F433063

General Info

Members Datasets Scaffolds Average Seq Length
394 221 390 200

Family's Representative Sequence

Representative Sequence 3300053150|Ga0500603_091898|Ga0500603_091898_31_708
Length 225
Sequence MTPSAARRVDHHMQVQVTGKHVDVGEALRSRVSAEISSSIGKYFDREGGGADVVVSREGHAFRVDCAVTLASGQQLTTQGLGGDAHLAFDAAILKLQKRIRRYKNRLKDHHPQALARQAETTAYYILQAPDDAPDWTSDDDDLDAGPVAFPEPMIIAETETSIGVMTVSMAVHELDLTESQTIVFRNAAHGGLSVVYRRPDGNIGWIDPERTKVNGAHSDGVGRA

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
213 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
214 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
218 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.41
Nodule 0.51
Rhizoplane 4.31
Rhizosphere 78.68
Stem 0
Stem Tuber 0
Unclassified 6.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1008055 3300002741 Bacteria 1486
2 rootL2_10245929 3300003322 Unclassified 2231
3 Ga0065165_1033253 3300005262 Bacteria 1606
4 Ga0070658_10075536 3300005327 Bacteria 2764
5 Ga0070658_10083912 3300005327 Bacteria 2619
6 Ga0070658_10089444 3300005327 Bacteria 2535
7 Ga0070658_10737055 3300005327 Bacteria 856
8 Ga0070683_100805178 3300005329 Bacteria 901
9 Ga0070690_100427003 3300005330 Bacteria 978
10 Ga0070670_100000022 3300005331 Bacteria 199146
11 Ga0070670_100045878 3300005331 Bacteria 3757
12 Ga0070670_100054126 3300005331 Bacteria 3445
13 Ga0070670_100164947 3300005331 Bacteria 1920
14 Ga0070670_100266111 3300005331 Bacteria 1495
15 Ga0068869_100691710 3300005334 Bacteria 869
16 Ga0070666_10042605 3300005335 Bacteria 3038
17 Ga0070666_10067962 3300005335 Bacteria 2420
18 Ga0070666_10172054 3300005335 Bacteria 1517
19 Ga0070666_10311869 3300005335 Bacteria 1121
20 Ga0070680_100002203 3300005336 Bacteria 14363
21 Ga0070680_100036557 3300005336 Bacteria 3967
22 Ga0068868_100193077 3300005338 Bacteria 1694
23 Ga0068868_100585413 3300005338 Bacteria 987
24 Ga0070660_100056883 3300005339 Bacteria 3027
25 Ga0070660_100193404 3300005339 Bacteria 1648
26 Ga0070668_100001362 3300005347 Bacteria 17489
27 Ga0070668_100004455 3300005347 Bacteria 10393
28 Ga0070668_100009396 3300005347 Bacteria 7253
29 Ga0070668_100016289 3300005347 Bacteria 5559
30 Ga0070669_100037389 3300005353 Bacteria 3521
31 Ga0070671_100023020 3300005355 Bacteria 5091
32 Ga0070671_100464007 3300005355 Bacteria 1087
33 Ga0070659_100000973 3300005366 Bacteria 21049
34 Ga0070659_100008371 3300005366 Bacteria 7554
35 Ga0070667_100000517 3300005367 Bacteria 38882
36 Ga0070667_100004822 3300005367 Bacteria 11300
37 Ga0070678_100392332 3300005456 Bacteria 1204
38 Ga0070662_100351427 3300005457 Bacteria 1208
39 Ga0070681_10001437 3300005458 Bacteria 20966
40 Ga0068867_100696949 3300005459 Bacteria 896
41 Ga0070679_100026323 3300005530 Bacteria 5713
42 Ga0070679_100594039 3300005530 Bacteria 1050
43 Ga0070684_100086448 3300005535 Bacteria 2783
44 Ga0070684_101155433 3300005535 Bacteria 728
45 Ga0068853_100053948 3300005539 Bacteria 3463
46 Ga0068853_100073775 3300005539 Bacteria 2976
47 Ga0068853_100296177 3300005539 Bacteria 1494
48 Ga0070672_100472280 3300005543 Bacteria 1082
49 Ga0070686_100320137 3300005544 Bacteria 1156
50 Ga0070665_100000674 3300005548 Bacteria 45861
51 Ga0070665_100001038 3300005548 Bacteria 34790
52 Ga0070665_100001299 3300005548 Bacteria 29894
53 Ga0070665_100033892 3300005548 Bacteria 5136
54 Ga0070665_100131718 3300005548 Bacteria 2503
55 Ga0068855_100043094 3300005563 Bacteria 5347
56 Ga0068855_100140560 3300005563 Bacteria 2753
57 Ga0070664_100644892 3300005564 Bacteria 984
58 Ga0068854_100187713 3300005578 Bacteria 1618
59 Ga0068854_100332745 3300005578 Bacteria 1238
60 Ga0068856_100064867 3300005614 Bacteria 3609
61 Ga0068856_100131860 3300005614 Bacteria 2504
62 Ga0068856_100218490 3300005614 Bacteria 1921
63 Ga0068852_100028598 3300005616 Bacteria 4566
64 Ga0068859_100000230 3300005617 Bacteria 55064
65 Ga0068859_100020496 3300005617 Bacteria 6636
66 Ga0068859_100528044 3300005617 Bacteria 1275
67 Ga0068859_100606178 3300005617 Bacteria 1188
68 Ga0068864_100000125 3300005618 Bacteria 74686
69 Ga0068864_100000947 3300005618 Bacteria 24277
70 Ga0068864_100130646 3300005618 Bacteria 2255
71 Ga0068864_100310383 3300005618 Bacteria 1479
72 Ga0068863_100000066 3300005841 Bacteria 117816
73 Ga0068863_100000486 3300005841 Bacteria 40496
74 Ga0068863_100003612 3300005841 Bacteria 15273
75 Ga0068863_100063249 3300005841 Bacteria 3499
76 Ga0068863_100180635 3300005841 Bacteria 2025
77 Ga0068863_100293416 3300005841 Bacteria 1576
78 Ga0068858_100000136 3300005842 Bacteria 77380
79 Ga0068858_100002621 3300005842 Bacteria 18119
80 Ga0068858_100009137 3300005842 Bacteria 9477
81 Ga0068860_100000136 3300005843 Bacteria 120083
82 Ga0068860_100005899 3300005843 Bacteria 12329
83 Ga0068860_100099815 3300005843 Bacteria 2769
84 Ga0068860_100375827 3300005843 Bacteria 1402
85 Ga0068862_100012442 3300005844 Bacteria 7041
86 Ga0068862_100026726 3300005844 Bacteria 4852
87 Ga0068862_100159341 3300005844 Bacteria 2014
88 Ga0068862_100289494 3300005844 Bacteria 1504
89 Ga0068862_100948856 3300005844 Bacteria 848
90 Ga0070717_10135367 3300006028 Bacteria 2121
91 Ga0070717_10200019 3300006028 Bacteria 1750
92 Ga0075368_10018544 3300006042 Bacteria 2615
93 Ga0075364_10002249 3300006051 Bacteria 10824
94 Ga0075367_10032920 3300006178 Bacteria 2985
95 Ga0075366_10201484 3300006195 Bacteria 1211
96 Ga0075370_10365293 3300006353 Bacteria 863
97 Ga0068865_100003848 3300006881 Bacteria 8995
98 Ga0097620_100000230 3300006931 Bacteria 55064
99 Ga0097620_100020496 3300006931 Bacteria 6636
100 Ga0097620_100528070 3300006931 Bacteria 1275
101 Ga0097620_100606210 3300006931 Bacteria 1188
102 Ga0079104_1013858 3300006946 Bacteria 2464
103 Ga0105250_10014335 3300009092 Bacteria 3260
104 Ga0105240_10009140 3300009093 Bacteria 14067
105 Ga0105240_10053601 3300009093 Bacteria 5062
106 Ga0105240_10075793 3300009093 Bacteria 4148
107 Ga0105240_10080907 3300009093 Bacteria 3994
108 Ga0105240_10267707 3300009093 Bacteria 1969
109 Ga0105247_10054464 3300009101 Bacteria 2468
110 Ga0105248_10000170 3300009177 Bacteria 75642
111 Ga0105248_10014056 3300009177 Bacteria 8809
112 Ga0105248_10070558 3300009177 Bacteria 3923
113 Ga0105248_10209510 3300009177 Bacteria 2196
114 Ga0105248_10291893 3300009177 Bacteria 1836
115 Ga0105248_10451041 3300009177 Bacteria 1449
116 Ga0105248_10498564 3300009177 Bacteria 1373
117 Ga0105248_10512772 3300009177 Bacteria 1352
118 Ga0105237_10458419 3300009545 Bacteria 1281
119 Ga0105238_10628977 3300009551 Bacteria 1083
120 Ga0105238_11004018 3300009551 Bacteria 855
121 Ga0105249_10000376 3300009553 Bacteria 44283
122 Ga0105249_10644143 3300009553 Bacteria 1117
123 Ga0105249_11617532 3300009553 Bacteria 720
124 Ga0105239_10156883 3300010375 Bacteria 2542
125 Ga0105239_10330221 3300010375 Bacteria 1720
126 Ga0105239_10900710 3300010375 Unclassified 1015
127 Ga0157373_10000590 3300013100 Bacteria 28279
128 Ga0157373_10003292 3300013100 Bacteria 12203
129 Ga0157370_10057893 3300013104 Bacteria 3683
130 Ga0157369_10414768 3300013105 Bacteria 1396
131 Ga0157369_10605624 3300013105 Bacteria 1131
132 Ga0157374_10438249 3300013296 Bacteria 1307
133 Ga0157378_11254353 3300013297 Bacteria 781
134 Ga0163162_10034891 3300013306 Bacteria 5008
135 Ga0163162_10088094 3300013306 Bacteria 3184
136 Ga0157372_10036193 3300013307 Bacteria 5440
137 Ga0157375_10334831 3300013308 Bacteria 1679
138 Ga0163163_10009311 3300014325 Bacteria 8761
139 Ga0163163_10016816 3300014325 Bacteria 6808
140 Ga0163163_10018900 3300014325 Bacteria 6465
141 Ga0163163_10116368 3300014325 Bacteria 2704
142 Ga0163163_10250821 3300014325 Bacteria 1820
143 Ga0163163_10694798 3300014325 Bacteria 1081
144 Ga0157380_11038318 3300014326 Bacteria 855
145 Ga0157379_10008310 3300014968 Bacteria 9022
146 Ga0157379_10013113 3300014968 Bacteria 7256
147 Ga0157379_10051688 3300014968 Bacteria 3670
148 Ga0157376_10389542 3300014969 Bacteria 1344
149 Ga0183365_10001 3300015684 Bacteria 2090444
150 Ga0213872_10004723 3300021361 Bacteria 7150
151 Ga0213876_10097165 3300021384 Bacteria 1561
152 Ga0209026_1003980 3300025250 Bacteria 4611
153 Ga0207697_10050360 3300025315 Bacteria 1720
154 Ga0207710_10033383 3300025900 Bacteria 2257
155 Ga0207680_10025149 3300025903 Bacteria 3281
156 Ga0207705_10002531 3300025909 Bacteria 14078
157 Ga0207707_10029018 3300025912 Bacteria 4836
158 Ga0207707_10056322 3300025912 Bacteria 3420
159 Ga0207695_10004032 3300025913 Bacteria 20213
160 Ga0207695_10040171 3300025913 Bacteria 5020
161 Ga0207695_10062224 3300025913 Bacteria 3854
162 Ga0207695_10454166 3300025913 Bacteria 1164
163 Ga0207660_10006156 3300025917 Bacteria 7789
164 Ga0207660_10124885 3300025917 Bacteria 1953
165 Ga0207657_10045888 3300025919 Bacteria 3830
166 Ga0207657_10239261 3300025919 Bacteria 1450
167 Ga0207652_10000909 3300025921 Bacteria 27935
168 Ga0207652_10260842 3300025921 Bacteria 1563
169 Ga0207681_10004772 3300025923 Bacteria 8343
170 Ga0207681_10067973 3300025923 Bacteria 2473
171 Ga0207681_10164684 3300025923 Bacteria 1675
172 Ga0207694_10072322 3300025924 Bacteria 2696
173 Ga0207694_10306860 3300025924 Bacteria 1308
174 Ga0207650_10000016 3300025925 Bacteria 361958
175 Ga0207650_10022038 3300025925 Bacteria 4508
176 Ga0207650_10038595 3300025925 Bacteria 3489
177 Ga0207650_10094007 3300025925 Bacteria 2296
178 Ga0207644_10000420 3300025931 Bacteria 27556
179 Ga0207644_10039475 3300025931 Bacteria 3332
180 Ga0207690_10000496 3300025932 Bacteria 25421
181 Ga0207690_10002098 3300025932 Bacteria 12207
182 Ga0207706_10349565 3300025933 Bacteria 1286
183 Ga0207669_10377228 3300025937 Bacteria 1104
184 Ga0207704_10054128 3300025938 Bacteria 2444
185 Ga0207691_10532669 3300025940 Bacteria 996
186 Ga0207711_10001254 3300025941 Bacteria 24084
187 Ga0207711_10010422 3300025941 Bacteria 7716
188 Ga0207711_10040688 3300025941 Bacteria 3955
189 Ga0207711_10052095 3300025941 Bacteria 3507
190 Ga0207711_10096784 3300025941 Bacteria 2605
191 Ga0207711_10176115 3300025941 Bacteria 1943
192 Ga0207711_10744749 3300025941 Bacteria 913
193 Ga0207679_10007260 3300025945 Bacteria 7021
194 Ga0207679_10093319 3300025945 Bacteria 2334
195 Ga0207679_10250833 3300025945 Bacteria 1505
196 Ga0207667_10010636 3300025949 Bacteria 10740
197 Ga0207667_10142793 3300025949 Bacteria 2465
198 Ga0207712_10000606 3300025961 Bacteria 28447
199 Ga0207668_10000002 3300025972 Bacteria 209163
200 Ga0207668_10000117 3300025972 Bacteria 55600
201 Ga0207668_10005619 3300025972 Bacteria 7389
202 Ga0207668_10234081 3300025972 Bacteria 1482
203 Ga0207640_10026380 3300025981 Bacteria 3527
204 Ga0207640_10362156 3300025981 Bacteria 1169
205 Ga0207658_10001861 3300025986 Bacteria 15797
206 Ga0207658_10002954 3300025986 Bacteria 12172
207 Ga0207658_10034634 3300025986 Bacteria 3610
208 Ga0207677_10067367 3300026023 Bacteria 2508
209 Ga0207677_10441225 3300026023 Bacteria 1113
210 Ga0207703_10000065 3300026035 Bacteria 126087
211 Ga0207703_10000953 3300026035 Bacteria 27985
212 Ga0207703_10002860 3300026035 Bacteria 14716
213 Ga0207639_10021666 3300026041 Bacteria 4619
214 Ga0207639_10048909 3300026041 Bacteria 3203
215 Ga0207641_10000011 3300026088 Bacteria 384362
216 Ga0207641_10000910 3300026088 Bacteria 30634
217 Ga0207641_10006023 3300026088 Bacteria 10274
218 Ga0207641_10053844 3300026088 Bacteria 3413
219 Ga0207648_10480899 3300026089 Bacteria 1134
220 Ga0207676_10000055 3300026095 Bacteria 124678
221 Ga0207676_10000148 3300026095 Bacteria 61016
222 Ga0207676_10118250 3300026095 Bacteria 2230
223 Ga0207676_10162851 3300026095 Bacteria 1934
224 Ga0207683_10093932 3300026121 Bacteria 2673
225 Ga0207698_10389264 3300026142 Bacteria 1329
226 Ga0209281_1028134 3300027111 Unclassified 1024
227 Ga0268266_10000003 3300028379 Bacteria 1701703
228 Ga0268266_10000887 3300028379 Bacteria 38753
229 Ga0268266_10002246 3300028379 Bacteria 21046
230 Ga0268266_10064422 3300028379 Bacteria 3166
231 Ga0268266_10111098 3300028379 Bacteria 2428
232 Ga0268265_10017523 3300028380 Bacteria 4944
233 Ga0268265_10040383 3300028380 Bacteria 3446
234 Ga0268265_10078157 3300028380 Bacteria 2602
235 Ga0268264_10000265 3300028381 Bacteria 92655
236 Ga0268264_10350406 3300028381 Bacteria 1405
237 Ga0268264_10403314 3300028381 Bacteria 1314
238 Ga0268264_10561970 3300028381 Bacteria 1120
239 Ga0307517_10024240 3300028786 Bacteria 7492
240 Ga0307517_10084241 3300028786 Bacteria 2678
241 Ga0265338_10640625 3300028800 Bacteria 737
242 Ga0307511_10023353 3300030521 Bacteria 5768
243 Ga0265327_10000279 3300031251 Bacteria 100885
244 Ga0307513_10000069 3300031456 Bacteria 140558
245 Ga0307513_10000541 3300031456 Bacteria 54065
246 Ga0307513_10002925 3300031456 Bacteria 23351
247 Ga0307414_10114412 3300032004 Bacteria 2061
248 Ga0307411_10102408 3300032005 Bacteria 2029
249 Ga0307510_10020789 3300033180 Bacteria 7663
250 Ga0373944_0005738 3300035089 Bacteria 3277
251 Ga0373936_0133418 3300035113 Bacteria 1068
252 Ga0373936_0155870 3300035113 Bacteria 992
253 Ga0373946_0079812 3300035171 Bacteria 1430
254 Ga0373931_0026206 3300035691 Unclassified 2965
255 Ga0373927_0000173 3300035695 Bacteria 50996
256 Ga0373925_0000049 3300037068 Bacteria 128065
257 Ga0395899_0107437 3300037312 Bacteria 2008
258 Ga0395899_0225091 3300037312 Bacteria 1298
259 Ga0395899_0312565 3300037312 Bacteria 1060
260 Ga0395900_0196771 3300037418 Bacteria 2041
261 Ga0395900_0359722 3300037418 Bacteria 1427
262 Ga0395898_0332464 3300037466 Bacteria 1449
263 Ga0395905_0062517 3300037471 Bacteria 3483
264 Ga0395901_0195911 3300038443 Bacteria 2118
265 Ga0395901_0611410 3300038443 Bacteria 1098
266 Ga0436365_1285497 3300039437 Bacteria 1574
267 Ga0436361_0115662 3300039447 Bacteria 23940
268 Ga0466972_0032701 3300044658 Bacteria 2554
269 Ga0466968_0088271 3300044735 Bacteria 1370
270 Ga0466957_0087911 3300044842 Bacteria 1944
271 Ga0466957_0168958 3300044842 Bacteria 1424
272 Ga0495583_0010249 3300046506 Bacteria 5493
273 Ga0495583_0068969 3300046506 Bacteria 1558
274 Ga0495606_0166710 3300046507 Bacteria 1281
275 Ga0495610_0024953 3300046512 Bacteria 3219
276 Ga0495628_0049549 3300046516 Bacteria 3326
277 Ga0495643_0043074 3300046522 Bacteria 2457
278 Ga0495642_0020405 3300046528 Bacteria 2604
279 Ga0495621_0240472 3300046539 Bacteria 737
280 Ga0495597_0042362 3300046542 Bacteria 2030
281 Ga0495668_0019011 3300046616 Bacteria 3966
282 Ga0495668_0035940 3300046616 Bacteria 2777
283 Ga0495668_0056268 3300046616 Bacteria 2171
284 Ga0495668_0112697 3300046616 Bacteria 1488
285 Ga0495668_0132358 3300046616 Bacteria 1365
286 Ga0495611_0009993 3300046648 Bacteria 4015
287 Ga0495625_0053981 3300046660 Bacteria 2871
288 Ga0495625_0155460 3300046660 Bacteria 1535
289 Ga0495625_0159724 3300046660 Bacteria 1511
290 Ga0495659_0114931 3300046664 Bacteria 1054
291 Ga0495669_0000014 3300046684 Bacteria 140832
292 Ga0495669_0000447 3300046684 Bacteria 19503
293 Ga0495669_0121853 3300046684 Bacteria 1223
294 Ga0495613_0078629 3300046689 Bacteria 2399
295 Ga0495670_0240015 3300046691 Bacteria 965
296 Ga0495672_0073136 3300047320 Bacteria 1934
297 Ga0495683_0118283 3300047323 Bacteria 1260
298 Ga0495687_013739 3300047443 Bacteria 4205
299 Ga0495677_0103999 3300047445 Bacteria 1076
300 Ga0495685_044273 3300047447 Bacteria 1518
301 Ga0495681_0212244 3300047470 Bacteria 780
302 Ga0495686_0003895 3300047472 Bacteria 12594
303 Ga0495593_0093197 3300047673 Bacteria 1550
304 Ga0496100_0343460 3300048903 Bacteria 1126
305 Ga0496101_0214779 3300048904 Bacteria 1491
306 Ga0496101_0366829 3300048904 Bacteria 1132
307 Ga0496102_0141512 3300048905 Bacteria 2256
308 Ga0496102_0911867 3300048905 Unclassified 800
309 Ga0496104_0140865 3300048907 Bacteria 2317
310 Ga0496106_0124766 3300048909 Bacteria 2015
311 Ga0496106_0561084 3300048909 Bacteria 916
312 Ga0496107_0059958 3300048910 Bacteria 2754
313 Ga0496108_0149329 3300048911 Bacteria 2016
314 Ga0496109_0023898 3300048912 Bacteria 5427
315 Ga0496112_0191449 3300048915 Bacteria 2007
316 Ga0496112_0385096 3300048915 Bacteria 1343
317 Ga0496115_0000921 3300048918 Bacteria 21326
318 Ga0496115_0000984 3300048918 Bacteria 20664
319 Ga0496115_0039648 3300048918 Bacteria 3742
320 Ga0496115_0097444 3300048918 Bacteria 2408
321 Ga0496116_0039532 3300048919 Bacteria 3261
322 Ga0496117_0031511 3300048920 Bacteria 4045
323 Ga0496118_0056875 3300048921 Bacteria 2936
324 Ga0496119_0022486 3300048922 Bacteria 4512
325 Ga0496120_0198327 3300048923 Bacteria 973
326 Ga0496121_0000035 3300048924 Bacteria 374316
327 Ga0496125_0080162 3300048928 Bacteria 2500
328 Ga0501032_0013413 3300049569 Bacteria 5831
329 Ga0501032_0200657 3300049569 Bacteria 1302
330 Ga0501033_0000883 3300049570 Bacteria 27401
331 Ga0501033_0036366 3300049570 Bacteria 3690
332 Ga0501033_0177012 3300049570 Bacteria 1530
333 Ga0501034_0011389 3300049571 Bacteria 9223
334 Ga0501034_0210615 3300049571 Bacteria 1899
335 Ga0501034_0542628 3300049571 Bacteria 1073
336 Ga0501037_0357577 3300049573 Bacteria 1006
337 Ga0501043_0297408 3300049579 Bacteria 1234
338 Ga0501047_0008955 3300049581 Bacteria 9450
339 Ga0501047_0024157 3300049581 Bacteria 5838
340 Ga0501047_0179498 3300049581 Bacteria 1984
341 Ga0501067_0132887 3300049583 Bacteria 1385
342 Ga0501072_0007742 3300049588 Bacteria 8157
343 Ga0501074_0032602 3300049590 Bacteria 3773
344 Ga0501257_038678 3300049686 Bacteria 1167
345 Ga0501080_0018755 3300049742 Bacteria 6403
346 Ga0501083_0169239 3300049744 Bacteria 1428
347 Ga0501275_043566 3300049772 Bacteria 637
348 Ga0501035_0016084 3300049822 Bacteria 6903
349 Ga0501035_0068720 3300049822 Bacteria 3141
350 Ga0501035_0199709 3300049822 Bacteria 1716
351 Ga0501044_0000869 3300049823 Bacteria 36398
352 Ga0501044_0022908 3300049823 Bacteria 6650
353 Ga0501044_0123005 3300049823 Bacteria 2594
354 Ga0501044_0277871 3300049823 Bacteria 1609
355 nmdc:mga03n38_391774_c1 3300050490 Bacteria 763
356 nmdc:mga00v17_1910_c1 3300050491 Bacteria 10775
357 nmdc:mga0k408_22733_c1 3300050493 Bacteria 3532
358 nmdc:mga06z11_62550_c1 3300050494 Bacteria 1945
359 nmdc:mga07m45_14679_c1 3300050496 Bacteria 4179
360 Ga0500635_0000087 3300053080 Bacteria 59735
361 Ga0500635_0000642 3300053080 Bacteria 8989
362 Ga0500647_0071367 3300053091 Bacteria 1669
363 Ga0500583_0153635 3300053092 Bacteria 1146
364 Ga0500651_0004070 3300053093 Bacteria 8130
365 Ga0500566_0059000 3300053094 Bacteria 2177
366 Ga0500641_0009430 3300053096 Bacteria 3511
367 Ga0500555_039292 3300053103 Unclassified 1321
368 Ga0500562_000804 3300053108 Bacteria 7656
369 Ga0500562_010285 3300053108 Bacteria 2370
370 Ga0500569_023149 3300053109 Bacteria 1665
371 Ga0500572_073696 3300053111 Bacteria 1059
372 Ga0500595_012934 3300053119 Bacteria 3211
373 Ga0500595_023129 3300053119 Bacteria 2188
374 Ga0500595_043588 3300053119 Bacteria 1427
375 Ga0500607_078789 3300053121 Bacteria 1684
376 Ga0500608_001781 3300053122 Bacteria 7695
377 Ga0500614_003029 3300053123 Bacteria 3651
378 Ga0500559_0010118 3300053136 Bacteria 4059
379 Ga0500559_0013113 3300053136 Bacteria 3515
380 Ga0500590_005741 3300053148 Bacteria 5992
381 Ga0500603_091898 3300053150 Bacteria 892
382 Ga0500619_003334 3300053154 Bacteria 3273
383 Ga0500636_0003768 3300053177 Bacteria 8563
384 Ga0500637_0014130 3300053178 Bacteria 4202
385 Ga0500637_0039086 3300053178 Bacteria 2675
386 Ga0500576_055023 3300053725 Bacteria 1755
387 Ga0500625_046453 3300053729 Bacteria 2024
388 Ga0500645_004686 3300053730 Bacteria 5197
389 Ga0500596_024486 3300053735 Bacteria 918
390 Ga0501084_0058931 3300054114 Bacteria 3213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100000230 Ga0068859_10000023043 148
2 3300005841 Ga0068863_100003612 Ga0068863_1000036127 148
3 3300006931 Ga0097620_100000230 Ga0097620_10000023043 148
4 3300009177 Ga0105248_10512772 Ga0105248_105127722 148
5 3300025941 Ga0207711_10096784 Ga0207711_100967842 148
6 3300026088 Ga0207641_10006023 Ga0207641_100060236 148
7 3300048903 Ga0496100_0343460 Ga0496100_0343460_106_759 148
8 3300005331 Ga0070670_100045878 Ga0070670_1000458783 150
9 3300005335 Ga0070666_10311869 Ga0070666_103118692 150
10 3300005347 Ga0070668_100009396 Ga0070668_1000093969 150
11 3300005355 Ga0070671_100023020 Ga0070671_1000230203 150
12 3300005544 Ga0070686_100320137 Ga0070686_1003201372 150
13 3300005548 Ga0070665_100131718 Ga0070665_1001317183 150
14 3300005842 Ga0068858_100002621 Ga0068858_1000026212 150
15 3300005843 Ga0068860_100005899 Ga0068860_10000589914 150
16 3300005844 Ga0068862_100159341 Ga0068862_1001593412 150
17 3300014325 Ga0163163_10009311 Ga0163163_1000931110 150
18 3300014968 Ga0157379_10008310 Ga0157379_100083104 150
19 3300025315 Ga0207697_10050360 Ga0207697_100503603 150
20 3300025925 Ga0207650_10022038 Ga0207650_100220383 150
21 3300025931 Ga0207644_10000420 Ga0207644_1000042021 150
22 3300025972 Ga0207668_10005619 Ga0207668_100056193 150
23 3300025986 Ga0207658_10034634 Ga0207658_100346343 150
24 3300026035 Ga0207703_10000953 Ga0207703_1000095324 150
25 3300028379 Ga0268266_10111098 Ga0268266_101110983 150
26 3300028381 Ga0268264_10403314 Ga0268264_104033142 150
27 3300005539 Ga0068853_100296177 Ga0068853_1002961772 154
28 3300009093 Ga0105240_10267707 Ga0105240_102677072 154
29 3300010375 Ga0105239_10330221 Ga0105239_103302213 154
30 3300013100 Ga0157373_10003292 Ga0157373_100032922 155
31 3300037312 Ga0395899_0225091 Ga0395899_0225091_528_1154 156
32 3300037466 Ga0395898_0332464 Ga0395898_0332464_325_951 156
33 3300005614 Ga0068856_100064867 Ga0068856_1000648672 157
34 3300003322 rootL2_10245929 rootL2_102459292 158
35 3300005539 Ga0068853_100073775 Ga0068853_1000737752 158
36 3300013100 Ga0157373_10000590 Ga0157373_100005902 158
37 3300013104 Ga0157370_10057893 Ga0157370_100578933 158
38 3300015684 Ga0183365_10001 Ga0183365_10001743 158
39 3300026041 Ga0207639_10048909 Ga0207639_100489092 158
40 3300049571 Ga0501034_0210615 Ga0501034_0210615_1125_1739 158
41 3300009093 Ga0105240_10053601 Ga0105240_100536012 161
42 3300025913 Ga0207695_10040171 Ga0207695_100401712 161
43 3300021384 Ga0213876_10097165 Ga0213876_100971652 162
44 3300039437 Ga0436365_1285497 Ga0436365_1285497_463_1092 162
45 3300005331 Ga0070670_100164947 Ga0070670_1001649473 164
46 3300005347 Ga0070668_100016289 Ga0070668_1000162897 164
47 3300005844 Ga0068862_100289494 Ga0068862_1002894941 164
48 3300028380 Ga0268265_10078157 Ga0268265_100781572 164
49 3300037471 Ga0395905_0062517 Ga0395905_0062517_2179_2865 165
50 3300028800 Ga0265338_10640625 Ga0265338_106406251 167
51 3300053103 Ga0500555_039292 Ga0500555_039292_107_739 168
52 3300046689 Ga0495613_0078629 Ga0495613_0078629_1241_1876 169
53 3300049772 Ga0501275_043566 Ga0501275_043566_10_588 169
54 3300005338 Ga0068868_100585413 Ga0068868_1005854131 170
55 3300005353 Ga0070669_100037389 Ga0070669_1000373892 170
56 3300005614 Ga0068856_100131860 Ga0068856_1001318602 170
57 3300009177 Ga0105248_10209510 Ga0105248_102095102 170
58 3300013306 Ga0163162_10034891 Ga0163162_100348915 170
59 3300025923 Ga0207681_10004772 Ga0207681_100047725 170
60 3300025941 Ga0207711_10010422 Ga0207711_1001042210 170
61 3300028786 Ga0307517_10084241 Ga0307517_100842413 170
62 3300046506 Ga0495583_0068969 Ga0495583_0068969_14_652 170
63 3300046512 Ga0495610_0024953 Ga0495610_0024953_1846_2484 170
64 3300046522 Ga0495643_0043074 Ga0495643_0043074_922_1560 170
65 3300046542 Ga0495597_0042362 Ga0495597_0042362_778_1416 170
66 3300046616 Ga0495668_0035940 Ga0495668_0035940_1256_1894 170
67 3300046660 Ga0495625_0159724 Ga0495625_0159724_805_1443 170
68 3300047443 Ga0495687_013739 Ga0495687_013739_594_1232 170
69 3300047673 Ga0495593_0093197 Ga0495593_0093197_749_1387 170
70 3300048905 Ga0496102_0141512 Ga0496102_0141512_182_820 170
71 3300048909 Ga0496106_0561084 Ga0496106_0561084_42_680 170
72 3300048919 Ga0496116_0039532 Ga0496116_0039532_1471_2109 170
73 3300048920 Ga0496117_0031511 Ga0496117_0031511_1706_2344 170
74 3300048921 Ga0496118_0056875 Ga0496118_0056875_598_1236 170
75 3300048922 Ga0496119_0022486 Ga0496119_0022486_2850_3488 170
76 3300048923 Ga0496120_0198327 Ga0496120_0198327_76_714 170
77 3300048924 Ga0496121_0000035 Ga0496121_0000035_317061_317699 170
78 3300053080 Ga0500635_0000087 Ga0500635_0000087_14863_15501 170
79 3300053091 Ga0500647_0071367 Ga0500647_0071367_282_920 170
80 3300053092 Ga0500583_0153635 Ga0500583_0153635_388_1026 170
81 3300053093 Ga0500651_0004070 Ga0500651_0004070_3016_3654 170
82 3300053094 Ga0500566_0059000 Ga0500566_0059000_611_1249 170
83 3300053109 Ga0500569_023149 Ga0500569_023149_551_1189 170
84 3300053111 Ga0500572_073696 Ga0500572_073696_306_944 170
85 3300053119 Ga0500595_023129 Ga0500595_023129_908_1546 170
86 3300053121 Ga0500607_078789 Ga0500607_078789_642_1280 170
87 3300053122 Ga0500608_001781 Ga0500608_001781_6154_6792 170
88 3300053123 Ga0500614_003029 Ga0500614_003029_2362_3000 170
89 3300053136 Ga0500559_0010118 Ga0500559_0010118_1598_2236 170
90 3300053148 Ga0500590_005741 Ga0500590_005741_2255_2893 170
91 3300053154 Ga0500619_003334 Ga0500619_003334_1336_1974 170
92 3300053177 Ga0500636_0003768 Ga0500636_0003768_6688_7326 170
93 3300053178 Ga0500637_0014130 Ga0500637_0014130_3271_3909 170
94 3300053178 Ga0500637_0039086 Ga0500637_0039086_269_907 170
95 3300053725 Ga0500576_055023 Ga0500576_055023_516_1154 170
96 3300053729 Ga0500625_046453 Ga0500625_046453_776_1414 170
97 3300053735 Ga0500596_024486 Ga0500596_024486_269_907 170
98 3300006946 Ga0079104_1013858 Ga0079104_10138582 171
99 3300027111 Ga0209281_1028134 Ga0209281_10281342 171
100 3300035691 Ga0373931_0026206 Ga0373931_0026206_279_872 172
101 3300028786 Ga0307517_10024240 Ga0307517_100242409 173
102 3300031456 Ga0307513_10000541 Ga0307513_1000054142 173
103 3300049573 Ga0501037_0357577 Ga0501037_0357577_48_740 173
104 3300049823 Ga0501044_0277871 Ga0501044_0277871_793_1485 173
105 3300005563 Ga0068855_100140560 Ga0068855_1001405603 174
106 3300005614 Ga0068856_100218490 Ga0068856_1002184903 174
107 3300009545 Ga0105237_10458419 Ga0105237_104584192 174
108 3300009551 Ga0105238_10628977 Ga0105238_106289772 174
109 3300025913 Ga0207695_10454166 Ga0207695_104541662 174
110 3300025949 Ga0207667_10142793 Ga0207667_101427933 174
111 3300049569 Ga0501032_0200657 Ga0501032_0200657_499_1113 174
112 3300049570 Ga0501033_0177012 Ga0501033_0177012_261_875 174
113 3300049579 Ga0501043_0297408 Ga0501043_0297408_276_890 174
114 3300049822 Ga0501035_0016084 Ga0501035_0016084_4175_4789 174
115 3300005844 Ga0068862_100948856 Ga0068862_1009488561 175
116 3300033180 Ga0307510_10020789 Ga0307510_100207895 175
117 3300053080 Ga0500635_0000642 Ga0500635_0000642_5055_5666 175
118 3300053136 Ga0500559_0013113 Ga0500559_0013113_487_1098 175
119 3300046684 Ga0495669_0000447 Ga0495669_0000447_17117_17737 176
120 3300048918 Ga0496115_0039648 Ga0496115_0039648_1778_2407 176
121 3300053108 Ga0500562_010285 Ga0500562_010285_1046_1654 176
122 3300049570 Ga0501033_0000883 Ga0501033_0000883_24573_25172 177
123 3300049571 Ga0501034_0011389 Ga0501034_0011389_6157_6813 177
124 3300049822 Ga0501035_0199709 Ga0501035_0199709_737_1336 177
125 3300049823 Ga0501044_0000869 Ga0501044_0000869_11374_11973 177
126 3300021361 Ga0213872_10004723 Ga0213872_100047239 178
127 3300031456 Ga0307513_10000069 Ga0307513_1000006930 178
128 3300039447 Ga0436361_0115662 Ga0436361_0115662_18512_19123 178
129 3300009177 Ga0105248_10498564 Ga0105248_104985642 179
130 3300025945 Ga0207679_10007260 Ga0207679_100072602 179
131 3300037312 Ga0395899_0107437 Ga0395899_0107437_341_970 179
132 3300037312 Ga0395899_0312565 Ga0395899_0312565_24_653 179
133 3300037418 Ga0395900_0196771 Ga0395900_0196771_439_1068 179
134 3300038443 Ga0395901_0195911 Ga0395901_0195911_253_882 179
135 3300048928 Ga0496125_0080162 Ga0496125_0080162_171_794 179
136 3300005330 Ga0070690_100427003 Ga0070690_1004270031 180
137 3300005331 Ga0070670_100054126 Ga0070670_1000541264 180
138 3300005335 Ga0070666_10172054 Ga0070666_101720542 180
139 3300005338 Ga0068868_100193077 Ga0068868_1001930771 180
140 3300005457 Ga0070662_100351427 Ga0070662_1003514272 180
141 3300005543 Ga0070672_100472280 Ga0070672_1004722802 180
142 3300005618 Ga0068864_100310383 Ga0068864_1003103832 180
143 3300005841 Ga0068863_100063249 Ga0068863_1000632492 180
144 3300009177 Ga0105248_10291893 Ga0105248_102918933 180
145 3300014325 Ga0163163_10016816 Ga0163163_100168168 180
146 3300025925 Ga0207650_10038595 Ga0207650_100385954 180
147 3300025931 Ga0207644_10039475 Ga0207644_100394752 180
148 3300025933 Ga0207706_10349565 Ga0207706_103495652 180
149 3300025940 Ga0207691_10532669 Ga0207691_105326692 180
150 3300025941 Ga0207711_10744749 Ga0207711_107447492 180
151 3300025945 Ga0207679_10093319 Ga0207679_100933192 180
152 3300026023 Ga0207677_10067367 Ga0207677_100673675 180
153 3300026095 Ga0207676_10162851 Ga0207676_101628512 180
154 3300046516 Ga0495628_0049549 Ga0495628_0049549_961_1602 180
155 3300046528 Ga0495642_0020405 Ga0495642_0020405_1974_2582 180
156 3300046539 Ga0495621_0240472 Ga0495621_0240472_13_621 180
157 3300046616 Ga0495668_0112697 Ga0495668_0112697_628_1236 180
158 3300046664 Ga0495659_0114931 Ga0495659_0114931_352_960 180
159 3300046684 Ga0495669_0121853 Ga0495669_0121853_207_815 180
160 3300046691 Ga0495670_0240015 Ga0495670_0240015_247_855 180
161 3300048904 Ga0496101_0214779 Ga0496101_0214779_236_844 180
162 3300048907 Ga0496104_0140865 Ga0496104_0140865_475_1083 180
163 3300048909 Ga0496106_0124766 Ga0496106_0124766_1043_1651 180
164 3300048910 Ga0496107_0059958 Ga0496107_0059958_1068_1676 180
165 3300048911 Ga0496108_0149329 Ga0496108_0149329_1199_1807 180
166 3300048912 Ga0496109_0023898 Ga0496109_0023898_1082_1690 180
167 3300048915 Ga0496112_0191449 Ga0496112_0191449_844_1452 180
168 3300049569 Ga0501032_0013413 Ga0501032_0013413_2186_2803 180
169 iso_pu_bacteria 2643221598 2643998682 180
170 iso_pu_bacteria 2643221614 2644087365 180
171 iso_pu_bacteria 2643221661 2644344591 180
172 iso_pu_bacteria 2643221666 2644366725 180
173 3300005530 Ga0070679_100594039 Ga0070679_1005940392 181
174 3300005617 Ga0068859_100606178 Ga0068859_1006061782 181
175 3300005843 Ga0068860_100099815 Ga0068860_1000998152 181
176 3300006931 Ga0097620_100606210 Ga0097620_1006062102 181
177 3300009553 Ga0105249_11617532 Ga0105249_116175321 181
178 3300025923 Ga0207681_10067973 Ga0207681_100679734 181
179 3300025972 Ga0207668_10234081 Ga0207668_102340812 181
180 3300028381 Ga0268264_10561970 Ga0268264_105619701 181
181 3300035089 Ga0373944_0005738 Ga0373944_0005738_330_944 181
182 3300035171 Ga0373946_0079812 Ga0373946_0079812_691_1305 181
183 3300035695 Ga0373927_0000173 Ga0373927_0000173_35667_36281 181
184 3300037068 Ga0373925_0000049 Ga0373925_0000049_32728_33342 181
185 3300005618 Ga0068864_100130646 Ga0068864_1001306462 182
186 3300005841 Ga0068863_100293416 Ga0068863_1002934163 182
187 3300009553 Ga0105249_10644143 Ga0105249_106441432 182
188 3300014325 Ga0163163_10250821 Ga0163163_102508213 182
189 3300026088 Ga0207641_10053844 Ga0207641_100538442 182
190 3300026095 Ga0207676_10118250 Ga0207676_101182503 182
191 3300026121 Ga0207683_10093932 Ga0207683_100939322 182
192 3300031251 Ga0265327_10000279 Ga0265327_1000027997 182
193 3300032004 Ga0307414_10114412 Ga0307414_101144123 182
194 3300032005 Ga0307411_10102408 Ga0307411_101024082 182
195 3300044842 Ga0466957_0168958 Ga0466957_0168958_468_1088 182
196 3300049581 Ga0501047_0179498 Ga0501047_0179498_604_1230 182
197 3300053119 Ga0500595_043588 Ga0500595_043588_552_1169 182
198 3300048915 Ga0496112_0385096 Ga0496112_0385096_306_956 183
199 3300048918 Ga0496115_0097444 Ga0496115_0097444_1361_1981 183
200 3300049571 Ga0501034_0542628 Ga0501034_0542628_38_667 183
201 3300049581 Ga0501047_0008955 Ga0501047_0008955_2102_2722 183
202 3300049686 Ga0501257_038678 Ga0501257_038678_231_866 183
203 3300005327 Ga0070658_10737055 Ga0070658_107370551 184
204 3300049583 Ga0501067_0132887 Ga0501067_0132887_618_1259 184
205 3300049588 Ga0501072_0007742 Ga0501072_0007742_6824_7465 184
206 3300049590 Ga0501074_0032602 Ga0501074_0032602_2551_3192 184
207 3300049742 Ga0501080_0018755 Ga0501080_0018755_3019_3660 184
208 3300049744 Ga0501083_0169239 Ga0501083_0169239_388_1029 184
209 3300050490 nmdc:mga03n38_391774_c1 nmdc:mga03n38_391774_c1_95_733 184
210 3300053108 Ga0500562_000804 Ga0500562_000804_6580_7200 184
211 3300054114 Ga0501084_0058931 Ga0501084_0058931_1405_2046 184
212 3300005327 Ga0070658_10075536 Ga0070658_100755362 185
213 3300005327 Ga0070658_10083912 Ga0070658_100839122 185
214 3300005331 Ga0070670_100000022 Ga0070670_10000002292 185
215 3300005331 Ga0070670_100266111 Ga0070670_1002661112 185
216 3300005334 Ga0068869_100691710 Ga0068869_1006917102 185
217 3300005335 Ga0070666_10042605 Ga0070666_100426052 185
218 3300005335 Ga0070666_10067962 Ga0070666_100679623 185
219 3300005336 Ga0070680_100002203 Ga0070680_10000220316 185
220 3300005339 Ga0070660_100056883 Ga0070660_1000568833 185
221 3300005339 Ga0070660_100193404 Ga0070660_1001934042 185
222 3300005347 Ga0070668_100001362 Ga0070668_10000136220 185
223 3300005347 Ga0070668_100004455 Ga0070668_1000044551 185
224 3300005366 Ga0070659_100000973 Ga0070659_1000009738 185
225 3300005366 Ga0070659_100008371 Ga0070659_10000837110 185
226 3300005367 Ga0070667_100000517 Ga0070667_10000051720 185
227 3300005367 Ga0070667_100004822 Ga0070667_10000482210 185
228 3300005456 Ga0070678_100392332 Ga0070678_1003923322 185
229 3300005458 Ga0070681_10001437 Ga0070681_1000143712 185
230 3300005530 Ga0070679_100026323 Ga0070679_1000263233 185
231 3300005535 Ga0070684_101155433 Ga0070684_1011554331 185
232 3300005539 Ga0068853_100053948 Ga0068853_1000539483 185
233 3300005548 Ga0070665_100000674 Ga0070665_10000067422 185
234 3300005548 Ga0070665_100001038 Ga0070665_10000103823 185
235 3300005548 Ga0070665_100001299 Ga0070665_1000012999 185
236 3300005548 Ga0070665_100033892 Ga0070665_1000338927 185
237 3300005563 Ga0068855_100043094 Ga0068855_1000430943 185
238 3300005564 Ga0070664_100644892 Ga0070664_1006448922 185
239 3300005578 Ga0068854_100187713 Ga0068854_1001877132 185
240 3300005617 Ga0068859_100020496 Ga0068859_1000204963 185
241 3300005617 Ga0068859_100528044 Ga0068859_1005280442 185
242 3300005618 Ga0068864_100000125 Ga0068864_10000012535 185
243 3300005618 Ga0068864_100000947 Ga0068864_10000094729 185
244 3300005841 Ga0068863_100000066 Ga0068863_10000006640 185
245 3300005841 Ga0068863_100000486 Ga0068863_10000048621 185
246 3300005842 Ga0068858_100000136 Ga0068858_10000013627 185
247 3300005842 Ga0068858_100009137 Ga0068858_10000913713 185
248 3300005843 Ga0068860_100000136 Ga0068860_100000136110 185
249 3300005843 Ga0068860_100375827 Ga0068860_1003758272 185
250 3300005844 Ga0068862_100012442 Ga0068862_1000124422 185
251 3300005844 Ga0068862_100026726 Ga0068862_1000267263 185
252 3300006028 Ga0070717_10135367 Ga0070717_101353672 185
253 3300006028 Ga0070717_10200019 Ga0070717_102000191 185
254 3300006042 Ga0075368_10018544 Ga0075368_100185442 185
255 3300006051 Ga0075364_10002249 Ga0075364_100022492 185
256 3300006178 Ga0075367_10032920 Ga0075367_100329203 185
257 3300006195 Ga0075366_10201484 Ga0075366_102014842 185
258 3300006353 Ga0075370_10365293 Ga0075370_103652932 185
259 3300006881 Ga0068865_100003848 Ga0068865_1000038483 185
260 3300006931 Ga0097620_100020496 Ga0097620_1000204969 185
261 3300006931 Ga0097620_100528070 Ga0097620_1005280702 185
262 3300009092 Ga0105250_10014335 Ga0105250_100143352 185
263 3300009093 Ga0105240_10080907 Ga0105240_100809075 185
264 3300009101 Ga0105247_10054464 Ga0105247_100544642 185
265 3300009177 Ga0105248_10000170 Ga0105248_1000017017 185
266 3300009177 Ga0105248_10014056 Ga0105248_100140564 185
267 3300009177 Ga0105248_10070558 Ga0105248_100705585 185
268 3300009177 Ga0105248_10451041 Ga0105248_104510412 185
269 3300009551 Ga0105238_11004018 Ga0105238_110040182 185
270 3300009553 Ga0105249_10000376 Ga0105249_1000037610 185
271 3300010375 Ga0105239_10156883 Ga0105239_101568834 185
272 3300013105 Ga0157369_10605624 Ga0157369_106056241 185
273 3300013297 Ga0157378_11254353 Ga0157378_112543531 185
274 3300013306 Ga0163162_10088094 Ga0163162_100880944 185
275 3300013308 Ga0157375_10334831 Ga0157375_103348312 185
276 3300014325 Ga0163163_10018900 Ga0163163_100189008 185
277 3300014325 Ga0163163_10116368 Ga0163163_101163683 185
278 3300014325 Ga0163163_10694798 Ga0163163_106947982 185
279 3300014326 Ga0157380_11038318 Ga0157380_110383182 185
280 3300014968 Ga0157379_10013113 Ga0157379_100131137 185
281 3300014968 Ga0157379_10051688 Ga0157379_100516882 185
282 3300025900 Ga0207710_10033383 Ga0207710_100333832 185
283 3300025903 Ga0207680_10025149 Ga0207680_100251494 185
284 3300025909 Ga0207705_10002531 Ga0207705_1000253117 185
285 3300025912 Ga0207707_10056322 Ga0207707_100563223 185
286 3300025913 Ga0207695_10062224 Ga0207695_100622242 185
287 3300025917 Ga0207660_10006156 Ga0207660_1000615610 185
288 3300025919 Ga0207657_10045888 Ga0207657_100458883 185
289 3300025919 Ga0207657_10239261 Ga0207657_102392612 185
290 3300025921 Ga0207652_10000909 Ga0207652_1000090928 185
291 3300025923 Ga0207681_10164684 Ga0207681_101646843 185
292 3300025924 Ga0207694_10072322 Ga0207694_100723223 185
293 3300025924 Ga0207694_10306860 Ga0207694_103068602 185
294 3300025925 Ga0207650_10000016 Ga0207650_1000001654 185
295 3300025925 Ga0207650_10094007 Ga0207650_100940072 185
296 3300025932 Ga0207690_10000496 Ga0207690_1000049611 185
297 3300025932 Ga0207690_10002098 Ga0207690_100020983 185
298 3300025938 Ga0207704_10054128 Ga0207704_100541284 185
299 3300025941 Ga0207711_10001254 Ga0207711_1000125411 185
300 3300025941 Ga0207711_10040688 Ga0207711_100406885 185
301 3300025941 Ga0207711_10052095 Ga0207711_100520953 185
302 3300025941 Ga0207711_10176115 Ga0207711_101761152 185
303 3300025949 Ga0207667_10010636 Ga0207667_1001063610 185
304 3300025961 Ga0207712_10000606 Ga0207712_100006063 185
305 3300025972 Ga0207668_10000002 Ga0207668_1000000269 185
306 3300025972 Ga0207668_10000117 Ga0207668_1000011732 185
307 3300025981 Ga0207640_10026380 Ga0207640_100263803 185
308 3300025986 Ga0207658_10001861 Ga0207658_1000186115 185
309 3300025986 Ga0207658_10002954 Ga0207658_1000295410 185
310 3300026023 Ga0207677_10441225 Ga0207677_104412252 185
311 3300026035 Ga0207703_10000065 Ga0207703_1000006562 185
312 3300026035 Ga0207703_10002860 Ga0207703_1000286010 185
313 3300026041 Ga0207639_10021666 Ga0207639_100216663 185
314 3300026088 Ga0207641_10000011 Ga0207641_10000011349 185
315 3300026088 Ga0207641_10000910 Ga0207641_100009103 185
316 3300026095 Ga0207676_10000055 Ga0207676_10000055121 185
317 3300026095 Ga0207676_10000148 Ga0207676_1000014842 185
318 3300026142 Ga0207698_10389264 Ga0207698_103892641 185
319 3300028379 Ga0268266_10000003 Ga0268266_100000031051 185
320 3300028379 Ga0268266_10000887 Ga0268266_1000088722 185
321 3300028379 Ga0268266_10002246 Ga0268266_100022467 185
322 3300028379 Ga0268266_10064422 Ga0268266_100644222 185
323 3300028380 Ga0268265_10017523 Ga0268265_100175235 185
324 3300028380 Ga0268265_10040383 Ga0268265_100403832 185
325 3300028381 Ga0268264_10000265 Ga0268264_100002653 185
326 3300028381 Ga0268264_10350406 Ga0268264_103504062 185
327 3300031456 Ga0307513_10002925 Ga0307513_1000292511 185
328 3300035113 Ga0373936_0133418 Ga0373936_0133418_176_805 185
329 3300044658 Ga0466972_0032701 Ga0466972_0032701_1743_2363 185
330 3300044735 Ga0466968_0088271 Ga0466968_0088271_202_834 185
331 3300044842 Ga0466957_0087911 Ga0466957_0087911_582_1202 185
332 3300046506 Ga0495583_0010249 Ga0495583_0010249_3604_4230 185
333 3300046507 Ga0495606_0166710 Ga0495606_0166710_497_1123 185
334 3300046616 Ga0495668_0019011 Ga0495668_0019011_132_758 185
335 3300046648 Ga0495611_0009993 Ga0495611_0009993_628_1254 185
336 3300046660 Ga0495625_0053981 Ga0495625_0053981_1513_2139 185
337 3300046660 Ga0495625_0155460 Ga0495625_0155460_736_1380 185
338 3300046684 Ga0495669_0000014 Ga0495669_0000014_90992_91636 185
339 3300047320 Ga0495672_0073136 Ga0495672_0073136_475_1101 185
340 3300047323 Ga0495683_0118283 Ga0495683_0118283_358_984 185
341 3300047445 Ga0495677_0103999 Ga0495677_0103999_140_784 185
342 3300047447 Ga0495685_044273 Ga0495685_044273_365_991 185
343 3300047470 Ga0495681_0212244 Ga0495681_0212244_113_739 185
344 3300048904 Ga0496101_0366829 Ga0496101_0366829_223_858 185
345 3300048905 Ga0496102_0911867 Ga0496102_0911867_32_664 185
346 3300048918 Ga0496115_0000921 Ga0496115_0000921_11625_12251 185
347 3300050491 nmdc:mga00v17_1910_c1 nmdc:mga00v17_1910_c1_9578_10207 185
348 3300050493 nmdc:mga0k408_22733_c1 nmdc:mga0k408_22733_c1_576_1205 185
349 3300050494 nmdc:mga06z11_62550_c1 nmdc:mga06z11_62550_c1_708_1337 185
350 3300050496 nmdc:mga07m45_14679_c1 nmdc:mga07m45_14679_c1_3431_4060 185
351 3300053150 Ga0500603_091898 Ga0500603_091898_31_708 185
352 3300005327 Ga0070658_10089444 Ga0070658_100894442 186
353 3300005329 Ga0070683_100805178 Ga0070683_1008051781 186
354 3300005336 Ga0070680_100036557 Ga0070680_1000365573 186
355 3300005355 Ga0070671_100464007 Ga0070671_1004640072 186
356 3300005535 Ga0070684_100086448 Ga0070684_1000864485 186
357 3300005578 Ga0068854_100332745 Ga0068854_1003327452 186
358 3300005616 Ga0068852_100028598 Ga0068852_1000285987 186
359 3300009093 Ga0105240_10075793 Ga0105240_100757933 186
360 3300010375 Ga0105239_10900710 Ga0105239_109007102 186
361 3300013105 Ga0157369_10414768 Ga0157369_104147682 186
362 3300013307 Ga0157372_10036193 Ga0157372_100361934 186
363 3300014969 Ga0157376_10389542 Ga0157376_103895422 186
364 3300025912 Ga0207707_10029018 Ga0207707_100290182 186
365 3300025917 Ga0207660_10124885 Ga0207660_101248854 186
366 3300025937 Ga0207669_10377228 Ga0207669_103772281 186
367 3300025945 Ga0207679_10250833 Ga0207679_102508333 186
368 3300025981 Ga0207640_10362156 Ga0207640_103621562 186
369 3300026089 Ga0207648_10480899 Ga0207648_104808992 186
370 3300035113 Ga0373936_0155870 Ga0373936_0155870_215_847 186
371 3300037418 Ga0395900_0359722 Ga0395900_0359722_324_953 186
372 3300048918 Ga0496115_0000984 Ga0496115_0000984_12393_13025 186
373 3300053096 Ga0500641_0009430 Ga0500641_0009430_347_973 186
374 3300005262 Ga0065165_1033253 Ga0065165_10332532 187
375 3300009093 Ga0105240_10009140 Ga0105240_100091409 187
376 3300013296 Ga0157374_10438249 Ga0157374_104382491 187
377 3300025913 Ga0207695_10004032 Ga0207695_100040329 187
378 3300025921 Ga0207652_10260842 Ga0207652_102608423 187
379 3300049570 Ga0501033_0036366 Ga0501033_0036366_796_1431 187
380 3300049581 Ga0501047_0024157 Ga0501047_0024157_4609_5241 187
381 3300049822 Ga0501035_0068720 Ga0501035_0068720_2115_2750 187
382 3300049823 Ga0501044_0022908 Ga0501044_0022908_4856_5491 187
383 3300049823 Ga0501044_0123005 Ga0501044_0123005_647_1279 187
384 3300005459 Ga0068867_100696949 Ga0068867_1006969491 188
385 3300005841 Ga0068863_100180635 Ga0068863_1001806354 188
386 3300030521 Ga0307511_10023353 Ga0307511_100233535 188
387 3300038443 Ga0395901_0611410 Ga0395901_0611410_350_985 188
388 3300046616 Ga0495668_0056268 Ga0495668_0056268_314_949 188
389 3300046616 Ga0495668_0132358 Ga0495668_0132358_60_695 188
390 3300047472 Ga0495686_0003895 Ga0495686_0003895_7169_7804 188
391 3300053119 Ga0500595_012934 Ga0500595_012934_2135_2770 188
392 3300053730 Ga0500645_004686 Ga0500645_004686_1939_2574 188
393 3300002741 JGI25157J39369_1008055 JGI25157J39369_10080552 189
394 3300025250 Ga0209026_1003980 Ga0209026_10039807 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16321

Ribosom_S30AE_C

Sigma 54 modulation/S30EA ribosomal protein C terminus

151

205

0.98

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

15

108

0.94

Feature Viewer

pLDDT pTM Quality
78.62 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map