F433017

General Info

Members Datasets Scaffolds Average Seq Length
394 273 788 350

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0160360|Ga0496105_0160360_94_1233
Length 379
Sequence MPRIVRSRAGQVGRAARCHHHRRGMNETASANPILVEVMRGPIVESRHAGAIAVSDANGRLLVAFGDVERPIYPRSAVKAMQAIPLIESGGADAFDLNDDALAVACSSHSGDAVHLEAVRSLLAKARLDESYLACGAHWPVSEEMTRALMRAGRRPQPLHNNCSGKHAGMLAAAVALGLEPRGYEQPDHPLQVMIARIISETCGTALDRGRMGVDGCSVPTWAIPLSALARGFARLGNGEGLTPELTSAMRRLVAACFASPVLVAGDGRLDTVVMAALAPEIFMKGGAEGVHCAALPELGLGIALKIDDGAKRAAERALSEVLVALVPRAMHVLAAQLEGELLNWRGISIGRLTASAELQHAVATLAQDSGLQLNRAAQ

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
251 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
271 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
272 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
273 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 0
Rhizoplane 7.61
Rhizosphere 89.34
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0160360 3300048908 Bacteria 1846
2 JGI25165J46597_1004255 3300003214 Bacteria 3146
3 JGI25165J46597_1005490 3300003214 Bacteria 2431
4 Ga0070676_10125182 3300005328 Bacteria 1618
5 Ga0070683_100333614 3300005329 Bacteria 1444
6 Ga0070690_100002469 3300005330 Bacteria 9944
7 Ga0070670_100004802 3300005331 Bacteria 11346
8 Ga0070670_100010109 3300005331 Bacteria 8049
9 Ga0068869_100195670 3300005334 Bacteria 1592
10 Ga0070680_100002239 3300005336 Bacteria 14265
11 Ga0070680_100323615 3300005336 Unclassified 1309
12 Ga0070682_100000739 3300005337 Bacteria 19554
13 Ga0068868_100065451 3300005338 Bacteria 2888
14 Ga0070660_100004563 3300005339 Bacteria 9576
15 Ga0070689_100020546 3300005340 Bacteria 4902
16 Ga0070689_100021466 3300005340 Bacteria 4808
17 Ga0070691_10001230 3300005341 Bacteria 10786
18 Ga0070687_100041666 3300005343 Bacteria 2321
19 Ga0070661_100000594 3300005344 Bacteria 27156
20 Ga0070692_10000131 3300005345 Bacteria 17808
21 Ga0070668_100000672 3300005347 Bacteria 23195
22 Ga0070668_100056531 3300005347 Bacteria 3031
23 Ga0070669_100012818 3300005353 Bacteria 5953
24 Ga0070675_100031837 3300005354 Bacteria 4265
25 Ga0070675_100111107 3300005354 Bacteria 2319
26 Ga0070671_100004459 3300005355 Bacteria 11082
27 Ga0070671_100010916 3300005355 Bacteria 7295
28 Ga0070674_100000551 3300005356 Bacteria 18799
29 Ga0070673_100003383 3300005364 Bacteria 9924
30 Ga0070673_100006352 3300005364 Bacteria 7679
31 Ga0070688_100000261 3300005365 Bacteria 27517
32 Ga0070659_100311993 3300005366 Bacteria 1313
33 Ga0070667_100000309 3300005367 Bacteria 54617
34 Ga0070703_10001582 3300005406 Bacteria 6771
35 Ga0070709_10006269 3300005434 Bacteria 6477
36 Ga0070714_100004416 3300005435 Bacteria 10585
37 Ga0070713_100095651 3300005436 Bacteria 2563
38 Ga0070710_10001969 3300005437 Bacteria 9735
39 Ga0070701_10000109 3300005438 Bacteria 23593
40 Ga0070711_100001710 3300005439 Bacteria 12161
41 Ga0070705_100000306 3300005440 Bacteria 28990
42 Ga0070705_100177025 3300005440 Bacteria 1441
43 Ga0070700_100000858 3300005441 Bacteria 15009
44 Ga0070694_100000201 3300005444 Bacteria 31692
45 Ga0070663_100002080 3300005455 Bacteria 11187
46 Ga0070678_100000371 3300005456 Bacteria 20997
47 Ga0070662_100003173 3300005457 Bacteria 10217
48 Ga0070681_10063733 3300005458 Bacteria 3658
49 Ga0070685_10002693 3300005466 Bacteria 9095
50 Ga0070699_100183010 3300005518 Bacteria 1860
51 Ga0070697_100102878 3300005536 Bacteria 2374
52 Ga0068853_100008006 3300005539 Bacteria 8477
53 Ga0068853_100009809 3300005539 Bacteria 7727
54 Ga0070672_100009393 3300005543 Bacteria 6741
55 Ga0070686_100009433 3300005544 Bacteria 5487
56 Ga0070695_100002621 3300005545 Bacteria 10395
57 Ga0070696_100203668 3300005546 Bacteria 1478
58 Ga0070693_100000082 3300005547 Bacteria 39617
59 Ga0070665_100038317 3300005548 Bacteria 4819
60 Ga0070704_100004752 3300005549 Bacteria 7861
61 Ga0068855_100011575 3300005563 Bacteria 10655
62 Ga0068855_100046570 3300005563 Bacteria 5126
63 Ga0070664_100007238 3300005564 Bacteria 8949
64 Ga0068854_100001020 3300005578 Bacteria 16803
65 Ga0068856_100005453 3300005614 Bacteria 12532
66 Ga0070702_100005932 3300005615 Bacteria 5739
67 Ga0068852_100004381 3300005616 Bacteria 9976
68 Ga0068859_100017666 3300005617 Bacteria 7171
69 Ga0068859_100140464 3300005617 Bacteria 2489
70 Ga0068866_10001833 3300005718 Bacteria 8934
71 Ga0068861_100000793 3300005719 Bacteria 19034
72 Ga0068863_100008742 3300005841 Bacteria 9890
73 Ga0068858_100018181 3300005842 Bacteria 6584
74 Ga0068860_100008473 3300005843 Bacteria 10247
75 Ga0081455_10002618 3300005937 Bacteria 21329
76 Ga0081455_10003018 3300005937 Bacteria 19627
77 Ga0081455_10065441 3300005937 Bacteria 3040
78 Ga0081538_10032336 3300005981 Bacteria 3508
79 Ga0081540_1000140 3300005983 Bacteria 75770
80 Ga0081539_10063112 3300005985 Bacteria 2023
81 Ga0070717_10186107 3300006028 Bacteria 1812
82 Ga0075363_100052618 3300006048 Bacteria 2174
83 Ga0070715_10000268 3300006163 Bacteria 12528
84 Ga0070716_100000735 3300006173 Bacteria 13984
85 Ga0070712_100000481 3300006175 Bacteria 22814
86 Ga0070712_100049290 3300006175 Bacteria 2924
87 Ga0097621_100091657 3300006237 Bacteria 2544
88 Ga0075428_100046681 3300006844 Bacteria 4757
89 Ga0075428_100048450 3300006844 Bacteria 4664
90 Ga0075431_100024636 3300006847 Bacteria 6169
91 Ga0075433_10036517 3300006852 Bacteria 4234
92 Ga0075433_10053682 3300006852 Bacteria 3514
93 Ga0075434_100046032 3300006871 Bacteria 4329
94 Ga0075434_100092056 3300006871 Bacteria 3034
95 Ga0075434_100207542 3300006871 Bacteria 1980
96 Ga0075429_100012885 3300006880 Bacteria 7255
97 Ga0068865_100004493 3300006881 Bacteria 8421
98 Ga0068865_100052427 3300006881 Bacteria 2827
99 Ga0075436_100004532 3300006914 Bacteria 9523
100 Ga0097620_100017666 3300006931 Bacteria 7171
101 Ga0097620_100140467 3300006931 Bacteria 2489
102 Ga0075435_100038302 3300007076 Bacteria 3822
103 Ga0105250_10005576 3300009092 Bacteria 5629
104 Ga0105240_10010367 3300009093 Bacteria 13111
105 Ga0111539_10043059 3300009094 Bacteria 5416
106 Ga0111539_10184963 3300009094 Unclassified 2433
107 Ga0105245_10001377 3300009098 Bacteria 22006
108 Ga0105247_10025828 3300009101 Bacteria 3545
109 Ga0114129_10118426 3300009147 Bacteria 3648
110 Ga0114129_10252788 3300009147 Bacteria 2365
111 Ga0105243_10000688 3300009148 Bacteria 32874
112 Ga0105243_10143384 3300009148 Bacteria 2041
113 Ga0105241_10000949 3300009174 Bacteria 21950
114 Ga0105242_10026344 3300009176 Bacteria 4608
115 Ga0105248_10018034 3300009177 Bacteria 7791
116 Ga0105248_10085248 3300009177 Bacteria 3555
117 Ga0105237_10000091 3300009545 Bacteria 122477
118 Ga0105237_10001143 3300009545 Bacteria 35677
119 Ga0105238_10408840 3300009551 Bacteria 1351
120 Ga0105249_10002187 3300009553 Bacteria 16923
121 Ga0099796_10013354 3300010159 Bacteria 2344
122 Ga0105239_10000793 3300010375 Bacteria 44855
123 Ga0105246_10004905 3300011119 Bacteria 8153
124 Ga0157371_10002294 3300013102 Bacteria 18437
125 Ga0157369_10006075 3300013105 Bacteria 14017
126 Ga0157374_10007065 3300013296 Bacteria 9559
127 Ga0157378_10001300 3300013297 Bacteria 22460
128 Ga0157378_10011799 3300013297 Bacteria 7651
129 Ga0163162_10009653 3300013306 Bacteria 9384
130 Ga0157372_10009779 3300013307 Bacteria 10199
131 Ga0157372_10232035 3300013307 Bacteria 2140
132 Ga0157375_10030328 3300013308 Bacteria 5098
133 Ga0157375_10183121 3300013308 Bacteria 2247
134 Ga0163163_10001334 3300014325 Bacteria 20814
135 Ga0163163_10127423 3300014325 Bacteria 2584
136 Ga0157380_10000175 3300014326 Bacteria 37121
137 Ga0157380_10135374 3300014326 Bacteria 2108
138 Ga0157377_10000263 3300014745 Bacteria 25807
139 Ga0157379_10028495 3300014968 Bacteria 4967
140 Ga0157379_10039780 3300014968 Bacteria 4195
141 Ga0157379_10075177 3300014968 Bacteria 3024
142 Ga0157376_10000424 3300014969 Bacteria 27368
143 Ga0228598_1006331 3300024227 Bacteria 2453
144 Ga0209233_1002249 3300025261 Bacteria 7214
145 Ga0209051_1060797 3300025303 Bacteria 1190
146 Ga0207653_10011837 3300025885 Bacteria 2722
147 Ga0207692_10009303 3300025898 Bacteria 4097
148 Ga0207710_10002075 3300025900 Bacteria 9497
149 Ga0207710_10062610 3300025900 Bacteria 1691
150 Ga0207688_10016085 3300025901 Bacteria 4056
151 Ga0207647_10012365 3300025904 Bacteria 5943
152 Ga0207685_10032633 3300025905 Bacteria 1875
153 Ga0207699_10087382 3300025906 Bacteria 1949
154 Ga0207645_10007622 3300025907 Bacteria 7628
155 Ga0207707_10088021 3300025912 Bacteria 2713
156 Ga0207671_10000095 3300025914 Bacteria 137647
157 Ga0207693_10000207 3300025915 Bacteria 53977
158 Ga0207693_10026374 3300025915 Bacteria 4599
159 Ga0207663_10020349 3300025916 Bacteria 3756
160 Ga0207662_10039394 3300025918 Bacteria 2772
161 Ga0207657_10000526 3300025919 Bacteria 40560
162 Ga0207649_10001659 3300025920 Bacteria 12873
163 Ga0207652_10029852 3300025921 Bacteria 4563
164 Ga0207694_10109214 3300025924 Bacteria 2199
165 Ga0207650_10041986 3300025925 Bacteria 3354
166 Ga0207659_10006974 3300025926 Bacteria 6942
167 Ga0207659_10047134 3300025926 Bacteria 3047
168 Ga0207687_10034125 3300025927 Bacteria 3454
169 Ga0207700_10073826 3300025928 Bacteria 2636
170 Ga0207664_10004150 3300025929 Bacteria 9777
171 Ga0207664_10013592 3300025929 Bacteria 5850
172 Ga0207664_10179595 3300025929 Bacteria 1816
173 Ga0207644_10003302 3300025931 Bacteria 10425
174 Ga0207706_10000148 3300025933 Bacteria 76563
175 Ga0207706_10279835 3300025933 Bacteria 1455
176 Ga0207706_10374554 3300025933 Bacteria 1236
177 Ga0207686_10018799 3300025934 Bacteria 3918
178 Ga0207670_10008519 3300025936 Bacteria 5794
179 Ga0207669_10013854 3300025937 Bacteria 4023
180 Ga0207704_10014035 3300025938 Bacteria 4034
181 Ga0207665_10000294 3300025939 Bacteria 34482
182 Ga0207691_10007366 3300025940 Bacteria 10602
183 Ga0207691_10053786 3300025940 Bacteria 3674
184 Ga0207689_10198858 3300025942 Bacteria 1654
185 Ga0207651_10006602 3300025960 Bacteria 6094
186 Ga0207651_10231122 3300025960 Bacteria 1501
187 Ga0207712_10004341 3300025961 Bacteria 8956
188 Ga0207668_10045053 3300025972 Bacteria 3006
189 Ga0207668_10105471 3300025972 Bacteria 2103
190 Ga0207640_10012113 3300025981 Bacteria 4903
191 Ga0207658_10005086 3300025986 Bacteria 9046
192 Ga0207658_10106360 3300025986 Bacteria 2209
193 Ga0207677_10049131 3300026023 Bacteria 2845
194 Ga0207703_10119759 3300026035 Bacteria 2258
195 Ga0207639_10005527 3300026041 Bacteria 8543
196 Ga0207639_10126035 3300026041 Bacteria 2112
197 Ga0207678_10000415 3300026067 Bacteria 38523
198 Ga0207708_10000685 3300026075 Bacteria 25730
199 Ga0207708_10032807 3300026075 Bacteria 3943
200 Ga0207708_10059109 3300026075 Bacteria 2926
201 Ga0207641_10246635 3300026088 Bacteria 1666
202 Ga0207676_10012142 3300026095 Bacteria 6165
203 Ga0207674_10000211 3300026116 Bacteria 71986
204 Ga0207675_100000491 3300026118 Bacteria 38393
205 Ga0207683_10001381 3300026121 Bacteria 21885
206 Ga0207683_10271779 3300026121 Bacteria 1548
207 Ga0207698_10228915 3300026142 Bacteria 1686
208 Ga0209998_10005522 3300027717 Bacteria 2642
209 Ga0207428_10019758 3300027907 Bacteria 5740
210 Ga0207428_10061935 3300027907 Unclassified 2960
211 Ga0207428_10172913 3300027907 Bacteria 1635
212 Ga0268266_10000417 3300028379 Bacteria 64608
213 Ga0268266_10099273 3300028379 Bacteria 2563
214 Ga0268266_10415001 3300028379 Bacteria 1275
215 Ga0268265_10031760 3300028380 Bacteria 3816
216 Ga0307515_10016569 3300028794 Bacteria 13487
217 Ga0265338_10009328 3300028800 Bacteria 11724
218 Ga0265325_10003068 3300031241 Bacteria 11034
219 Ga0265339_10000077 3300031249 Bacteria 84288
220 Ga0307408_100148568 3300031548 Bacteria 1848
221 Ga0265313_10003775 3300031595 Bacteria 12021
222 Ga0265314_10024265 3300031711 Bacteria 4600
223 Ga0307414_10169391 3300032004 Bacteria 1744
224 Ga0373943_0118734 3300035170 Bacteria 1403
225 Ga0373946_0046901 3300035171 Bacteria 1793
226 Ga0373924_0044939 3300035410 Bacteria 1816
227 Ga0373931_0004600 3300035691 Bacteria 6313
228 Ga0373935_0036221 3300035692 Bacteria 3084
229 Ga0373927_0010783 3300035695 Bacteria 6088
230 Ga0373947_0203401 3300035725 Bacteria 1296
231 Ga0373937_0092032 3300036401 Bacteria 2810
232 Ga0373937_0227118 3300036401 Bacteria 1757
233 Ga0373925_0011939 3300037068 Bacteria 6287
234 Ga0373925_0116845 3300037068 Bacteria 2067
235 Ga0395899_0041881 3300037312 Bacteria 3420
236 Ga0395900_0003365 3300037418 Bacteria 17264
237 Ga0395898_0062434 3300037466 Bacteria 3618
238 Ga0395898_0105307 3300037466 Bacteria 2705
239 Ga0395905_0001231 3300037471 Bacteria 31814
240 Ga0436364_0081063 3300037853 Bacteria 4309
241 Ga0436364_1040518 3300037853 Bacteria 5065
242 Ga0395901_0021692 3300038443 Bacteria 6581
243 Ga0395901_0429982 3300038443 Bacteria 1353
244 Ga0395901_0780280 3300038443 Bacteria 946
245 Ga0436361_0052829 3300039447 Bacteria 3937
246 Ga0451576_0073736 3300045051 Bacteria 3552
247 Ga0495603_0000375 3300046455 Bacteria 24256
248 Ga0495629_0000807 3300046459 Bacteria 25356
249 Ga0495641_0017868 3300046461 Bacteria 3677
250 Ga0495653_0035452 3300046463 Bacteria 3937
251 Ga0495582_0000367 3300046473 Bacteria 24654
252 Ga0495639_0022657 3300046475 Bacteria 2756
253 Ga0495594_0000732 3300046499 Bacteria 16836
254 Ga0495628_0174173 3300046516 Bacteria 1630
255 Ga0495652_0037153 3300046529 Bacteria 4227
256 Ga0495665_0007419 3300046531 Bacteria 5930
257 Ga0495640_0156588 3300046533 Bacteria 1462
258 Ga0495622_0000605 3300046557 Bacteria 20910
259 Ga0495633_0061343 3300046558 Unclassified 1761
260 Ga0495667_0032653 3300046559 Bacteria 3487
261 Ga0495634_0006507 3300046642 Bacteria 8873
262 Ga0495635_0099151 3300046663 Bacteria 1991
263 Ga0495588_0011667 3300046674 Bacteria 4130
264 Ga0495647_0004319 3300046681 Bacteria 4606
265 Ga0495658_0000669 3300046683 Bacteria 18610
266 Ga0495613_0000290 3300046689 Bacteria 46122
267 Ga0495600_0174110 3300046809 Unclassified 1388
268 Ga0495581_0014567 3300047315 Bacteria 4559
269 Ga0495604_0151756 3300047317 Unclassified 1645
270 Ga0495680_0044165 3300047322 Bacteria 3525
271 Ga0495680_0066169 3300047322 Bacteria 2766
272 Ga0495675_0024665 3300047444 Bacteria 3835
273 Ga0495593_0000102 3300047673 Bacteria 38953
274 Ga0495593_0116440 3300047673 Bacteria 1362
275 Ga0495602_0103589 3300048088 Bacteria 2329
276 Ga0495614_0000209 3300048089 Bacteria 22625
277 Ga0496100_0022423 3300048903 Bacteria 3821
278 Ga0496100_0046615 3300048903 Bacteria 2788
279 Ga0496101_0010529 3300048904 Bacteria 6108
280 Ga0496102_0042933 3300048905 Bacteria 4098
281 Ga0496102_0068281 3300048905 Bacteria 3261
282 Ga0496102_0108938 3300048905 Bacteria 2580
283 Ga0496102_0172018 3300048905 Bacteria 2039
284 Ga0496103_0029310 3300048906 Bacteria 3344
285 Ga0496103_0074128 3300048906 Bacteria 2133
286 Ga0496104_0021423 3300048907 Bacteria 5933
287 Ga0496104_0127866 3300048907 Bacteria 2440
288 Ga0496104_0402863 3300048907 Unclassified 1280
289 Ga0496105_0015202 3300048908 Bacteria 6129
290 Ga0496106_0151031 3300048909 Unclassified 1832
291 Ga0496107_0005754 3300048910 Bacteria 8480
292 Ga0496107_0063802 3300048910 Bacteria 2670
293 Ga0496107_0093504 3300048910 Bacteria 2198
294 Ga0496107_0233547 3300048910 Bacteria 1368
295 Ga0496108_0200154 3300048911 Bacteria 1733
296 Ga0496109_0021027 3300048912 Bacteria 5769
297 Ga0496109_0201442 3300048912 Bacteria 1871
298 Ga0496110_0225431 3300048913 Bacteria 1704
299 Ga0496112_0005010 3300048915 Bacteria 11368
300 Ga0496112_0012848 3300048915 Bacteria 7708
301 Ga0496112_0020346 3300048915 Bacteria 6289
302 Ga0496112_0328165 3300048915 Unclassified 1474
303 Ga0496113_0005712 3300048916 Bacteria 7793
304 Ga0496113_0200022 3300048916 Bacteria 1588
305 Ga0496113_0245500 3300048916 Bacteria 1429
306 Ga0501032_0045338 3300049569 Bacteria 2974
307 Ga0501036_0063018 3300049572 Bacteria 3140
308 Ga0501036_0079959 3300049572 Bacteria 2764
309 Ga0501036_0248737 3300049572 Bacteria 1490
310 Ga0501037_0037913 3300049573 Bacteria 3553
311 Ga0501038_0028667 3300049574 Bacteria 4945
312 Ga0501038_0270605 3300049574 Bacteria 1340
313 Ga0501039_0015961 3300049575 Bacteria 5750
314 Ga0501040_0006480 3300049576 Bacteria 7603
315 Ga0501040_0072739 3300049576 Bacteria 2375
316 Ga0501041_0029785 3300049577 Bacteria 3293
317 Ga0501042_0034911 3300049578 Bacteria 3567
318 Ga0501043_0033119 3300049579 Bacteria 4065
319 Ga0501046_0063401 3300049580 Bacteria 2886
320 Ga0501046_0259073 3300049580 Bacteria 1278
321 Ga0501047_0131569 3300049581 Bacteria 2382
322 Ga0501047_0155269 3300049581 Bacteria 2162
323 Ga0501048_0039711 3300049582 Bacteria 3374
324 Ga0501069_0130684 3300049585 Bacteria 1438
325 Ga0501070_0105490 3300049586 Bacteria 2330
326 Ga0501071_0017346 3300049587 Bacteria 4963
327 Ga0501071_0042814 3300049587 Bacteria 3245
328 Ga0501071_0077240 3300049587 Bacteria 2432
329 Ga0501072_0041723 3300049588 Bacteria 3604
330 Ga0501072_0052702 3300049588 Bacteria 3203
331 Ga0501072_0105013 3300049588 Bacteria 2246
332 Ga0501072_0163218 3300049588 Bacteria 1777
333 Ga0501073_0040660 3300049589 Bacteria 3289
334 Ga0501074_0020221 3300049590 Bacteria 4837
335 Ga0501075_0010117 3300049591 Bacteria 6617
336 Ga0501075_0017268 3300049591 Bacteria 5211
337 Ga0501075_0085277 3300049591 Bacteria 2393
338 Ga0501075_0318133 3300049591 Bacteria 1186
339 Ga0501076_0016311 3300049592 Bacteria 5631
340 Ga0501076_0101330 3300049592 Bacteria 2321
341 Ga0501076_0137943 3300049592 Bacteria 1981
342 Ga0501077_0024119 3300049593 Bacteria 3861
343 Ga0501077_0029954 3300049593 Bacteria 3462
344 Ga0501077_0031614 3300049593 Bacteria 3369
345 Ga0501198_000012 3300049649 Bacteria 113529
346 Ga0501222_000010 3300049662 Bacteria 113536
347 Ga0501079_0009321 3300049741 Bacteria 7439
348 Ga0501079_0037633 3300049741 Bacteria 3729
349 Ga0501079_0070257 3300049741 Bacteria 2704
350 Ga0501079_0089608 3300049741 Bacteria 2382
351 Ga0501079_0232810 3300049741 Bacteria 1439
352 Ga0501080_0143762 3300049742 Bacteria 2205
353 Ga0501080_0165420 3300049742 Bacteria 2041
354 Ga0501080_0180333 3300049742 Bacteria 1944
355 Ga0501080_0619800 3300049742 Bacteria 959
356 Ga0501081_0010917 3300049743 Bacteria 5937
357 Ga0501081_0017206 3300049743 Bacteria 4782
358 Ga0501081_0049533 3300049743 Bacteria 2893
359 Ga0501035_0066047 3300049822 Bacteria 3211
360 Ga0501044_0159229 3300049823 Bacteria 2236
361 Ga0501044_0324265 3300049823 Bacteria 1464
362 Ga0501045_0013684 3300049824 Bacteria 5735
363 Ga0501045_0015374 3300049824 Bacteria 5433
364 Ga0501045_0040784 3300049824 Bacteria 3376
365 Ga0501045_0097524 3300049824 Bacteria 2175
366 Ga0501045_0155430 3300049824 Bacteria 1702
367 Ga0501045_0169590 3300049824 Bacteria 1626
368 nmdc:mga03n38_119169_c1 3300050490 Bacteria 1295
369 nmdc:mga06r32_101912_c1 3300050510 Bacteria 2818
370 nmdc:mga08y16_255118_c1 3300050511 Bacteria 1812
371 nmdc:mga08y16_26430_c1 3300050511 Bacteria 6121
372 nmdc:mga0n895_144633_c1 3300050512 Bacteria 2407
373 nmdc:mga0n895_62624_c1 3300050512 Bacteria 3677
374 nmdc:mga0n895_72985_c1 3300050512 Bacteria 3406
375 nmdc:mga0rr50_224723_c1 3300050513 Bacteria 1552
376 nmdc:mga08x19_106607_c1 3300050514 Bacteria 1865
377 nmdc:mga0a205_8874_c1 3300050515 Bacteria 9158
378 nmdc:mga0sz30_43838_c1 3300050516 Bacteria 1884
379 Ga0495655_0019270 3300053083 Unclassified 1512
380 Ga0495619_0001533 3300053085 Bacteria 15223
381 Ga0501084_0045578 3300054114 Bacteria 3672
382 Ga0501084_0098157 3300054114 Bacteria 2459
383 Ga0501084_0108499 3300054114 Bacteria 2332
384 Ga0501084_0389923 3300054114 Bacteria 1177
385 Ga0501082_0018188 3300060353 Bacteria 6051
386 Ga0501082_0069028 3300060353 Bacteria 3043
387 Ga0501082_0315549 3300060353 Bacteria 1361
388 Ga0501082_0385306 3300060353 Bacteria 1223
389 Ga0530510_0034344 3300061734 Bacteria 3653
390 Ga0530510_0052427 3300061734 Bacteria 2947
391 Ga0530510_0170000 3300061734 Bacteria 1614
392 2512034594 2511231221 Bacteria 6846400
393 2897808628 2897803580 Bacteria 7000062
394 8054003882 8054002106 Bacteria 7987183
395 Ga0496105_0160360
396 JGI25165J46597_1004255
397 JGI25165J46597_1005490
398 Ga0070676_10125182
399 Ga0070683_100333614
400 Ga0070690_100002469
401 Ga0070670_100004802
402 Ga0070670_100010109
403 Ga0068869_100195670
404 Ga0070680_100002239
405 Ga0070680_100323615
406 Ga0070682_100000739
407 Ga0068868_100065451
408 Ga0070660_100004563
409 Ga0070689_100020546
410 Ga0070689_100021466
411 Ga0070691_10001230
412 Ga0070687_100041666
413 Ga0070661_100000594
414 Ga0070692_10000131
415 Ga0070668_100000672
416 Ga0070668_100056531
417 Ga0070669_100012818
418 Ga0070675_100031837
419 Ga0070675_100111107
420 Ga0070671_100004459
421 Ga0070671_100010916
422 Ga0070674_100000551
423 Ga0070673_100003383
424 Ga0070673_100006352
425 Ga0070688_100000261
426 Ga0070659_100311993
427 Ga0070667_100000309
428 Ga0070703_10001582
429 Ga0070709_10006269
430 Ga0070714_100004416
431 Ga0070713_100095651
432 Ga0070710_10001969
433 Ga0070701_10000109
434 Ga0070711_100001710
435 Ga0070705_100000306
436 Ga0070705_100177025
437 Ga0070700_100000858
438 Ga0070694_100000201
439 Ga0070663_100002080
440 Ga0070678_100000371
441 Ga0070662_100003173
442 Ga0070681_10063733
443 Ga0070685_10002693
444 Ga0070699_100183010
445 Ga0070697_100102878
446 Ga0068853_100008006
447 Ga0068853_100009809
448 Ga0070672_100009393
449 Ga0070686_100009433
450 Ga0070695_100002621
451 Ga0070696_100203668
452 Ga0070693_100000082
453 Ga0070665_100038317
454 Ga0070704_100004752
455 Ga0068855_100011575
456 Ga0068855_100046570
457 Ga0070664_100007238
458 Ga0068854_100001020
459 Ga0068856_100005453
460 Ga0070702_100005932
461 Ga0068852_100004381
462 Ga0068859_100017666
463 Ga0068859_100140464
464 Ga0068866_10001833
465 Ga0068861_100000793
466 Ga0068863_100008742
467 Ga0068858_100018181
468 Ga0068860_100008473
469 Ga0081455_10002618
470 Ga0081455_10003018
471 Ga0081455_10065441
472 Ga0081538_10032336
473 Ga0081540_1000140
474 Ga0081539_10063112
475 Ga0070717_10186107
476 Ga0075363_100052618
477 Ga0070715_10000268
478 Ga0070716_100000735
479 Ga0070712_100000481
480 Ga0070712_100049290
481 Ga0097621_100091657
482 Ga0075428_100046681
483 Ga0075428_100048450
484 Ga0075431_100024636
485 Ga0075433_10036517
486 Ga0075433_10053682
487 Ga0075434_100046032
488 Ga0075434_100092056
489 Ga0075434_100207542
490 Ga0075429_100012885
491 Ga0068865_100004493
492 Ga0068865_100052427
493 Ga0075436_100004532
494 Ga0097620_100017666
495 Ga0097620_100140467
496 Ga0075435_100038302
497 Ga0105250_10005576
498 Ga0105240_10010367
499 Ga0111539_10043059
500 Ga0111539_10184963
501 Ga0105245_10001377
502 Ga0105247_10025828
503 Ga0114129_10118426
504 Ga0114129_10252788
505 Ga0105243_10000688
506 Ga0105243_10143384
507 Ga0105241_10000949
508 Ga0105242_10026344
509 Ga0105248_10018034
510 Ga0105248_10085248
511 Ga0105237_10000091
512 Ga0105237_10001143
513 Ga0105238_10408840
514 Ga0105249_10002187
515 Ga0099796_10013354
516 Ga0105239_10000793
517 Ga0105246_10004905
518 Ga0157371_10002294
519 Ga0157369_10006075
520 Ga0157374_10007065
521 Ga0157378_10001300
522 Ga0157378_10011799
523 Ga0163162_10009653
524 Ga0157372_10009779
525 Ga0157372_10232035
526 Ga0157375_10030328
527 Ga0157375_10183121
528 Ga0163163_10001334
529 Ga0163163_10127423
530 Ga0157380_10000175
531 Ga0157380_10135374
532 Ga0157377_10000263
533 Ga0157379_10028495
534 Ga0157379_10039780
535 Ga0157379_10075177
536 Ga0157376_10000424
537 Ga0228598_1006331
538 Ga0209233_1002249
539 Ga0209051_1060797
540 Ga0207653_10011837
541 Ga0207692_10009303
542 Ga0207710_10002075
543 Ga0207710_10062610
544 Ga0207688_10016085
545 Ga0207647_10012365
546 Ga0207685_10032633
547 Ga0207699_10087382
548 Ga0207645_10007622
549 Ga0207707_10088021
550 Ga0207671_10000095
551 Ga0207693_10000207
552 Ga0207693_10026374
553 Ga0207663_10020349
554 Ga0207662_10039394
555 Ga0207657_10000526
556 Ga0207649_10001659
557 Ga0207652_10029852
558 Ga0207694_10109214
559 Ga0207650_10041986
560 Ga0207659_10006974
561 Ga0207659_10047134
562 Ga0207687_10034125
563 Ga0207700_10073826
564 Ga0207664_10004150
565 Ga0207664_10013592
566 Ga0207664_10179595
567 Ga0207644_10003302
568 Ga0207706_10000148
569 Ga0207706_10279835
570 Ga0207706_10374554
571 Ga0207686_10018799
572 Ga0207670_10008519
573 Ga0207669_10013854
574 Ga0207704_10014035
575 Ga0207665_10000294
576 Ga0207691_10007366
577 Ga0207691_10053786
578 Ga0207689_10198858
579 Ga0207651_10006602
580 Ga0207651_10231122
581 Ga0207712_10004341
582 Ga0207668_10045053
583 Ga0207668_10105471
584 Ga0207640_10012113
585 Ga0207658_10005086
586 Ga0207658_10106360
587 Ga0207677_10049131
588 Ga0207703_10119759
589 Ga0207639_10005527
590 Ga0207639_10126035
591 Ga0207678_10000415
592 Ga0207708_10000685
593 Ga0207708_10032807
594 Ga0207708_10059109
595 Ga0207641_10246635
596 Ga0207676_10012142
597 Ga0207674_10000211
598 Ga0207675_100000491
599 Ga0207683_10001381
600 Ga0207683_10271779
601 Ga0207698_10228915
602 Ga0209998_10005522
603 Ga0207428_10019758
604 Ga0207428_10061935
605 Ga0207428_10172913
606 Ga0268266_10000417
607 Ga0268266_10099273
608 Ga0268266_10415001
609 Ga0268265_10031760
610 Ga0307515_10016569
611 Ga0265338_10009328
612 Ga0265325_10003068
613 Ga0265339_10000077
614 Ga0307408_100148568
615 Ga0265313_10003775
616 Ga0265314_10024265
617 Ga0307414_10169391
618 Ga0373943_0118734
619 Ga0373946_0046901
620 Ga0373924_0044939
621 Ga0373931_0004600
622 Ga0373935_0036221
623 Ga0373927_0010783
624 Ga0373947_0203401
625 Ga0373937_0092032
626 Ga0373937_0227118
627 Ga0373925_0011939
628 Ga0373925_0116845
629 Ga0395899_0041881
630 Ga0395900_0003365
631 Ga0395898_0062434
632 Ga0395898_0105307
633 Ga0395905_0001231
634 Ga0436364_0081063
635 Ga0436364_1040518
636 Ga0395901_0021692
637 Ga0395901_0429982
638 Ga0395901_0780280
639 Ga0436361_0052829
640 Ga0451576_0073736
641 Ga0495603_0000375
642 Ga0495629_0000807
643 Ga0495641_0017868
644 Ga0495653_0035452
645 Ga0495582_0000367
646 Ga0495639_0022657
647 Ga0495594_0000732
648 Ga0495628_0174173
649 Ga0495652_0037153
650 Ga0495665_0007419
651 Ga0495640_0156588
652 Ga0495622_0000605
653 Ga0495633_0061343
654 Ga0495667_0032653
655 Ga0495634_0006507
656 Ga0495635_0099151
657 Ga0495588_0011667
658 Ga0495647_0004319
659 Ga0495658_0000669
660 Ga0495613_0000290
661 Ga0495600_0174110
662 Ga0495581_0014567
663 Ga0495604_0151756
664 Ga0495680_0044165
665 Ga0495680_0066169
666 Ga0495675_0024665
667 Ga0495593_0000102
668 Ga0495593_0116440
669 Ga0495602_0103589
670 Ga0495614_0000209
671 Ga0496100_0022423
672 Ga0496100_0046615
673 Ga0496101_0010529
674 Ga0496102_0042933
675 Ga0496102_0068281
676 Ga0496102_0108938
677 Ga0496102_0172018
678 Ga0496103_0029310
679 Ga0496103_0074128
680 Ga0496104_0021423
681 Ga0496104_0127866
682 Ga0496104_0402863
683 Ga0496105_0015202
684 Ga0496106_0151031
685 Ga0496107_0005754
686 Ga0496107_0063802
687 Ga0496107_0093504
688 Ga0496107_0233547
689 Ga0496108_0200154
690 Ga0496109_0021027
691 Ga0496109_0201442
692 Ga0496110_0225431
693 Ga0496112_0005010
694 Ga0496112_0012848
695 Ga0496112_0020346
696 Ga0496112_0328165
697 Ga0496113_0005712
698 Ga0496113_0200022
699 Ga0496113_0245500
700 Ga0501032_0045338
701 Ga0501036_0063018
702 Ga0501036_0079959
703 Ga0501036_0248737
704 Ga0501037_0037913
705 Ga0501038_0028667
706 Ga0501038_0270605
707 Ga0501039_0015961
708 Ga0501040_0006480
709 Ga0501040_0072739
710 Ga0501041_0029785
711 Ga0501042_0034911
712 Ga0501043_0033119
713 Ga0501046_0063401
714 Ga0501046_0259073
715 Ga0501047_0131569
716 Ga0501047_0155269
717 Ga0501048_0039711
718 Ga0501069_0130684
719 Ga0501070_0105490
720 Ga0501071_0017346
721 Ga0501071_0042814
722 Ga0501071_0077240
723 Ga0501072_0041723
724 Ga0501072_0052702
725 Ga0501072_0105013
726 Ga0501072_0163218
727 Ga0501073_0040660
728 Ga0501074_0020221
729 Ga0501075_0010117
730 Ga0501075_0017268
731 Ga0501075_0085277
732 Ga0501075_0318133
733 Ga0501076_0016311
734 Ga0501076_0101330
735 Ga0501076_0137943
736 Ga0501077_0024119
737 Ga0501077_0029954
738 Ga0501077_0031614
739 Ga0501198_000012
740 Ga0501222_000010
741 Ga0501079_0009321
742 Ga0501079_0037633
743 Ga0501079_0070257
744 Ga0501079_0089608
745 Ga0501079_0232810
746 Ga0501080_0143762
747 Ga0501080_0165420
748 Ga0501080_0180333
749 Ga0501080_0619800
750 Ga0501081_0010917
751 Ga0501081_0017206
752 Ga0501081_0049533
753 Ga0501035_0066047
754 Ga0501044_0159229
755 Ga0501044_0324265
756 Ga0501045_0013684
757 Ga0501045_0015374
758 Ga0501045_0040784
759 Ga0501045_0097524
760 Ga0501045_0155430
761 Ga0501045_0169590
762 nmdc:mga03n38_119169_c1
763 nmdc:mga06r32_101912_c1
764 nmdc:mga08y16_255118_c1
765 nmdc:mga08y16_26430_c1
766 nmdc:mga0n895_144633_c1
767 nmdc:mga0n895_62624_c1
768 nmdc:mga0n895_72985_c1
769 nmdc:mga0rr50_224723_c1
770 nmdc:mga08x19_106607_c1
771 nmdc:mga0a205_8874_c1
772 nmdc:mga0sz30_43838_c1
773 Ga0495655_0019270
774 Ga0495619_0001533
775 Ga0501084_0045578
776 Ga0501084_0098157
777 Ga0501084_0108499
778 Ga0501084_0389923
779 Ga0501082_0018188
780 Ga0501082_0069028
781 Ga0501082_0315549
782 Ga0501082_0385306
783 Ga0530510_0034344
784 Ga0530510_0052427
785 Ga0530510_0170000
786 2512034594
787 2897808628
788 8054003882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06089

Asparaginase_II

L-asparaginase II

36

355

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8col-assembly2.cif.gz_DDD crystal structure of rhizobium etli constitutive l-asparaginase reaiv (orthorombic form r4op-2) 0.9503 3 338
8col-assembly2.cif.gz_DDD crystal structure of rhizobium etli constitutive l-asparaginase reaiv (orthorombic form r4op-2) 0.9449 3 338
7os6-assembly2.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9153 4 331
7os3-assembly1.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav solved by s-sad (orthorhombic form start) 0.9124 6 330
7os6-assembly1.cif.gz_CCC crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9102 6 331
ID Description Score Start End Superfamily
4f3lA02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.82 22 37 3.30.450.20
af_Q9VZ85_1793_1984_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6356 253 282 2.30.29.30
af_Q86YR7_827_974_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5623 253 278 2.30.29.30
af_Q9LTJ6_57_381_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5487 248 283 2.130.10.10
3ih9B01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.5487 21 281 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A085FIS8-F1-model_v4 L-asparaginase II 0.9846 1 331
AF-A0A2D8YKU0-F1-model_v4 deleted 0.9816 1 336
AF-A0A085FIS8-F1-model_v4 L-asparaginase II 0.9787 1 331
AF-A0A3D3SP59-F1-model_v4 deleted 0.9767 1 276
AF-A0A504H937-F1-model_v4 Asparaginase 0.9734 3 295

Map