F432935

General Info

Members Datasets Scaffolds Average Seq Length
394 269 365 230

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10020305|Ga0265340_100203052
Length 269
Sequence MQHEVLLCRPGTPVNSATGVPHLRRTAHALHRVRDKRLMFSLTPDEWTAVHLSLRIAIVATLVALPFGVAMAWLLARKEFWGKTLLDGIVHLPLVLPPVVTGYLLLIWFGRRGPIGSFLAETFGIVFSFRWTGAALACGVMGFPLLVRAIRLSIEAIDRKLEDAASTLGANRAFVFLTVTLPLSVPGIIAGMVLCFAKALGEFGATITFVSNIPGETQTISAAIYTYTQIPNGDAAAGRLVIVAIVISLVALVASEWLARYAGTRLHGE

Samples

Sample ID Description Type Environment
1 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
2 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
3 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
4 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
5 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
6 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
7 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
8 2643221693 Rhizobium sp. Root491 Isolate Unclassified
9 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
10 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
11 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
12 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
13 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
14 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
15 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
16 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
17 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
18 2952252522 Salinicola sp. DM10 Isolate Unclassified
19 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
20 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
21 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
22 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
23 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
24 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
25 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
26 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
267 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
268 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
269 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.64
Metatranscriptomes 0
Isolates 7.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.76
Bulb 0
Endosphere 6.35
Nodule 1.52
Rhizoplane 7.36
Rhizosphere 78.43
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10020357 3300003187 Bacteria 2799
2 Ga0058692_1003757 3300003856 Bacteria 4632
3 Ga0065712_10004299 3300005290 Bacteria 4169
4 Ga0065715_10029511 3300005293 Bacteria 1603
5 Ga0065707_10345829 3300005295 Bacteria 926
6 Ga0070658_10064908 3300005327 Bacteria 2979
7 Ga0070690_100074820 3300005330 Bacteria 2207
8 Ga0070677_10004955 3300005333 Bacteria 4374
9 Ga0068869_100298712 3300005334 Bacteria 1300
10 Ga0070666_10404558 3300005335 Bacteria 982
11 Ga0070680_100020950 3300005336 Bacteria 5191
12 Ga0070682_100517311 3300005337 Bacteria 928
13 Ga0068868_100098950 3300005338 Bacteria 2359
14 Ga0070689_100028492 3300005340 Bacteria 4222
15 Ga0070689_100034953 3300005340 Bacteria 3837
16 Ga0070689_100045432 3300005340 Bacteria 3382
17 Ga0070661_100326381 3300005344 Bacteria 1200
18 Ga0070669_100212302 3300005353 Bacteria 1527
19 Ga0070675_100798691 3300005354 Bacteria 862
20 Ga0070671_100010167 3300005355 Bacteria 7552
21 Ga0070671_100100811 3300005355 Bacteria 2422
22 Ga0070671_100366034 3300005355 Bacteria 1231
23 Ga0070674_100000293 3300005356 Bacteria 24580
24 Ga0070674_100005387 3300005356 Bacteria 7382
25 Ga0070674_100182524 3300005356 Bacteria 1608
26 Ga0070673_100092640 3300005364 Bacteria 2472
27 Ga0070673_100408623 3300005364 Bacteria 1215
28 Ga0070673_100429145 3300005364 Bacteria 1186
29 Ga0070688_100671795 3300005365 Bacteria 800
30 Ga0070659_100188488 3300005366 Bacteria 1695
31 Ga0070659_100529973 3300005366 Bacteria 1006
32 Ga0070667_100028211 3300005367 Bacteria 4673
33 Ga0070709_10078168 3300005434 Bacteria 2152
34 Ga0070714_100212819 3300005435 Bacteria 1772
35 Ga0070714_100232546 3300005435 Bacteria 1699
36 Ga0070713_100004171 3300005436 Bacteria 9642
37 Ga0070713_100071699 3300005436 Bacteria 2928
38 Ga0070710_10032016 3300005437 Bacteria 2845
39 Ga0070711_100588726 3300005439 Bacteria 927
40 Ga0070708_100143641 3300005445 Bacteria 2215
41 Ga0070663_100261388 3300005455 Bacteria 1373
42 Ga0070678_100010410 3300005456 Bacteria 5680
43 Ga0070678_100088767 3300005456 Bacteria 2365
44 Ga0070681_10015779 3300005458 Bacteria 7529
45 Ga0070681_10019071 3300005458 Bacteria 6864
46 Ga0068867_100222891 3300005459 Bacteria 1520
47 Ga0070685_10155091 3300005466 Bacteria 1454
48 Ga0070707_100165523 3300005468 Bacteria 2155
49 Ga0070684_100134072 3300005535 Bacteria 2236
50 Ga0070672_100127575 3300005543 Bacteria 2088
51 Ga0070686_100123249 3300005544 Bacteria 1782
52 Ga0070696_100091221 3300005546 Bacteria 2169
53 Ga0070693_100018759 3300005547 Bacteria 3618
54 Ga0070664_100028233 3300005564 Bacteria 4667
55 Ga0068856_100065975 3300005614 Bacteria 3577
56 Ga0068859_100167323 3300005617 Bacteria 2278
57 Ga0068864_100093695 3300005618 Bacteria 2653
58 Ga0068866_10028593 3300005718 Bacteria 2658
59 Ga0068866_10148674 3300005718 Bacteria 1354
60 Ga0068861_100376689 3300005719 Bacteria 1252
61 Ga0068863_100547210 3300005841 Bacteria 1143
62 Ga0068858_100059605 3300005842 Bacteria 3528
63 Ga0068858_100065139 3300005842 Bacteria 3372
64 Ga0068860_100267854 3300005843 Bacteria 1667
65 Ga0081455_10012668 3300005937 Bacteria 8392
66 Ga0081540_1017359 3300005983 Bacteria 4459
67 Ga0070717_10031214 3300006028 Bacteria 4284
68 Ga0075364_10092534 3300006051 Bacteria 2007
69 Ga0075364_10196938 3300006051 Bacteria 1365
70 Ga0070715_10000587 3300006163 Bacteria 9568
71 Ga0070716_100230553 3300006173 Bacteria 1250
72 Ga0075367_10047652 3300006178 Bacteria 2522
73 Ga0075367_10145254 3300006178 Bacteria 1471
74 Ga0075369_10013017 3300006186 Bacteria 3293
75 Ga0097621_100431996 3300006237 Bacteria 1184
76 Ga0097621_100471922 3300006237 Bacteria 1133
77 Ga0068871_100181732 3300006358 Bacteria 1808
78 Ga0075428_100238490 3300006844 Bacteria 1962
79 Ga0075428_100502699 3300006844 Bacteria 1297
80 Ga0075428_101173885 3300006844 Bacteria 810
81 Ga0075430_100000015 3300006846 Bacteria 89952
82 Ga0075430_100200698 3300006846 Bacteria 1656
83 Ga0075430_100334569 3300006846 Bacteria 1251
84 Ga0075431_100040641 3300006847 Bacteria 4793
85 Ga0075431_100091380 3300006847 Bacteria 3142
86 Ga0075433_10644771 3300006852 Bacteria 929
87 Ga0075429_100072900 3300006880 Bacteria 2990
88 Ga0068865_100105196 3300006881 Bacteria 2073
89 Ga0068865_100123103 3300006881 Bacteria 1932
90 Ga0075436_100011783 3300006914 Bacteria 6001
91 Ga0097620_100167332 3300006931 Bacteria 2278
92 Ga0075435_100180528 3300007076 Bacteria 1784
93 Ga0075435_100412378 3300007076 Bacteria 1163
94 Ga0099795_10142854 3300007788 Bacteria 975
95 Ga0105240_10132601 3300009093 Bacteria 2987
96 Ga0111539_10429840 3300009094 Bacteria 1538
97 Ga0111539_10916175 3300009094 Bacteria 1019
98 Ga0105245_10320817 3300009098 Bacteria 1526
99 Ga0105247_10067220 3300009101 Bacteria 2233
100 Ga0105247_10085966 3300009101 Bacteria 1990
101 Ga0105247_10091798 3300009101 Bacteria 1929
102 Ga0114129_10031826 3300009147 Bacteria 7457
103 Ga0114129_10091398 3300009147 Bacteria 4217
104 Ga0114129_10619148 3300009147 Bacteria 1400
105 Ga0105243_10003690 3300009148 Bacteria 12313
106 Ga0105243_10057806 3300009148 Bacteria 3089
107 Ga0105243_10214121 3300009148 Bacteria 1698
108 Ga0105241_10279510 3300009174 Bacteria 1425
109 Ga0105248_10112305 3300009177 Bacteria 3073
110 Ga0105248_10576900 3300009177 Bacteria 1269
111 Ga0105249_10970958 3300009553 Bacteria 918
112 Ga0105246_10241402 3300011119 Bacteria 1428
113 Ga0105246_10248717 3300011119 Bacteria 1410
114 Ga0157373_10091975 3300013100 Bacteria 2136
115 Ga0157371_10000195 3300013102 Bacteria 89727
116 Ga0157375_10327384 3300013308 Bacteria 1697
117 Ga0157379_10032682 3300014968 Bacteria 4639
118 Ga0157379_10264302 3300014968 Bacteria 1564
119 Ga0157376_10081567 3300014969 Bacteria 2777
120 Ga0157376_10274421 3300014969 Bacteria 1585
121 Ga0163161_10309745 3300017792 Bacteria 1245
122 Ga0213872_10004392 3300021361 Bacteria 7505
123 Ga0213872_10017448 3300021361 Bacteria 3316
124 Ga0213872_10034507 3300021361 Bacteria 2315
125 Ga0207425_1000937 3300025245 Bacteria 13889
126 Ga0207425_1022417 3300025245 Bacteria 1331
127 Ga0209129_1000377 3300025258 Bacteria 36213
128 Ga0209129_1001431 3300025258 Bacteria 13337
129 Ga0209025_1000469 3300025294 Bacteria 78737
130 Ga0209025_1006466 3300025294 Bacteria 9083
131 Ga0209025_1072192 3300025294 Bacteria 1218
132 Ga0209758_1000563 3300025297 Bacteria 58374
133 Ga0209758_1001297 3300025297 Bacteria 30633
134 Ga0207692_10007012 3300025898 Bacteria 4600
135 Ga0207692_10149240 3300025898 Bacteria 1337
136 Ga0207710_10040141 3300025900 Bacteria 2073
137 Ga0207710_10041909 3300025900 Bacteria 2032
138 Ga0207688_10119232 3300025901 Bacteria 1538
139 Ga0207688_10161097 3300025901 Bacteria 1330
140 Ga0207685_10035194 3300025905 Bacteria 1826
141 Ga0207699_10587649 3300025906 Bacteria 810
142 Ga0207645_10302724 3300025907 Bacteria 1065
143 Ga0207654_10090439 3300025911 Bacteria 1864
144 Ga0207671_10124609 3300025914 Bacteria 1972
145 Ga0207663_10026401 3300025916 Bacteria 3371
146 Ga0207660_10014807 3300025917 Bacteria 5140
147 Ga0207662_10029902 3300025918 Bacteria 3159
148 Ga0207646_10068277 3300025922 Bacteria 3175
149 Ga0207681_10573933 3300025923 Bacteria 930
150 Ga0207694_10360013 3300025924 Bacteria 1205
151 Ga0207687_10096094 3300025927 Bacteria 2171
152 Ga0207687_10378769 3300025927 Bacteria 1159
153 Ga0207700_10007811 3300025928 Bacteria 6574
154 Ga0207700_10179600 3300025928 Bacteria 1771
155 Ga0207664_10014919 3300025929 Bacteria 5625
156 Ga0207664_10397439 3300025929 Bacteria 1225
157 Ga0207690_10116915 3300025932 Bacteria 1930
158 Ga0207690_10457676 3300025932 Bacteria 1026
159 Ga0207706_10025042 3300025933 Bacteria 5349
160 Ga0207686_10154962 3300025934 Bacteria 1599
161 Ga0207670_10511509 3300025936 Bacteria 976
162 Ga0207669_10002180 3300025937 Bacteria 8313
163 Ga0207669_10430700 3300025937 Bacteria 1040
164 Ga0207704_10023604 3300025938 Bacteria 3318
165 Ga0207704_10242862 3300025938 Bacteria 1347
166 Ga0207665_10021625 3300025939 Bacteria 4231
167 Ga0207665_10026845 3300025939 Bacteria 3803
168 Ga0207665_10116279 3300025939 Bacteria 1885
169 Ga0207691_10002457 3300025940 Bacteria 18124
170 Ga0207711_10078057 3300025941 Bacteria 2887
171 Ga0207711_10100639 3300025941 Bacteria 2557
172 Ga0207711_10157003 3300025941 Bacteria 2057
173 Ga0207689_10102180 3300025942 Bacteria 2355
174 Ga0207679_10134428 3300025945 Bacteria 1989
175 Ga0207667_10779134 3300025949 Bacteria 954
176 Ga0207651_10144114 3300025960 Bacteria 1844
177 Ga0207658_10035258 3300025986 Bacteria 3582
178 Ga0207658_10101274 3300025986 Bacteria 2257
179 Ga0207677_10108699 3300026023 Bacteria 2060
180 Ga0207703_10069204 3300026035 Bacteria 2910
181 Ga0207703_10920768 3300026035 Bacteria 837
182 Ga0207639_10121455 3300026041 Bacteria 2147
183 Ga0207678_10380214 3300026067 Bacteria 1221
184 Ga0207702_10192482 3300026078 Bacteria 1885
185 Ga0207641_10171513 3300026088 Bacteria 1981
186 Ga0207648_10058857 3300026089 Bacteria 3351
187 Ga0207676_10065015 3300026095 Bacteria 2903
188 Ga0207674_10258187 3300026116 Bacteria 1689
189 Ga0207675_100354521 3300026118 Bacteria 1438
190 Ga0207683_10000561 3300026121 Bacteria 34352
191 Ga0207683_10003691 3300026121 Bacteria 13301
192 Ga0207683_10058977 3300026121 Bacteria 3370
193 Ga0209179_1001999 3300027512 Bacteria 2656
194 Ga0265318_10017971 3300028577 Bacteria 2893
195 Ga0265328_10037022 3300031239 Bacteria 1803
196 Ga0265320_10014133 3300031240 Bacteria 4562
197 Ga0265325_10010357 3300031241 Bacteria 5403
198 Ga0265325_10191949 3300031241 Bacteria 946
199 Ga0265340_10008869 3300031247 Bacteria 5419
200 Ga0265340_10020305 3300031247 Bacteria 3415
201 Ga0265339_10010715 3300031249 Bacteria 5678
202 Ga0265331_10030135 3300031250 Bacteria 2702
203 Ga0265316_10313528 3300031344 Bacteria 1141
204 Ga0265313_10019904 3300031595 Bacteria 3719
205 Ga0265314_10046751 3300031711 Bacteria 3051
206 Ga0265314_10179599 3300031711 Bacteria 1270
207 Ga0265342_10008547 3300031712 Bacteria 7323
208 Ga0265342_10011532 3300031712 Bacteria 6041
209 Ga0307409_100020695 3300031995 Bacteria 4491
210 Ga0373938_0006154 3300034957 Bacteria 2064
211 Ga0373953_0006517 3300035117 Bacteria 3852
212 Ga0373947_0051838 3300035725 Bacteria 2470
213 Ga0373937_0002159 3300036401 Bacteria 16474
214 Ga0395900_0784492 3300037418 Bacteria 882
215 Ga0436364_1272475 3300037853 Bacteria 1650
216 Ga0436365_1535819 3300039437 Bacteria 795
217 Ga0436365_1582316 3300039437 Bacteria 1171
218 Ga0436361_0014121 3300039447 Bacteria 1387
219 Ga0436361_0014220 3300039447 Bacteria 11428
220 Ga0436361_0120866 3300039447 Bacteria 3804
221 Ga0436361_0466866 3300039447 Bacteria 5705
222 Ga0436361_0970117 3300039447 Bacteria 1904
223 Ga0436361_1131699 3300039447 Bacteria 9569
224 Ga0436363_0734502 3300039450 Bacteria 1590
225 Ga0436362_0575058 3300039453 Bacteria 1299
226 Ga0436362_1290531 3300039453 Bacteria 1455
227 Ga0439446_0039710 3300042156 Bacteria 1383
228 Ga0466963_0327244 3300044694 Bacteria 1079
229 Ga0495592_0261394 3300046454 Bacteria 1140
230 Ga0495638_0010559 3300046460 Bacteria 6396
231 Ga0495621_0001314 3300046539 Bacteria 6423
232 Ga0495656_0018672 3300046615 Bacteria 2668
233 Ga0495659_0127261 3300046664 Bacteria 1008
234 Ga0495613_0294370 3300046689 Bacteria 1125
235 Ga0495670_0026621 3300046691 Bacteria 2863
236 Ga0495604_0312506 3300047317 Bacteria 1052
237 Ga0495672_0084015 3300047320 Bacteria 1767
238 Ga0495685_029075 3300047447 Bacteria 1901
239 Ga0495684_0253648 3300047471 Bacteria 1279
240 Ga0496100_0019076 3300048903 Bacteria 4083
241 Ga0496100_0102838 3300048903 Bacteria 1972
242 Ga0496100_0433879 3300048903 Bacteria 1005
243 Ga0496101_0016510 3300048904 Bacteria 4990
244 Ga0496102_0189492 3300048905 Bacteria 1938
245 Ga0496102_0427980 3300048905 Bacteria 1243
246 Ga0496103_0084966 3300048906 Bacteria 1994
247 Ga0496104_0082787 3300048907 Bacteria 3060
248 Ga0496105_0225199 3300048908 Bacteria 1525
249 Ga0496106_0006359 3300048909 Bacteria 8746
250 Ga0496106_0527727 3300048909 Bacteria 948
251 Ga0496107_0009537 3300048910 Bacteria 6735
252 Ga0496108_0169129 3300048911 Bacteria 1891
253 Ga0496108_0220702 3300048911 Bacteria 1647
254 Ga0496109_0027787 3300048912 Bacteria 5055
255 Ga0496109_0154979 3300048912 Bacteria 2146
256 Ga0496109_0348234 3300048912 Bacteria 1399
257 Ga0496110_0190696 3300048913 Bacteria 1861
258 Ga0496110_0330532 3300048913 Bacteria 1388
259 Ga0496111_0008982 3300048914 Bacteria 6648
260 Ga0496111_0135731 3300048914 Bacteria 1822
261 Ga0496111_0319803 3300048914 Bacteria 1149
262 Ga0496112_0115860 3300048915 Bacteria 2650
263 Ga0496112_0126060 3300048915 Bacteria 2531
264 Ga0496113_0065824 3300048916 Bacteria 2744
265 Ga0496113_0093422 3300048916 Bacteria 2322
266 Ga0496114_0013746 3300048917 Bacteria 6489
267 Ga0496114_0027347 3300048917 Bacteria 4671
268 Ga0496115_0020151 3300048918 Bacteria 5141
269 Ga0496117_0004556 3300048920 Bacteria 15185
270 Ga0496122_0000606 3300048925 Bacteria 73602
271 Ga0496123_0000450 3300048926 Bacteria 73652
272 Ga0496124_0000704 3300048927 Bacteria 54690
273 Ga0496125_0003535 3300048928 Bacteria 18835
274 Ga0496126_0006808 3300048929 Bacteria 12679
275 Ga0496126_0039166 3300048929 Bacteria 4401
276 Ga0501031_0004297 3300049568 Bacteria 9217
277 Ga0501031_0021430 3300049568 Bacteria 4212
278 Ga0501031_0042979 3300049568 Bacteria 2950
279 Ga0501032_0007576 3300049569 Bacteria 7926
280 Ga0501032_0030532 3300049569 Bacteria 3698
281 Ga0501033_0016304 3300049570 Bacteria 5628
282 Ga0501033_0057564 3300049570 Bacteria 2872
283 Ga0501034_0015566 3300049571 Bacteria 7811
284 Ga0501034_0021392 3300049571 Bacteria 6593
285 Ga0501036_0006244 3300049572 Bacteria 9665
286 Ga0501036_0008837 3300049572 Bacteria 8271
287 Ga0501036_0042273 3300049572 Bacteria 3860
288 Ga0501037_0002448 3300049573 Bacteria 13420
289 Ga0501037_0025334 3300049573 Bacteria 4382
290 Ga0501038_0021656 3300049574 Bacteria 5767
291 Ga0501039_0035318 3300049575 Bacteria 3857
292 Ga0501040_0376357 3300049576 Bacteria 1018
293 Ga0501041_0022985 3300049577 Bacteria 3736
294 Ga0501042_0275640 3300049578 Bacteria 1214
295 Ga0501043_0010839 3300049579 Bacteria 7138
296 Ga0501046_0007397 3300049580 Bacteria 9652
297 Ga0501046_0031455 3300049580 Bacteria 4301
298 Ga0501046_0104742 3300049580 Bacteria 2168
299 Ga0501047_0016961 3300049581 Bacteria 6962
300 Ga0501047_0036022 3300049581 Bacteria 4781
301 Ga0501047_0089527 3300049581 Bacteria 2955
302 Ga0501047_0241703 3300049581 Bacteria 1656
303 Ga0501047_0391419 3300049581 Bacteria 1223
304 Ga0501047_0634611 3300049581 Bacteria 888
305 Ga0501048_0001904 3300049582 Bacteria 15842
306 Ga0501067_0001082 3300049583 Bacteria 14694
307 Ga0501067_0329897 3300049583 Bacteria 850
308 Ga0501068_0074977 3300049584 Bacteria 2069
309 Ga0501069_0001841 3300049585 Bacteria 10580
310 Ga0501070_0019204 3300049586 Bacteria 5732
311 Ga0501070_0304459 3300049586 Bacteria 1298
312 Ga0501071_0041764 3300049587 Bacteria 3285
313 Ga0501072_0012181 3300049588 Bacteria 6570
314 Ga0501072_0293487 3300049588 Bacteria 1292
315 Ga0501073_0006258 3300049589 Bacteria 8878
316 Ga0501074_0002766 3300049590 Bacteria 12272
317 Ga0501074_0034189 3300049590 Bacteria 3685
318 Ga0501076_0096078 3300049592 Bacteria 2386
319 Ga0501080_0027706 3300049742 Bacteria 5268
320 Ga0501081_0101087 3300049743 Bacteria 2038
321 Ga0501083_0006017 3300049744 Bacteria 8595
322 Ga0501083_0145779 3300049744 Bacteria 1550
323 Ga0501035_0004725 3300049822 Bacteria 12934
324 Ga0501035_0007763 3300049822 Bacteria 10022
325 Ga0501044_0000426 3300049823 Bacteria 52024
326 Ga0501044_0048524 3300049823 Bacteria 4384
327 Ga0501044_0163982 3300049823 Bacteria 2197
328 Ga0501044_0394495 3300049823 Bacteria 1297
329 Ga0501044_0495754 3300049823 Bacteria 1123
330 Ga0501044_0620371 3300049823 Bacteria 973
331 Ga0501045_0012705 3300049824 Bacteria 5929
332 Ga0501045_0122667 3300049824 Bacteria 1929
333 nmdc:mga0k408_5410_c1 3300050493 Bacteria 6793
334 nmdc:mga06z11_236540_c1 3300050494 Bacteria 1072
335 nmdc:mga04h51_193860_c1 3300050495 Bacteria 796
336 nmdc:mga07m45_97768_c1 3300050496 Bacteria 1685
337 nmdc:mga05p37_37783_c1 3300050507 Bacteria 5923
338 nmdc:mga05p37_409266_c1 3300050507 Bacteria 1581
339 nmdc:mga05p37_549924_c1 3300050507 Bacteria 1314
340 nmdc:mga0qj67_168_c1 3300050509 Bacteria 43793
341 nmdc:mga0qj67_207669_c1 3300050509 Bacteria 1591
342 nmdc:mga0qj67_89484_c1 3300050509 Bacteria 2472
343 nmdc:mga06r32_27457_c1 3300050510 Bacteria 5317
344 nmdc:mga06r32_747006_c1 3300050510 Bacteria 942
345 nmdc:mga0n895_963072_c1 3300050512 Bacteria 836
346 nmdc:mga0rr50_124518_c1 3300050513 Bacteria 2056
347 nmdc:mga08x19_201835_c1 3300050514 Bacteria 1363
348 nmdc:mga08x19_5083_c1 3300050514 Bacteria 7780
349 nmdc:mga0sz30_10195_c1 3300050516 Bacteria 3595
350 nmdc:mga0sz30_9273_c1 3300050516 Bacteria 3738
351 Ga0495601_0138034 3300053077 Bacteria 1590
352 Ga0495619_0049867 3300053085 Bacteria 2762
353 Ga0495619_0210380 3300053085 Bacteria 1347
354 Ga0500646_0040040 3300053090 Bacteria 1317
355 Ga0500641_0006721 3300053096 Bacteria 4089
356 Ga0500593_009259 3300053117 Bacteria 4081
357 Ga0500616_0203517 3300053153 Bacteria 875
358 Ga0501084_0022645 3300054114 Bacteria 5243
359 Ga0501084_0344514 3300054114 Bacteria 1259
360 Ga0501082_0009445 3300060353 Bacteria 8396
361 Ga0501082_0017393 3300060353 Bacteria 6195
362 Ga0501082_0245609 3300060353 Bacteria 1558
363 Ga0501082_0283219 3300060353 Bacteria 1443
364 Ga0501082_0507081 3300060353 Bacteria 1054
365 Ga0530510_0186909 3300061734 Bacteria 1537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10004299 Ga0065712_100042994 204
2 3300005293 Ga0065715_10029511 Ga0065715_100295111 204
3 3300005340 Ga0070689_100045432 Ga0070689_1000454323 204
4 3300005364 Ga0070673_100092640 Ga0070673_1000926403 204
5 3300005435 Ga0070714_100212819 Ga0070714_1002128192 204
6 3300005456 Ga0070678_100010410 Ga0070678_1000104105 204
7 3300025906 Ga0207699_10587649 Ga0207699_105876492 204
8 3300025918 Ga0207662_10029902 Ga0207662_100299023 204
9 3300025939 Ga0207665_10026845 Ga0207665_100268452 204
10 3300025940 Ga0207691_10002457 Ga0207691_100024572 204
11 3300025960 Ga0207651_10144114 Ga0207651_101441142 204
12 3300044694 Ga0466963_0327244 Ga0466963_0327244_71_766 204
13 3300047447 Ga0495685_029075 Ga0495685_029075_466_1161 204
14 3300021361 Ga0213872_10034507 Ga0213872_100345073 208
15 3300049588 Ga0501072_0012181 Ga0501072_0012181_2112_2807 209
16 3300060353 Ga0501082_0245609 Ga0501082_0245609_801_1496 209
17 3300021361 Ga0213872_10017448 Ga0213872_100174484 210
18 3300046454 Ga0495592_0261394 Ga0495592_0261394_294_989 210
19 iso_pu_bacteria 2952252522 2952252696 212
20 iso_pu_bacteria 2775507049 2776912307 213
21 iso_pu_bacteria 2791354903 2791923255 213
22 iso_pu_bacteria 2643221623 2644132459 214
23 iso_pu_bacteria 2671180139 2671695359 214
24 iso_pu_bacteria 2917554339 2917556500 214
25 iso_pu_bacteria 8002285264 8002288339 214
26 3300005365 Ga0070688_100671795 Ga0070688_1006717951 215
27 3300006051 Ga0075364_10092534 Ga0075364_100925342 215
28 3300013100 Ga0157373_10091975 Ga0157373_100919752 215
29 3300013102 Ga0157371_10000195 Ga0157371_1000019514 215
30 3300053117 Ga0500593_009259 Ga0500593_009259_2206_2892 215
31 3300046691 Ga0495670_0026621 Ga0495670_0026621_1567_2262 216
32 3300048929 Ga0496126_0039166 Ga0496126_0039166_328_1029 216
33 iso_pu_bacteria 2513237085 2513580463 216
34 iso_pu_bacteria 2517287029 2517408407 216
35 iso_pu_bacteria 2554235003 2554248727 216
36 iso_pu_bacteria 2558860242 2559295815 216
37 iso_pu_bacteria 2582581867 2585399875 216
38 iso_pu_bacteria 2585427590 2585820963 216
39 iso_pu_bacteria 2643221693 2644521393 216
40 iso_pu_bacteria 2808606387 2808988361 216
41 iso_pu_bacteria 2891373044 2891376197 216
42 iso_pu_bacteria 2935901341 2935903496 216
43 iso_pu_bacteria 2989349275 2989350888 216
44 iso_pu_bacteria 3005445848 3005449799 216
45 iso_pu_bacteria 8024486573 8024490969 216
46 3300005337 Ga0070682_100517311 Ga0070682_1005173112 217
47 3300005445 Ga0070708_100143641 Ga0070708_1001436412 217
48 3300005468 Ga0070707_100165523 Ga0070707_1001655232 217
49 3300014968 Ga0157379_10264302 Ga0157379_102643022 217
50 3300025922 Ga0207646_10068277 Ga0207646_100682772 217
51 3300031995 Ga0307409_100020695 Ga0307409_1000206951 217
52 3300037418 Ga0395900_0784492 Ga0395900_0784492_76_768 217
53 3300039447 Ga0436361_0014121 Ga0436361_0014121_391_1083 217
54 3300039447 Ga0436361_0970117 Ga0436361_0970117_683_1375 217
55 3300039447 Ga0436361_1131699 Ga0436361_1131699_7240_7932 217
56 3300048903 Ga0496100_0433879 Ga0496100_0433879_290_982 217
57 3300048905 Ga0496102_0427980 Ga0496102_0427980_373_1065 217
58 3300049568 Ga0501031_0021430 Ga0501031_0021430_1690_2382 217
59 3300049572 Ga0501036_0008837 Ga0501036_0008837_4243_4935 217
60 3300049575 Ga0501039_0035318 Ga0501039_0035318_2871_3563 217
61 3300049576 Ga0501040_0376357 Ga0501040_0376357_301_993 217
62 3300049577 Ga0501041_0022985 Ga0501041_0022985_1914_2606 217
63 3300049578 Ga0501042_0275640 Ga0501042_0275640_349_1041 217
64 3300049580 Ga0501046_0031455 Ga0501046_0031455_3173_3865 217
65 3300049584 Ga0501068_0074977 Ga0501068_0074977_1260_1952 217
66 3300049586 Ga0501070_0304459 Ga0501070_0304459_357_1049 217
67 3300049588 Ga0501072_0293487 Ga0501072_0293487_229_921 217
68 3300049590 Ga0501074_0034189 Ga0501074_0034189_201_893 217
69 3300049592 Ga0501076_0096078 Ga0501076_0096078_571_1263 217
70 3300049743 Ga0501081_0101087 Ga0501081_0101087_1330_2022 217
71 3300049824 Ga0501045_0122667 Ga0501045_0122667_596_1288 217
72 3300050516 nmdc:mga0sz30_9273_c1 nmdc:mga0sz30_9273_c1_535_1242 217
73 3300060353 Ga0501082_0507081 Ga0501082_0507081_162_854 217
74 3300061734 Ga0530510_0186909 Ga0530510_0186909_218_910 217
75 iso_pu_bacteria 2903448605 2903451434 217
76 iso_pu_bacteria 2968083720 2968086017 217
77 3300005295 Ga0065707_10345829 Ga0065707_103458292 218
78 3300005327 Ga0070658_10064908 Ga0070658_100649082 218
79 3300005330 Ga0070690_100074820 Ga0070690_1000748202 218
80 3300005333 Ga0070677_10004955 Ga0070677_100049552 218
81 3300005334 Ga0068869_100298712 Ga0068869_1002987121 218
82 3300005335 Ga0070666_10404558 Ga0070666_104045581 218
83 3300005336 Ga0070680_100020950 Ga0070680_1000209505 218
84 3300005338 Ga0068868_100098950 Ga0068868_1000989502 218
85 3300005340 Ga0070689_100028492 Ga0070689_1000284923 218
86 3300005340 Ga0070689_100034953 Ga0070689_1000349534 218
87 3300005344 Ga0070661_100326381 Ga0070661_1003263812 218
88 3300005353 Ga0070669_100212302 Ga0070669_1002123022 218
89 3300005354 Ga0070675_100798691 Ga0070675_1007986911 218
90 3300005355 Ga0070671_100010167 Ga0070671_1000101674 218
91 3300005355 Ga0070671_100100811 Ga0070671_1001008112 218
92 3300005355 Ga0070671_100366034 Ga0070671_1003660342 218
93 3300005356 Ga0070674_100000293 Ga0070674_10000029313 218
94 3300005356 Ga0070674_100005387 Ga0070674_1000053872 218
95 3300005356 Ga0070674_100182524 Ga0070674_1001825242 218
96 3300005364 Ga0070673_100408623 Ga0070673_1004086232 218
97 3300005364 Ga0070673_100429145 Ga0070673_1004291452 218
98 3300005366 Ga0070659_100188488 Ga0070659_1001884882 218
99 3300005366 Ga0070659_100529973 Ga0070659_1005299732 218
100 3300005367 Ga0070667_100028211 Ga0070667_1000282114 218
101 3300005434 Ga0070709_10078168 Ga0070709_100781683 218
102 3300005435 Ga0070714_100232546 Ga0070714_1002325462 218
103 3300005436 Ga0070713_100004171 Ga0070713_1000041713 218
104 3300005436 Ga0070713_100071699 Ga0070713_1000716992 218
105 3300005437 Ga0070710_10032016 Ga0070710_100320162 218
106 3300005439 Ga0070711_100588726 Ga0070711_1005887261 218
107 3300005455 Ga0070663_100261388 Ga0070663_1002613882 218
108 3300005456 Ga0070678_100088767 Ga0070678_1000887672 218
109 3300005458 Ga0070681_10015779 Ga0070681_100157793 218
110 3300005458 Ga0070681_10019071 Ga0070681_100190716 218
111 3300005459 Ga0068867_100222891 Ga0068867_1002228912 218
112 3300005466 Ga0070685_10155091 Ga0070685_101550912 218
113 3300005535 Ga0070684_100134072 Ga0070684_1001340722 218
114 3300005543 Ga0070672_100127575 Ga0070672_1001275753 218
115 3300005544 Ga0070686_100123249 Ga0070686_1001232493 218
116 3300005546 Ga0070696_100091221 Ga0070696_1000912212 218
117 3300005547 Ga0070693_100018759 Ga0070693_1000187592 218
118 3300005564 Ga0070664_100028233 Ga0070664_1000282335 218
119 3300005614 Ga0068856_100065975 Ga0068856_1000659752 218
120 3300005617 Ga0068859_100167323 Ga0068859_1001673233 218
121 3300005618 Ga0068864_100093695 Ga0068864_1000936953 218
122 3300005718 Ga0068866_10028593 Ga0068866_100285931 218
123 3300005718 Ga0068866_10148674 Ga0068866_101486742 218
124 3300005719 Ga0068861_100376689 Ga0068861_1003766892 218
125 3300005841 Ga0068863_100547210 Ga0068863_1005472102 218
126 3300005842 Ga0068858_100059605 Ga0068858_1000596053 218
127 3300005842 Ga0068858_100065139 Ga0068858_1000651393 218
128 3300005843 Ga0068860_100267854 Ga0068860_1002678542 218
129 3300005937 Ga0081455_10012668 Ga0081455_100126682 218
130 3300005983 Ga0081540_1017359 Ga0081540_10173592 218
131 3300006028 Ga0070717_10031214 Ga0070717_100312143 218
132 3300006051 Ga0075364_10196938 Ga0075364_101969382 218
133 3300006163 Ga0070715_10000587 Ga0070715_100005879 218
134 3300006173 Ga0070716_100230553 Ga0070716_1002305532 218
135 3300006178 Ga0075367_10047652 Ga0075367_100476523 218
136 3300006178 Ga0075367_10145254 Ga0075367_101452542 218
137 3300006186 Ga0075369_10013017 Ga0075369_100130173 218
138 3300006237 Ga0097621_100431996 Ga0097621_1004319962 218
139 3300006237 Ga0097621_100471922 Ga0097621_1004719221 218
140 3300006358 Ga0068871_100181732 Ga0068871_1001817322 218
141 3300006844 Ga0075428_100238490 Ga0075428_1002384902 218
142 3300006844 Ga0075428_100502699 Ga0075428_1005026992 218
143 3300006844 Ga0075428_101173885 Ga0075428_1011738851 218
144 3300006846 Ga0075430_100000015 Ga0075430_10000001564 218
145 3300006846 Ga0075430_100200698 Ga0075430_1002006982 218
146 3300006846 Ga0075430_100334569 Ga0075430_1003345692 218
147 3300006847 Ga0075431_100040641 Ga0075431_1000406414 218
148 3300006847 Ga0075431_100091380 Ga0075431_1000913802 218
149 3300006852 Ga0075433_10644771 Ga0075433_106447711 218
150 3300006880 Ga0075429_100072900 Ga0075429_1000729004 218
151 3300006881 Ga0068865_100105196 Ga0068865_1001051963 218
152 3300006881 Ga0068865_100123103 Ga0068865_1001231033 218
153 3300006914 Ga0075436_100011783 Ga0075436_1000117834 218
154 3300006931 Ga0097620_100167332 Ga0097620_1001673322 218
155 3300007076 Ga0075435_100180528 Ga0075435_1001805282 218
156 3300007076 Ga0075435_100412378 Ga0075435_1004123782 218
157 3300007788 Ga0099795_10142854 Ga0099795_101428542 218
158 3300009093 Ga0105240_10132601 Ga0105240_101326012 218
159 3300009094 Ga0111539_10429840 Ga0111539_104298402 218
160 3300009094 Ga0111539_10916175 Ga0111539_109161752 218
161 3300009098 Ga0105245_10320817 Ga0105245_103208172 218
162 3300009101 Ga0105247_10067220 Ga0105247_100672203 218
163 3300009101 Ga0105247_10085966 Ga0105247_100859662 218
164 3300009101 Ga0105247_10091798 Ga0105247_100917983 218
165 3300009147 Ga0114129_10031826 Ga0114129_100318269 218
166 3300009147 Ga0114129_10091398 Ga0114129_100913984 218
167 3300009148 Ga0105243_10057806 Ga0105243_100578062 218
168 3300009148 Ga0105243_10214121 Ga0105243_102141213 218
169 3300009174 Ga0105241_10279510 Ga0105241_102795102 218
170 3300009177 Ga0105248_10112305 Ga0105248_101123052 218
171 3300009177 Ga0105248_10576900 Ga0105248_105769002 218
172 3300009553 Ga0105249_10970958 Ga0105249_109709582 218
173 3300011119 Ga0105246_10241402 Ga0105246_102414022 218
174 3300011119 Ga0105246_10248717 Ga0105246_102487172 218
175 3300013308 Ga0157375_10327384 Ga0157375_103273843 218
176 3300014968 Ga0157379_10032682 Ga0157379_100326825 218
177 3300014969 Ga0157376_10081567 Ga0157376_100815672 218
178 3300014969 Ga0157376_10274421 Ga0157376_102744213 218
179 3300017792 Ga0163161_10309745 Ga0163161_103097451 218
180 3300021361 Ga0213872_10004392 Ga0213872_100043925 218
181 3300025245 Ga0207425_1000937 Ga0207425_10009378 218
182 3300025258 Ga0209129_1001431 Ga0209129_10014316 218
183 3300025294 Ga0209025_1072192 Ga0209025_10721922 218
184 3300025297 Ga0209758_1001297 Ga0209758_100129711 218
185 3300025898 Ga0207692_10007012 Ga0207692_100070126 218
186 3300025898 Ga0207692_10149240 Ga0207692_101492402 218
187 3300025900 Ga0207710_10040141 Ga0207710_100401412 218
188 3300025900 Ga0207710_10041909 Ga0207710_100419092 218
189 3300025901 Ga0207688_10119232 Ga0207688_101192322 218
190 3300025901 Ga0207688_10161097 Ga0207688_101610972 218
191 3300025905 Ga0207685_10035194 Ga0207685_100351943 218
192 3300025907 Ga0207645_10302724 Ga0207645_103027242 218
193 3300025911 Ga0207654_10090439 Ga0207654_100904392 218
194 3300025914 Ga0207671_10124609 Ga0207671_101246091 218
195 3300025916 Ga0207663_10026401 Ga0207663_100264012 218
196 3300025917 Ga0207660_10014807 Ga0207660_100148073 218
197 3300025923 Ga0207681_10573933 Ga0207681_105739331 218
198 3300025924 Ga0207694_10360013 Ga0207694_103600132 218
199 3300025927 Ga0207687_10096094 Ga0207687_100960942 218
200 3300025927 Ga0207687_10378769 Ga0207687_103787692 218
201 3300025928 Ga0207700_10007811 Ga0207700_100078113 218
202 3300025928 Ga0207700_10179600 Ga0207700_101796002 218
203 3300025929 Ga0207664_10014919 Ga0207664_100149196 218
204 3300025929 Ga0207664_10397439 Ga0207664_103974392 218
205 3300025932 Ga0207690_10116915 Ga0207690_101169152 218
206 3300025932 Ga0207690_10457676 Ga0207690_104576762 218
207 3300025933 Ga0207706_10025042 Ga0207706_100250423 218
208 3300025934 Ga0207686_10154962 Ga0207686_101549622 218
209 3300025936 Ga0207670_10511509 Ga0207670_105115092 218
210 3300025937 Ga0207669_10002180 Ga0207669_100021804 218
211 3300025937 Ga0207669_10430700 Ga0207669_104307002 218
212 3300025938 Ga0207704_10023604 Ga0207704_100236043 218
213 3300025938 Ga0207704_10242862 Ga0207704_102428622 218
214 3300025939 Ga0207665_10021625 Ga0207665_100216254 218
215 3300025939 Ga0207665_10116279 Ga0207665_101162792 218
216 3300025941 Ga0207711_10078057 Ga0207711_100780571 218
217 3300025941 Ga0207711_10100639 Ga0207711_101006391 218
218 3300025941 Ga0207711_10157003 Ga0207711_101570033 218
219 3300025942 Ga0207689_10102180 Ga0207689_101021803 218
220 3300025945 Ga0207679_10134428 Ga0207679_101344282 218
221 3300025949 Ga0207667_10779134 Ga0207667_107791341 218
222 3300025986 Ga0207658_10035258 Ga0207658_100352583 218
223 3300025986 Ga0207658_10101274 Ga0207658_101012743 218
224 3300026023 Ga0207677_10108699 Ga0207677_101086992 218
225 3300026035 Ga0207703_10069204 Ga0207703_100692043 218
226 3300026035 Ga0207703_10920768 Ga0207703_109207682 218
227 3300026041 Ga0207639_10121455 Ga0207639_101214553 218
228 3300026067 Ga0207678_10380214 Ga0207678_103802141 218
229 3300026078 Ga0207702_10192482 Ga0207702_101924822 218
230 3300026088 Ga0207641_10171513 Ga0207641_101715133 218
231 3300026089 Ga0207648_10058857 Ga0207648_100588572 218
232 3300026095 Ga0207676_10065015 Ga0207676_100650152 218
233 3300026116 Ga0207674_10258187 Ga0207674_102581872 218
234 3300026118 Ga0207675_100354521 Ga0207675_1003545211 218
235 3300026121 Ga0207683_10000561 Ga0207683_1000056112 218
236 3300026121 Ga0207683_10003691 Ga0207683_100036917 218
237 3300026121 Ga0207683_10058977 Ga0207683_100589774 218
238 3300027512 Ga0209179_1001999 Ga0209179_10019993 218
239 3300028577 Ga0265318_10017971 Ga0265318_100179714 218
240 3300031239 Ga0265328_10037022 Ga0265328_100370222 218
241 3300031240 Ga0265320_10014133 Ga0265320_100141335 218
242 3300031241 Ga0265325_10010357 Ga0265325_100103572 218
243 3300031241 Ga0265325_10191949 Ga0265325_101919492 218
244 3300031247 Ga0265340_10008869 Ga0265340_100088695 218
245 3300031249 Ga0265339_10010715 Ga0265339_100107152 218
246 3300031250 Ga0265331_10030135 Ga0265331_100301354 218
247 3300031344 Ga0265316_10313528 Ga0265316_103135282 218
248 3300031711 Ga0265314_10046751 Ga0265314_100467511 218
249 3300031711 Ga0265314_10179599 Ga0265314_101795992 218
250 3300031712 Ga0265342_10008547 Ga0265342_100085472 218
251 3300031712 Ga0265342_10011532 Ga0265342_100115321 218
252 3300034957 Ga0373938_0006154 Ga0373938_0006154_133_828 218
253 3300035117 Ga0373953_0006517 Ga0373953_0006517_1813_2508 218
254 3300035725 Ga0373947_0051838 Ga0373947_0051838_861_1556 218
255 3300036401 Ga0373937_0002159 Ga0373937_0002159_9166_9861 218
256 3300037853 Ga0436364_1272475 Ga0436364_1272475_341_1042 218
257 3300039437 Ga0436365_1535819 Ga0436365_1535819_79_777 218
258 3300039437 Ga0436365_1582316 Ga0436365_1582316_52_747 218
259 3300039447 Ga0436361_0014220 Ga0436361_0014220_2701_3405 218
260 3300039447 Ga0436361_0120866 Ga0436361_0120866_858_1562 218
261 3300039447 Ga0436361_0466866 Ga0436361_0466866_3615_4319 218
262 3300039450 Ga0436363_0734502 Ga0436363_0734502_537_1232 218
263 3300039453 Ga0436362_0575058 Ga0436362_0575058_124_819 218
264 3300039453 Ga0436362_1290531 Ga0436362_1290531_669_1370 218
265 3300042156 Ga0439446_0039710 Ga0439446_0039710_627_1322 218
266 3300046460 Ga0495638_0010559 Ga0495638_0010559_402_1097 218
267 3300046539 Ga0495621_0001314 Ga0495621_0001314_1018_1713 218
268 3300046615 Ga0495656_0018672 Ga0495656_0018672_611_1306 218
269 3300046664 Ga0495659_0127261 Ga0495659_0127261_10_705 218
270 3300046689 Ga0495613_0294370 Ga0495613_0294370_73_768 218
271 3300047317 Ga0495604_0312506 Ga0495604_0312506_42_737 218
272 3300047320 Ga0495672_0084015 Ga0495672_0084015_327_1022 218
273 3300047471 Ga0495684_0253648 Ga0495684_0253648_160_855 218
274 3300048903 Ga0496100_0019076 Ga0496100_0019076_3293_3991 218
275 3300048903 Ga0496100_0102838 Ga0496100_0102838_852_1547 218
276 3300048904 Ga0496101_0016510 Ga0496101_0016510_2433_3131 218
277 3300048905 Ga0496102_0189492 Ga0496102_0189492_406_1104 218
278 3300048906 Ga0496103_0084966 Ga0496103_0084966_311_1009 218
279 3300048907 Ga0496104_0082787 Ga0496104_0082787_2141_2839 218
280 3300048908 Ga0496105_0225199 Ga0496105_0225199_213_911 218
281 3300048909 Ga0496106_0006359 Ga0496106_0006359_6582_7280 218
282 3300048909 Ga0496106_0527727 Ga0496106_0527727_95_793 218
283 3300048910 Ga0496107_0009537 Ga0496107_0009537_2424_3122 218
284 3300048911 Ga0496108_0169129 Ga0496108_0169129_1119_1814 218
285 3300048911 Ga0496108_0220702 Ga0496108_0220702_671_1369 218
286 3300048912 Ga0496109_0027787 Ga0496109_0027787_4322_5023 218
287 3300048912 Ga0496109_0154979 Ga0496109_0154979_1272_1967 218
288 3300048912 Ga0496109_0348234 Ga0496109_0348234_475_1173 218
289 3300048913 Ga0496110_0190696 Ga0496110_0190696_40_741 218
290 3300048913 Ga0496110_0330532 Ga0496110_0330532_339_1034 218
291 3300048914 Ga0496111_0008982 Ga0496111_0008982_2884_3585 218
292 3300048914 Ga0496111_0135731 Ga0496111_0135731_977_1672 218
293 3300048914 Ga0496111_0319803 Ga0496111_0319803_64_759 218
294 3300048915 Ga0496112_0115860 Ga0496112_0115860_303_998 218
295 3300048915 Ga0496112_0126060 Ga0496112_0126060_488_1186 218
296 3300048916 Ga0496113_0065824 Ga0496113_0065824_2008_2706 218
297 3300048916 Ga0496113_0093422 Ga0496113_0093422_404_1099 218
298 3300048917 Ga0496114_0013746 Ga0496114_0013746_2407_3105 218
299 3300048917 Ga0496114_0027347 Ga0496114_0027347_3614_4309 218
300 3300048918 Ga0496115_0020151 Ga0496115_0020151_3603_4301 218
301 3300049568 Ga0501031_0004297 Ga0501031_0004297_3234_3929 218
302 3300049568 Ga0501031_0042979 Ga0501031_0042979_2213_2908 218
303 3300049569 Ga0501032_0007576 Ga0501032_0007576_4495_5190 218
304 3300049569 Ga0501032_0030532 Ga0501032_0030532_2044_2739 218
305 3300049570 Ga0501033_0016304 Ga0501033_0016304_4016_4711 218
306 3300049570 Ga0501033_0057564 Ga0501033_0057564_1783_2478 218
307 3300049571 Ga0501034_0015566 Ga0501034_0015566_5890_6585 218
308 3300049571 Ga0501034_0021392 Ga0501034_0021392_2046_2741 218
309 3300049572 Ga0501036_0006244 Ga0501036_0006244_5315_6010 218
310 3300049572 Ga0501036_0042273 Ga0501036_0042273_315_1010 218
311 3300049573 Ga0501037_0002448 Ga0501037_0002448_6195_6890 218
312 3300049573 Ga0501037_0025334 Ga0501037_0025334_2556_3251 218
313 3300049574 Ga0501038_0021656 Ga0501038_0021656_2301_2996 218
314 3300049579 Ga0501043_0010839 Ga0501043_0010839_2477_3172 218
315 3300049580 Ga0501046_0007397 Ga0501046_0007397_70_765 218
316 3300049580 Ga0501046_0104742 Ga0501046_0104742_224_919 218
317 3300049581 Ga0501047_0016961 Ga0501047_0016961_2301_2996 218
318 3300049581 Ga0501047_0036022 Ga0501047_0036022_311_1006 218
319 3300049581 Ga0501047_0089527 Ga0501047_0089527_234_929 218
320 3300049581 Ga0501047_0391419 Ga0501047_0391419_498_1193 218
321 3300049581 Ga0501047_0634611 Ga0501047_0634611_178_876 218
322 3300049582 Ga0501048_0001904 Ga0501048_0001904_6095_6790 218
323 3300049583 Ga0501067_0001082 Ga0501067_0001082_6119_6814 218
324 3300049583 Ga0501067_0329897 Ga0501067_0329897_58_753 218
325 3300049585 Ga0501069_0001841 Ga0501069_0001841_6264_6959 218
326 3300049586 Ga0501070_0019204 Ga0501070_0019204_2301_2996 218
327 3300049587 Ga0501071_0041764 Ga0501071_0041764_891_1586 218
328 3300049589 Ga0501073_0006258 Ga0501073_0006258_5447_6142 218
329 3300049590 Ga0501074_0002766 Ga0501074_0002766_5447_6142 218
330 3300049742 Ga0501080_0027706 Ga0501080_0027706_918_1613 218
331 3300049744 Ga0501083_0006017 Ga0501083_0006017_5020_5715 218
332 3300049744 Ga0501083_0145779 Ga0501083_0145779_37_732 218
333 3300049822 Ga0501035_0004725 Ga0501035_0004725_5642_6337 218
334 3300049822 Ga0501035_0007763 Ga0501035_0007763_4923_5618 218
335 3300049823 Ga0501044_0000426 Ga0501044_0000426_24858_25553 218
336 3300049823 Ga0501044_0048524 Ga0501044_0048524_2772_3467 218
337 3300049823 Ga0501044_0163982 Ga0501044_0163982_1274_1969 218
338 3300049823 Ga0501044_0394495 Ga0501044_0394495_524_1219 218
339 3300049823 Ga0501044_0495754 Ga0501044_0495754_403_1098 218
340 3300049823 Ga0501044_0620371 Ga0501044_0620371_71_769 218
341 3300049824 Ga0501045_0012705 Ga0501045_0012705_686_1381 218
342 3300050493 nmdc:mga0k408_5410_c1 nmdc:mga0k408_5410_c1_347_1042 218
343 3300050494 nmdc:mga06z11_236540_c1 nmdc:mga06z11_236540_c1_139_834 218
344 3300050495 nmdc:mga04h51_193860_c1 nmdc:mga04h51_193860_c1_24_719 218
345 3300050496 nmdc:mga07m45_97768_c1 nmdc:mga07m45_97768_c1_89_784 218
346 3300050507 nmdc:mga05p37_37783_c1 nmdc:mga05p37_37783_c1_1615_2310 218
347 3300050507 nmdc:mga05p37_409266_c1 nmdc:mga05p37_409266_c1_377_1072 218
348 3300050509 nmdc:mga0qj67_168_c1 nmdc:mga0qj67_168_c1_17388_18083 218
349 3300050509 nmdc:mga0qj67_207669_c1 nmdc:mga0qj67_207669_c1_11_706 218
350 3300050509 nmdc:mga0qj67_89484_c1 nmdc:mga0qj67_89484_c1_564_1259 218
351 3300050510 nmdc:mga06r32_27457_c1 nmdc:mga06r32_27457_c1_2148_2843 218
352 3300050510 nmdc:mga06r32_747006_c1 nmdc:mga06r32_747006_c1_29_724 218
353 3300050512 nmdc:mga0n895_963072_c1 nmdc:mga0n895_963072_c1_12_707 218
354 3300050513 nmdc:mga0rr50_124518_c1 nmdc:mga0rr50_124518_c1_1138_1833 218
355 3300050514 nmdc:mga08x19_201835_c1 nmdc:mga08x19_201835_c1_40_735 218
356 3300050514 nmdc:mga08x19_5083_c1 nmdc:mga08x19_5083_c1_268_963 218
357 3300050516 nmdc:mga0sz30_10195_c1 nmdc:mga0sz30_10195_c1_2717_3412 218
358 3300053077 Ga0495601_0138034 Ga0495601_0138034_174_869 218
359 3300053085 Ga0495619_0049867 Ga0495619_0049867_1032_1727 218
360 3300053085 Ga0495619_0210380 Ga0495619_0210380_254_949 218
361 3300053090 Ga0500646_0040040 Ga0500646_0040040_293_988 218
362 3300053096 Ga0500641_0006721 Ga0500641_0006721_643_1338 218
363 3300054114 Ga0501084_0022645 Ga0501084_0022645_1887_2582 218
364 3300054114 Ga0501084_0344514 Ga0501084_0344514_33_728 218
365 3300060353 Ga0501082_0009445 Ga0501082_0009445_3081_3776 218
366 3300060353 Ga0501082_0017393 Ga0501082_0017393_920_1615 218
367 3300060353 Ga0501082_0283219 Ga0501082_0283219_47_742 218
368 iso_pu_bacteria 2926760298 2926762334 218
369 iso_pu_bacteria 2979089926 2979092396 218
370 iso_pu_bacteria 2979095461 2979100214 218
371 iso_pu_bacteria 2984509177 2984513839 218
372 iso_pu_bacteria 2984518228 2984522584 218
373 iso_pu_bacteria 2984537506 2984541889 218
374 iso_pu_bacteria 650716007 650741028 218
375 3300049581 Ga0501047_0241703 Ga0501047_0241703_817_1521 219
376 3300053153 Ga0500616_0203517 Ga0500616_0203517_94_792 219
377 3300003187 JGI25151J46595_10020357 JGI25151J46595_100203572 220
378 3300003856 Ga0058692_1003757 Ga0058692_10037571 220
379 3300009147 Ga0114129_10619148 Ga0114129_106191482 220
380 3300009148 Ga0105243_10003690 Ga0105243_1000369013 220
381 3300025245 Ga0207425_1022417 Ga0207425_10224172 220
382 3300025258 Ga0209129_1000377 Ga0209129_100037730 220
383 3300025294 Ga0209025_1000469 Ga0209025_100046947 220
384 3300025294 Ga0209025_1006466 Ga0209025_10064663 220
385 3300025297 Ga0209758_1000563 Ga0209758_100056344 220
386 3300031247 Ga0265340_10020305 Ga0265340_100203052 220
387 3300031595 Ga0265313_10019904 Ga0265313_100199042 220
388 3300048920 Ga0496117_0004556 Ga0496117_0004556_4656_5357 220
389 3300048925 Ga0496122_0000606 Ga0496122_0000606_34532_35233 220
390 3300048926 Ga0496123_0000450 Ga0496123_0000450_34582_35283 220
391 3300048927 Ga0496124_0000704 Ga0496124_0000704_16189_16890 220
392 3300048928 Ga0496125_0003535 Ga0496125_0003535_13933_14634 220
393 3300048929 Ga0496126_0006808 Ga0496126_0006808_117_818 220
394 3300050507 nmdc:mga05p37_549924_c1 nmdc:mga05p37_549924_c1_488_1195 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

64

268

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8003 9 205
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7736 7 206
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7664 8 209
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7626 6 210
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7529 7 208
ID Description Score Start End Superfamily
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8799 5 211 1.10.3720.10
af_P9WG13_10_255_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8494 1 207 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.841 3 214 1.10.3720.10
af_Q2FVX5_4_220_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8336 12 212 1.10.3720.10
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8283 9 215 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A377DIU0-F1-model_v4 Molybdenum ABC transporter permease 0.9869 5 107 GO:0005886
GO:0055085
AF-A0A434REF0-F1-model_v4 Molybdate ABC transporter permease subunit 0.9844 4 120 GO:0005886
GO:0055085
AF-A0A522WEJ5-F1-model_v4 Molybdate ABC transporter permease subunit 0.9726 5 109 GO:0005886
GO:0055085
AF-A0A530MQN9-F1-model_v4 deleted 0.9627 1 111
AF-A0A377DIU0-F1-model_v4 Molybdenum ABC transporter permease 0.9593 5 107 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
79.06 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map