2732
366 Ga0501080_0366532 3300049742 Bacteria 1299
367 Ga0501080_0440109 3300049742 Bacteria 1169
368 Ga0501083_0340323 3300049744 Bacteria 975
369 Ga0501083_0594226 3300049744 Bacteria 720
370 Ga0501035_0067961 3300049822 Bacteria 3160
371 Ga0501035_0112296 3300049822 Bacteria 2388
372 Ga0501035_0121077 3300049822 Unclassified 2287
373 Ga0501035_0210462 3300049822 Bacteria 1663
374 Ga0501035_0503541 3300049822 Bacteria 996
375 Ga0501044_0014368 3300049823 Bacteria 8550
376 Ga0501044_0045639 3300049823 Bacteria 4540
377 Ga0501044_0076742 3300049823 Bacteria 3390
378 Ga0501044_0110990 3300049823 Bacteria 2750
379 Ga0501044_0117119 3300049823 Unclassified 2668
380 Ga0501045_0192304 3300049824 Bacteria 1520
381 Ga0501045_0340489 3300049824 Unclassified 1116
382 Ga0500610_0005301 3300053079 Bacteria 5266
383 Ga0500651_0000352 3300053093 Bacteria 25798
384 Ga0500651_0020651 3300053093 Bacteria 4101
385 Ga0500559_0079596 3300053136 Bacteria 1488
386 Ga0500568_0001136 3300053139 Bacteria 17862
387 Ga0500636_0168269 3300053177 Bacteria 1188
388 Ga0501084_0397962 3300054114 Bacteria 1164
389 Ga0501082_0003116 3300060353 Bacteria 14452
390 Ga0501082_0525024 3300060353 Bacteria 1035
391 Ga0501082_0591915 3300060353 Bacteria 970
392 Ga0501082_0693163 3300060353 Bacteria 891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0149594 Ga0395900_0149594_1722_2225 127
2 3300037471 Ga0395905_0555668 Ga0395905_0555668_45_548 127
3 3300045836 Ga0466958_0861077 Ga0466958_0861077_70_573 135
4 3300026041 Ga0207639_11123613 Ga0207639_111236131 139
5 3300005367 Ga0070667_100029970 Ga0070667_1000299706 140
6 3300005548 Ga0070665_100282763 Ga0070665_1002827632 140
7 3300025986 Ga0207658_10023690 Ga0207658_100236906 140
8 3300013306 Ga0163162_10147599 Ga0163162_101475992 141
9 3300005539 Ga0068853_100503451 Ga0068853_1005034512 143
10 3300005616 Ga0068852_101318785 Ga0068852_1013187851 143
11 3300005834 Ga0068851_10198389 Ga0068851_101983892 143
12 3300005330 Ga0070690_100075575 Ga0070690_1000755753 145
13 3300048920 Ga0496117_0004194 Ga0496117_0004194_13140_13631 145
14 3300048921 Ga0496118_0010512 Ga0496118_0010512_3055_3546 145
15 3300005364 Ga0070673_100314647 Ga0070673_1003146472 146
16 3300005539 Ga0068853_100046040 Ga0068853_1000460402 146
17 3300005577 Ga0068857_100828113 Ga0068857_1008281131 146
18 3300006237 Ga0097621_100115545 Ga0097621_1001155452 146
19 3300006881 Ga0068865_100020929 Ga0068865_1000209292 146
20 3300009093 Ga0105240_10404168 Ga0105240_104041682 146
21 3300013296 Ga0157374_10479341 Ga0157374_104793412 146
22 3300013308 Ga0157375_10879487 Ga0157375_108794871 146
23 3300014968 Ga0157379_10118724 Ga0157379_101187242 146
24 3300025903 Ga0207680_10110990 Ga0207680_101109902 148
25 3300025911 Ga0207654_10536968 Ga0207654_105369682 148
26 3300025938 Ga0207704_10041977 Ga0207704_100419772 148
27 3300025986 Ga0207658_10086476 Ga0207658_100864762 148
28 3300026041 Ga0207639_10230109 Ga0207639_102301092 148
29 3300026067 Ga0207678_10940135 Ga0207678_109401351 148
30 3300026095 Ga0207676_10089497 Ga0207676_100894972 148
31 3300026142 Ga0207698_10177323 Ga0207698_101773232 148
32 3300005616 Ga0068852_100348483 Ga0068852_1003484831 149
33 3300005834 Ga0068851_10224025 Ga0068851_102240252 149
34 3300005842 Ga0068858_101369535 Ga0068858_1013695352 149
35 3300025321 Ga0207656_10129633 Ga0207656_101296332 149
36 3300026116 Ga0207674_10145061 Ga0207674_101450612 149
37 3300053079 Ga0500610_0005301 Ga0500610_0005301_4174_4665 151
38 3300005530 Ga0070679_100569722 Ga0070679_1005697222 152
39 3300020082 Ga0206353_10884708 Ga0206353_108847082 152
40 3300037418 Ga0395900_0310599 Ga0395900_0310599_796_1296 152
41 3300037471 Ga0395905_0281344 Ga0395905_0281344_620_1120 152
42 iso_pu_bacteria 2524614729 2525558156 152
43 iso_pu_bacteria 2627854209 2630649959 152
44 3300005458 Ga0070681_10184126 Ga0070681_101841262 153
45 3300005616 Ga0068852_100003822 Ga0068852_10000382211 153
46 3300025921 Ga0207652_10663407 Ga0207652_106634071 153
47 3300026142 Ga0207698_10017962 Ga0207698_100179622 153
48 3300042876 Ga0451577_0505352 Ga0451577_0505352_226_762 153
49 3300049586 Ga0501070_0095553 Ga0501070_0095553_282_788 153
50 3300005327 Ga0070658_10067073 Ga0070658_100670733 154
51 3300005458 Ga0070681_10000827 Ga0070681_1000082727 154
52 3300005458 Ga0070681_10563075 Ga0070681_105630752 154
53 3300005530 Ga0070679_100419037 Ga0070679_1004190372 154
54 3300006237 Ga0097621_100492053 Ga0097621_1004920531 154
55 3300009176 Ga0105242_11006410 Ga0105242_110064101 154
56 3300013104 Ga0157370_10088936 Ga0157370_100889362 154
57 3300013104 Ga0157370_10907313 Ga0157370_109073131 154
58 3300013297 Ga0157378_10556240 Ga0157378_105562402 154
59 3300013297 Ga0157378_11112108 Ga0157378_111121081 154
60 3300025912 Ga0207707_10000075 Ga0207707_1000007578 154
61 3300025949 Ga0207667_10230144 Ga0207667_102301443 154
62 3300026023 Ga0207677_10077485 Ga0207677_100774852 154
63 3300037418 Ga0395900_0000060 Ga0395900_0000060_76520_77041 154
64 3300037418 Ga0395900_0005310 Ga0395900_0005310_6760_7284 154
65 3300049742 Ga0501080_0097338 Ga0501080_0097338_1702_2187 154
66 3300005335 Ga0070666_10321660 Ga0070666_103216601 155
67 3300005338 Ga0068868_100537861 Ga0068868_1005378612 155
68 3300005347 Ga0070668_100620468 Ga0070668_1006204681 155
69 3300005355 Ga0070671_100386778 Ga0070671_1003867782 155
70 3300005356 Ga0070674_101106537 Ga0070674_1011065371 155
71 3300005364 Ga0070673_100219911 Ga0070673_1002199112 155
72 3300005367 Ga0070667_100419611 Ga0070667_1004196112 155
73 3300005456 Ga0070678_100384736 Ga0070678_1003847362 155
74 3300005457 Ga0070662_100530112 Ga0070662_1005301121 155
75 3300005459 Ga0068867_100300517 Ga0068867_1003005171 155
76 3300005466 Ga0070685_10291872 Ga0070685_102918722 155
77 3300005530 Ga0070679_100163509 Ga0070679_1001635093 155
78 3300005539 Ga0068853_100295307 Ga0068853_1002953071 155
79 3300005543 Ga0070672_100504789 Ga0070672_1005047891 155
80 3300005614 Ga0068856_100488333 Ga0068856_1004883332 155
81 3300005617 Ga0068859_100294107 Ga0068859_1002941072 155
82 3300005841 Ga0068863_100311238 Ga0068863_1003112382 155
83 3300005841 Ga0068863_100467090 Ga0068863_1004670902 155
84 3300005842 Ga0068858_100730600 Ga0068858_1007306001 155
85 3300006237 Ga0097621_100179809 Ga0097621_1001798092 155
86 3300006358 Ga0068871_100460375 Ga0068871_1004603751 155
87 3300006881 Ga0068865_100034699 Ga0068865_1000346994 155
88 3300006881 Ga0068865_100650166 Ga0068865_1006501661 155
89 3300006931 Ga0097620_100294086 Ga0097620_1002940862 155
90 3300009177 Ga0105248_10125596 Ga0105248_101255963 155
91 3300013296 Ga0157374_10220035 Ga0157374_102200351 155
92 3300013306 Ga0163162_10126666 Ga0163162_101266664 155
93 3300013306 Ga0163162_10180752 Ga0163162_101807523 155
94 3300013306 Ga0163162_11110255 Ga0163162_111102552 155
95 3300013307 Ga0157372_10832477 Ga0157372_108324772 155
96 3300013308 Ga0157375_10037087 Ga0157375_100370875 155
97 3300014325 Ga0163163_10307802 Ga0163163_103078022 155
98 3300014497 Ga0182008_10398758 Ga0182008_103987582 155
99 3300014968 Ga0157379_10230115 Ga0157379_102301151 155
100 3300014969 Ga0157376_10006564 Ga0157376_100065645 155
101 3300017792 Ga0163161_10040787 Ga0163161_100407873 155
102 3300025903 Ga0207680_10244823 Ga0207680_102448232 155
103 3300025917 Ga0207660_10075549 Ga0207660_100755492 155
104 3300025921 Ga0207652_10135299 Ga0207652_101352993 155
105 3300025931 Ga0207644_10613644 Ga0207644_106136441 155
106 3300025938 Ga0207704_10910076 Ga0207704_109100761 155
107 3300025940 Ga0207691_10298958 Ga0207691_102989582 155
108 3300025941 Ga0207711_10739284 Ga0207711_107392842 155
109 3300025949 Ga0207667_10016160 Ga0207667_100161605 155
110 3300025960 Ga0207651_10132634 Ga0207651_101326341 155
111 3300025986 Ga0207658_10543026 Ga0207658_105430261 155
112 3300026023 Ga0207677_10747523 Ga0207677_107475231 155
113 3300026041 Ga0207639_10361019 Ga0207639_103610192 155
114 3300026088 Ga0207641_10035690 Ga0207641_100356905 155
115 3300026088 Ga0207641_10659856 Ga0207641_106598562 155
116 3300026088 Ga0207641_10826630 Ga0207641_108266302 155
117 3300026089 Ga0207648_10462768 Ga0207648_104627682 155
118 3300026121 Ga0207683_10008323 Ga0207683_100083232 155
119 3300031730 Ga0307516_10179698 Ga0307516_101796982 155
120 3300036401 Ga0373937_0417691 Ga0373937_0417691_324_809 155
121 3300041501 Ga0451845_0405586 Ga0451845_0405586_61_549 155
122 3300041512 Ga0451853_2163128 Ga0451853_2163128_75_557 155
123 3300046463 Ga0495653_0842311 Ga0495653_0842311_27_515 155
124 3300053093 Ga0500651_0000352 Ga0500651_0000352_22302_22790 155
125 3300005327 Ga0070658_10411700 Ga0070658_104117002 156
126 3300005328 Ga0070676_10034479 Ga0070676_100344791 156
127 3300005328 Ga0070676_10271780 Ga0070676_102717802 156
128 3300005328 Ga0070676_10560477 Ga0070676_105604772 156
129 3300005334 Ga0068869_100017096 Ga0068869_1000170966 156
130 3300005334 Ga0068869_100446211 Ga0068869_1004462112 156
131 3300005335 Ga0070666_10477921 Ga0070666_104779212 156
132 3300005338 Ga0068868_100028729 Ga0068868_1000287293 156
133 3300005347 Ga0070668_101140476 Ga0070668_1011404762 156
134 3300005353 Ga0070669_100011125 Ga0070669_1000111256 156
135 3300005354 Ga0070675_100019138 Ga0070675_1000191385 156
136 3300005364 Ga0070673_100110803 Ga0070673_1001108032 156
137 3300005365 Ga0070688_100362450 Ga0070688_1003624501 156
138 3300005367 Ga0070667_100060896 Ga0070667_1000608962 156
139 3300005367 Ga0070667_100146783 Ga0070667_1001467832 156
140 3300005455 Ga0070663_100777936 Ga0070663_1007779362 156
141 3300005459 Ga0068867_100110505 Ga0068867_1001105051 156
142 3300005459 Ga0068867_100246680 Ga0068867_1002466801 156
143 3300005539 Ga0068853_100016385 Ga0068853_1000163858 156
144 3300005539 Ga0068853_100438438 Ga0068853_1004384382 156
145 3300005539 Ga0068853_100551735 Ga0068853_1005517351 156
146 3300005539 Ga0068853_100674306 Ga0068853_1006743061 156
147 3300005548 Ga0070665_100054782 Ga0070665_1000547822 156
148 3300005548 Ga0070665_100078432 Ga0070665_1000784322 156
149 3300005548 Ga0070665_100142782 Ga0070665_1001427824 156
150 3300005548 Ga0070665_100584532 Ga0070665_1005845322 156
151 3300005617 Ga0068859_100506628 Ga0068859_1005066282 156
152 3300005719 Ga0068861_100408177 Ga0068861_1004081772 156
153 3300005840 Ga0068870_10026205 Ga0068870_100262051 156
154 3300005843 Ga0068860_100553817 Ga0068860_1005538172 156
155 3300005843 Ga0068860_101185843 Ga0068860_1011858432 156
156 3300005844 Ga0068862_100336568 Ga0068862_1003365682 156
157 3300005983 Ga0081540_1008619 Ga0081540_10086197 156
158 3300006237 Ga0097621_100022549 Ga0097621_1000225494 156
159 3300006881 Ga0068865_100243586 Ga0068865_1002435862 156
160 3300006881 Ga0068865_101043829 Ga0068865_1010438291 156
161 3300006931 Ga0097620_100506585 Ga0097620_1005065851 156
162 3300009093 Ga0105240_10443544 Ga0105240_104435442 156
163 3300009176 Ga0105242_11777972 Ga0105242_117779722 156
164 3300009553 Ga0105249_10000084 Ga0105249_10000084101 156
165 3300009553 Ga0105249_10038177 Ga0105249_100381774 156
166 3300010375 Ga0105239_10050230 Ga0105239_100502304 156
167 3300010375 Ga0105239_10451675 Ga0105239_104516751 156
168 3300013105 Ga0157369_10000001 Ga0157369_10000001287 156
169 3300013297 Ga0157378_10000475 Ga0157378_1000047521 156
170 3300013307 Ga0157372_10169396 Ga0157372_101693962 156
171 3300013308 Ga0157375_10848909 Ga0157375_108489092 156
172 3300014497 Ga0182008_10064311 Ga0182008_100643112 156
173 3300014969 Ga0157376_10030153 Ga0157376_100301533 156
174 3300014969 Ga0157376_10425968 Ga0157376_104259682 156
175 3300014969 Ga0157376_10489429 Ga0157376_104894292 156
176 3300025903 Ga0207680_10069818 Ga0207680_100698182 156
177 3300025907 Ga0207645_10070471 Ga0207645_100704712 156
178 3300025911 Ga0207654_10446269 Ga0207654_104462692 156
179 3300025913 Ga0207695_10068048 Ga0207695_100680482 156
180 3300025914 Ga0207671_10007138 Ga0207671_100071386 156
181 3300025920 Ga0207649_10444206 Ga0207649_104442061 156
182 3300025923 Ga0207681_10060885 Ga0207681_100608851 156
183 3300025924 Ga0207694_10276712 Ga0207694_102767122 156
184 3300025933 Ga0207706_10790030 Ga0207706_107900302 156
185 3300025938 Ga0207704_10070128 Ga0207704_100701283 156
186 3300025940 Ga0207691_10181212 Ga0207691_101812122 156
187 3300025942 Ga0207689_10330463 Ga0207689_103304632 156
188 3300025960 Ga0207651_10165650 Ga0207651_101656501 156
189 3300025961 Ga0207712_10041733 Ga0207712_100417332 156
190 3300025972 Ga0207668_11239940 Ga0207668_112399402 156
191 3300025972 Ga0207668_11927793 Ga0207668_119277931 156
192 3300025986 Ga0207658_10159033 Ga0207658_101590331 156
193 3300025986 Ga0207658_10232302 Ga0207658_102323022 156
194 3300025986 Ga0207658_10294041 Ga0207658_102940412 156
195 3300026041 Ga0207639_10007555 Ga0207639_100075555 156
196 3300026041 Ga0207639_10227950 Ga0207639_102279502 156
197 3300026041 Ga0207639_10281998 Ga0207639_102819982 156
198 3300026041 Ga0207639_10363940 Ga0207639_103639402 156
199 3300026041 Ga0207639_11000349 Ga0207639_110003492 156
200 3300026067 Ga0207678_10086814 Ga0207678_100868142 156
201 3300026088 Ga0207641_10051194 Ga0207641_100511942 156
202 3300026089 Ga0207648_10073868 Ga0207648_100738684 156
203 3300026118 Ga0207675_100545956 Ga0207675_1005459562 156
204 3300028379 Ga0268266_10128009 Ga0268266_101280093 156
205 3300028379 Ga0268266_10421544 Ga0268266_104215442 156
206 3300028381 Ga0268264_11080007 Ga0268264_110800072 156
207 3300041452 Ga0451793_1691990 Ga0451793_1691990_417_908 156
208 3300041456 Ga0451795_0015813 Ga0451795_0015813_19_510 156
209 3300041486 Ga0451807_1421545 Ga0451807_1421545_1421_1912 156
210 3300041509 Ga0451843_1196645 Ga0451843_1196645_255_746 156
211 3300041512 Ga0451853_1261072 Ga0451853_1261072_34_525 156
212 3300044712 Ga0453684_0000316 Ga0453684_0000316_48552_49037 156
213 3300045049 Ga0466959_0017172 Ga0466959_0017172_2358_2849 156
214 3300045051 Ga0451576_0000128 Ga0451576_0000128_36166_36651 156
215 3300048903 Ga0496100_0323710 Ga0496100_0323710_49_540 156
216 3300048904 Ga0496101_0259567 Ga0496101_0259567_216_707 156
217 3300048920 Ga0496117_0029156 Ga0496117_0029156_411_902 156
218 3300048921 Ga0496118_0001472 Ga0496118_0001472_32298_32789 156
219 3300048929 Ga0496126_0062906 Ga0496126_0062906_2671_3162 156
220 3300049568 Ga0501031_0138149 Ga0501031_0138149_654_1145 156
221 3300049568 Ga0501031_0264849 Ga0501031_0264849_367_858 156
222 3300049569 Ga0501032_0003925 Ga0501032_0003925_8963_9454 156
223 3300049569 Ga0501032_0075349 Ga0501032_0075349_57_548 156
224 3300049570 Ga0501033_0007392 Ga0501033_0007392_8004_8495 156
225 3300049570 Ga0501033_0088366 Ga0501033_0088366_69_560 156
226 3300049571 Ga0501034_0152351 Ga0501034_0152351_1728_2219 156
227 3300049571 Ga0501034_0422619 Ga0501034_0422619_726_1217 156
228 3300049571 Ga0501034_0527191 Ga0501034_0527191_85_576 156
229 3300049572 Ga0501036_0018039 Ga0501036_0018039_2498_2989 156
230 3300049572 Ga0501036_0043644 Ga0501036_0043644_431_922 156
231 3300049573 Ga0501037_0012728 Ga0501037_0012728_5254_5745 156
232 3300049573 Ga0501037_0075851 Ga0501037_0075851_157_648 156
233 3300049574 Ga0501038_0003076 Ga0501038_0003076_13069_13560 156
234 3300049574 Ga0501038_0090857 Ga0501038_0090857_350_841 156
235 3300049575 Ga0501039_0005931 Ga0501039_0005931_2763_3254 156
236 3300049578 Ga0501042_0303631 Ga0501042_0303631_258_749 156
237 3300049579 Ga0501043_0010472 Ga0501043_0010472_4275_4766 156
238 3300049579 Ga0501043_0069047 Ga0501043_0069047_453_944 156
239 3300049579 Ga0501043_0131714 Ga0501043_0131714_17_508 156
240 3300049579 Ga0501043_0331654 Ga0501043_0331654_85_576 156
241 3300049580 Ga0501046_0003886 Ga0501046_0003886_7100_7591 156
242 3300049580 Ga0501046_0051059 Ga0501046_0051059_163_654 156
243 3300049581 Ga0501047_0234866 Ga0501047_0234866_1099_1590 156
244 3300049581 Ga0501047_0247359 Ga0501047_0247359_399_890 156
245 3300049581 Ga0501047_0552321 Ga0501047_0552321_468_959 156
246 3300049581 Ga0501047_0725491 Ga0501047_0725491_96_587 156
247 3300049581 Ga0501047_0876284 Ga0501047_0876284_60_551 156
248 3300049582 Ga0501048_0042444 Ga0501048_0042444_2621_3112 156
249 3300049583 Ga0501067_0049500 Ga0501067_0049500_1165_1656 156
250 3300049585 Ga0501069_0013764 Ga0501069_0013764_2355_2846 156
251 3300049585 Ga0501069_0022289 Ga0501069_0022289_271_762 156
252 3300049586 Ga0501070_0052567 Ga0501070_0052567_2822_3313 156
253 3300049586 Ga0501070_0449169 Ga0501070_0449169_197_688 156
254 3300049586 Ga0501070_0580031 Ga0501070_0580031_261_752 156
255 3300049586 Ga0501070_0637885 Ga0501070_0637885_287_778 156
256 3300049587 Ga0501071_0138832 Ga0501071_0138832_82_573 156
257 3300049587 Ga0501071_0143533 Ga0501071_0143533_495_986 156
258 3300049589 Ga0501073_0005524 Ga0501073_0005524_973_1464 156
259 3300049589 Ga0501073_0040860 Ga0501073_0040860_2731_3222 156
260 3300049589 Ga0501073_0099732 Ga0501073_0099732_1262_1753 156
261 3300049590 Ga0501074_0071012 Ga0501074_0071012_1959_2450 156
262 3300049590 Ga0501074_0241914 Ga0501074_0241914_119_610 156
263 3300049592 Ga0501076_0390092 Ga0501076_0390092_378_869 156
264 3300049741 Ga0501079_0023751 Ga0501079_0023751_1686_2177 156
265 3300049741 Ga0501079_0061390 Ga0501079_0061390_801_1292 156
266 3300049742 Ga0501080_0008868 Ga0501080_0008868_2497_2988 156
267 3300049742 Ga0501080_0075006 Ga0501080_0075006_494_985 156
268 3300049742 Ga0501080_0440109 Ga0501080_0440109_522_1013 156
269 3300049744 Ga0501083_0340323 Ga0501083_0340323_430_921 156
270 3300049822 Ga0501035_0067961 Ga0501035_0067961_989_1480 156
271 3300049822 Ga0501035_0121077 Ga0501035_0121077_69_560 156
272 3300049822 Ga0501035_0210462 Ga0501035_0210462_1104_1595 156
273 3300049822 Ga0501035_0503541 Ga0501035_0503541_25_516 156
274 3300049823 Ga0501044_0014368 Ga0501044_0014368_844_1335 156
275 3300049823 Ga0501044_0110990 Ga0501044_0110990_1259_1750 156
276 3300049823 Ga0501044_0117119 Ga0501044_0117119_450_941 156
277 3300049824 Ga0501045_0192304 Ga0501045_0192304_901_1392 156
278 3300049824 Ga0501045_0340489 Ga0501045_0340489_393_884 156
279 3300053139 Ga0500568_0001136 Ga0500568_0001136_12813_13304 156
280 3300054114 Ga0501084_0397962 Ga0501084_0397962_271_762 156
281 3300060353 Ga0501082_0525024 Ga0501082_0525024_48_539 156
282 3300060353 Ga0501082_0591915 Ga0501082_0591915_457_948 156
283 3300060353 Ga0501082_0693163 Ga0501082_0693163_357_848 156
284 3300005328 Ga0070676_10529041 Ga0070676_105290412 157
285 3300005329 Ga0070683_100275779 Ga0070683_1002757792 157
286 3300005330 Ga0070690_100101101 Ga0070690_1001011012 157
287 3300005338 Ga0068868_101360549 Ga0068868_1013605491 157
288 3300005347 Ga0070668_100960725 Ga0070668_1009607251 157
289 3300005355 Ga0070671_100148860 Ga0070671_1001488602 157
290 3300005458 Ga0070681_10051428 Ga0070681_100514282 157
291 3300005530 Ga0070679_100500564 Ga0070679_1005005642 157
292 3300005539 Ga0068853_100141705 Ga0068853_1001417053 157
293 3300005543 Ga0070672_100754454 Ga0070672_1007544542 157
294 3300005548 Ga0070665_100027998 Ga0070665_1000279983 157
295 3300005548 Ga0070665_100052873 Ga0070665_1000528733 157
296 3300005548 Ga0070665_100056191 Ga0070665_1000561915 157
297 3300005563 Ga0068855_100187743 Ga0068855_1001877433 157
298 3300005563 Ga0068855_100237593 Ga0068855_1002375933 157
299 3300005563 Ga0068855_100322660 Ga0068855_1003226602 157
300 3300005564 Ga0070664_101111334 Ga0070664_1011113341 157
301 3300005577 Ga0068857_100165728 Ga0068857_1001657282 157
302 3300005614 Ga0068856_100820501 Ga0068856_1008205012 157
303 3300005617 Ga0068859_100011964 Ga0068859_1000119642 157
304 3300005617 Ga0068859_100210703 Ga0068859_1002107032 157
305 3300005841 Ga0068863_100104067 Ga0068863_1001040673 157
306 3300005842 Ga0068858_100058548 Ga0068858_1000585483 157
307 3300005843 Ga0068860_100116032 Ga0068860_1001160322 157
308 3300005844 Ga0068862_100000355 Ga0068862_10000035522 157
309 3300006358 Ga0068871_100310814 Ga0068871_1003108142 157
310 3300006931 Ga0097620_100011964 Ga0097620_1000119642 157
311 3300006931 Ga0097620_100210711 Ga0097620_1002107112 157
312 3300009093 Ga0105240_10130083 Ga0105240_101300833 157
313 3300009098 Ga0105245_10410118 Ga0105245_104101182 157
314 3300009101 Ga0105247_10106458 Ga0105247_101064582 157
315 3300009176 Ga0105242_10399768 Ga0105242_103997682 157
316 3300009176 Ga0105242_11192363 Ga0105242_111923631 157
317 3300009177 Ga0105248_10150362 Ga0105248_101503623 157
318 3300009545 Ga0105237_10058007 Ga0105237_100580072 157
319 3300009545 Ga0105237_10585238 Ga0105237_105852381 157
320 3300010375 Ga0105239_10004920 Ga0105239_1000492010 157
321 3300010375 Ga0105239_10103831 Ga0105239_101038312 157
322 3300010375 Ga0105239_10107408 Ga0105239_101074082 157
323 3300013104 Ga0157370_10715709 Ga0157370_107157091 157
324 3300013105 Ga0157369_10954919 Ga0157369_109549192 157
325 3300013296 Ga0157374_10029173 Ga0157374_100291732 157
326 3300013297 Ga0157378_10236666 Ga0157378_102366662 157
327 3300013306 Ga0163162_10000017 Ga0163162_10000017120 157
328 3300013308 Ga0157375_10019086 Ga0157375_100190863 157
329 3300014969 Ga0157376_11472405 Ga0157376_114724052 157
330 3300020070 Ga0206356_11062190 Ga0206356_110621902 157
331 3300025273 Ga0209673_1067645 Ga0209673_10676452 157
332 3300025912 Ga0207707_10730634 Ga0207707_107306341 157
333 3300025914 Ga0207671_10279533 Ga0207671_102795332 157
334 3300025914 Ga0207671_10295860 Ga0207671_102958602 157
335 3300025914 Ga0207671_10713749 Ga0207671_107137492 157
336 3300025921 Ga0207652_10471464 Ga0207652_104714642 157
337 3300025924 Ga0207694_10307326 Ga0207694_103073261 157
338 3300025925 Ga0207650_11150720 Ga0207650_111507202 157
339 3300025927 Ga0207687_10142203 Ga0207687_101422032 157
340 3300025931 Ga0207644_10412497 Ga0207644_104124972 157
341 3300025934 Ga0207686_10072598 Ga0207686_100725983 157
342 3300025940 Ga0207691_10635962 Ga0207691_106359622 157
343 3300025941 Ga0207711_10153233 Ga0207711_101532333 157
344 3300025949 Ga0207667_10161554 Ga0207667_101615541 157
345 3300025949 Ga0207667_10405098 Ga0207667_104050982 157
346 3300025972 Ga0207668_10043032 Ga0207668_100430322 157
347 3300025981 Ga0207640_10332769 Ga0207640_103327692 157
348 3300025981 Ga0207640_10569719 Ga0207640_105697192 157
349 3300025986 Ga0207658_10341621 Ga0207658_103416211 157
350 3300026041 Ga0207639_10000176 Ga0207639_1000017625 157
351 3300026041 Ga0207639_10381241 Ga0207639_103812412 157
352 3300026088 Ga0207641_10152444 Ga0207641_101524442 157
353 3300026116 Ga0207674_10353405 Ga0207674_103534052 157
354 3300026142 Ga0207698_10806124 Ga0207698_108061242 157
355 3300028379 Ga0268266_10162018 Ga0268266_101620182 157
356 3300028380 Ga0268265_10000236 Ga0268265_1000023612 157
357 3300028381 Ga0268264_10144377 Ga0268264_101443771 157
358 3300031616 Ga0307508_10062799 Ga0307508_100627991 157
359 3300031616 Ga0307508_10203752 Ga0307508_102037522 157
360 3300033179 Ga0307507_10428847 Ga0307507_104288472 157
361 3300041441 Ga0451787_295017 Ga0451787_295017_64_576 157
362 3300041451 Ga0451791_1047663 Ga0451791_1047663_404_916 157
363 3300041452 Ga0451793_1133516 Ga0451793_1133516_4630_5142 157
364 3300041459 Ga0451800_0655674 Ga0451800_0655674_1046_1558 157
365 3300041460 Ga0451802_0077970 Ga0451802_0077970_1785_2297 157
366 3300041486 Ga0451807_2472610 Ga0451807_2472610_2052_2564 157
367 3300041491 Ga0451833_1413619 Ga0451833_1413619_29_541 157
368 3300041492 Ga0451835_0625179 Ga0451835_0625179_203_715 157
369 3300041494 Ga0451837_1208518 Ga0451837_1208518_77_583 157
370 3300041512 Ga0451853_1276493 Ga0451853_1276493_82_576 157
371 3300046557 Ga0495622_0375691 Ga0495622_0375691_77_574 157
372 3300048918 Ga0496115_0189147 Ga0496115_0189147_961_1458 157
373 3300048924 Ga0496121_0335239 Ga0496121_0335239_27_524 157
374 3300049571 Ga0501034_0462030 Ga0501034_0462030_447_950 157
375 3300049571 Ga0501034_0601876 Ga0501034_0601876_15_509 157
376 3300049573 Ga0501037_0082213 Ga0501037_0082213_460_957 157
377 3300049589 Ga0501073_0166109 Ga0501073_0166109_160_654 157
378 3300049589 Ga0501073_0373150 Ga0501073_0373150_426_920 157
379 3300049589 Ga0501073_0475336 Ga0501073_0475336_320_817 157
380 3300049590 Ga0501074_0522734 Ga0501074_0522734_10_507 157
381 3300049742 Ga0501080_0366532 Ga0501080_0366532_98_592 157
382 3300049744 Ga0501083_0594226 Ga0501083_0594226_153_647 157
383 3300049822 Ga0501035_0112296 Ga0501035_0112296_1436_1933 157
384 3300049823 Ga0501044_0045639 Ga0501044_0045639_3280_3786 157
385 3300049823 Ga0501044_0076742 Ga0501044_0076742_449_946 157
386 3300053093 Ga0500651_0020651 Ga0500651_0020651_1391_1891 157
387 3300053136 Ga0500559_0079596 Ga0500559_0079596_899_1396 157
388 3300053177 Ga0500636_0168269 Ga0500636_0168269_280_777 157
389 3300060353 Ga0501082_0003116 Ga0501082_0003116_2214_2708 157
390 3300009545 Ga0105237_10342159 Ga0105237_103421592 158
391 3300031730 Ga0307516_10047423 Ga0307516_100474233 161
392 3300003214 JGI25165J46597_1028662 JGI25165J46597_10286621 175
393 3300025261 Ga0209233_1009632 Ga0209233_10096322 175
394 3300037312 Ga0395899_0482420 Ga0395899_0482420_133_660 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04608

PgpA

Phosphatidylglycerophosphatase A

34

176

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cwc-assembly1.cif.gz_A crystal structure of de novo designed helical repeat protein dhr5 0.4661 68 167
1rfz-assembly1.cif.gz_C structure of protein of unknown function from bacillus stearothermophilus 0.4323 13 172
3t8v-assembly1.cif.gz_A a bestatin-based chemical biology strategy reveals distinct roles for malaria m1- and m17-family aminopeptidases 0.3971 59 167
5cwb-assembly1.cif.gz_A crystal structure of de novo designed helical repeat protein dhr4 0.3679 13 167
1rfz-assembly1.cif.gz_C structure of protein of unknown function from bacillus stearothermophilus 0.3634 13 172
ID Description Score Start End Superfamily
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4296 8 167 1.20.1250.20
af_Q4D3U2_42_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4152 37 169 1.20.1250.20
af_A4I3I9_159_313_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3976 64 167 1.20.140.150
af_Q75HJ8_142_268_1.20.58.1210 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, N-terminal helical domain 0.3828 18 167 1.20.58.1210
af_I1KG51_268_372_1.20.58.1220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, C-terminal helical domain 0.3794 59 165 1.20.58.1220
ID Description Score Start End GO Terms
AF-A0A848QIV2-F1-model_v4 deleted 0.9216 56 175
AF-A0A530LBZ0-F1-model_v4 Phosphatidylglycerophosphatase A 0.9074 60 174 GO:0006629
GO:0008962
GO:0016020
AF-G0YU53-F1-model_v4 Putative phosphatidylglycerophosphatase 0.9073 56 173 GO:0006629
GO:0008962
GO:0016020
AF-A0A1V5JSE6-F1-model_v4 Phosphatidylglycerophosphatase A (EC 3.1.3.27) 0.9057 55 170 GO:0006629
GO:0008962
GO:0016020
AF-A0A1V4XTZ7-F1-model_v4 Phosphatidylglycerophosphatase A (EC 3.1.3.27) 0.9039 44 175 GO:0006629
GO:0008962
GO:0016020

Feature Viewer

pLDDT pTM Quality
68.33 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map