F433112

General Info

Members Datasets Scaffolds Average Seq Length
395 273 790 461

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10082218|Ga0065707_1008221814
Length 514
Sequence MYSQRSEKVPADSGSAGHCRQSFNASSASAAFESELPFAGDKRTIALAMNEMSALFLSRIQFGFVISFHIIFPAFTIGLGSWLAFLAGMYLKTHRTLWRELYLFWLKIFAVSFALGVVSGLVMSFQFGTNWSELSARAGNILGPLLAYEVLTAFFLEATFLGVMLFGWKRVSPGVHFFASCMVAVGTLISTFWILAANSWMHTPAGYAIVEGVFEPRDWAKIVFNPSFPYRLVHMTLGAFITTCFVIGGISATYLLRSRHVEAAQLMLKLAIGFAAITVPLQIFVGDLHGLEVREYQPMKLAAIEGHWETRRSAPLVLFAVPDEKNEINRYEVAIPKLGSLILTHDVNGEIKGLKSKPASERPPVVPVFFAFRAMVGIGMLMLLLVAWSALSWRRHRLQQSKAMLRAWMMMTPAGFIAVLAGWYTTEIGRQPYVIYGLMRTADAGSAVDASSVLTSLIVFATVYLFVFISGTYYLLKLLRKGPQPVADDMRHPNDKTSLRPLSLPDDSLEGNHG

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
217 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
220 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
221 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
222 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
223 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
224 2643221559 Lysobacter sp. Root559 Isolate Unclassified
225 2643221573 Lysobacter sp. Root604 Isolate Unclassified
226 2643221586 Lysobacter sp. Root667 Isolate Unclassified
227 2643221593 Lysobacter sp. Root690 Isolate Unclassified
228 2643221612 Lysobacter sp. Root76 Isolate Unclassified
229 2643221720 Lysobacter sp. Root916 Isolate Unclassified
230 2643221727 Lysobacter sp. Root96 Isolate Unclassified
231 2643221728 Lysobacter sp. Root983 Isolate Unclassified
232 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
233 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
234 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
235 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
236 2818991457 Xanthomonas translucens 569 Isolate Unclassified
237 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
238 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
239 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
240 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
241 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
242 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
243 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
244 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
245 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
246 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
247 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
248 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
249 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
250 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
251 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
252 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
253 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
254 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
255 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
256 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
257 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
258 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
259 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
260 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
261 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
262 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
263 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
264 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
265 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
266 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
267 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
268 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
269 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
270 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
271 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
272 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
273 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.08
Metatranscriptomes 0
Isolates 13.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 16.46
Nodule 1.01
Rhizoplane 0.51
Rhizosphere 65.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10082218 3300005295 Bacteria 18935
2 SwRhRL2b_contig_3837291 2162886007 Bacteria 2774
3 JGI25152J39213_1000525 3300002773 Bacteria 21286
4 JGI25151J46595_10000693 3300003187 Bacteria 28389
5 JGI25153J46596_10009809 3300003215 Bacteria 4399
6 rootL2_10279950 3300003322 Bacteria 3969
7 Ga0055526_1000003 3300003771 Bacteria 413092
8 Ga0055526_1007078 3300003771 Bacteria 5927
9 Ga0055526_1016361 3300003771 Bacteria 2909
10 Ga0055537_1000287 3300003773 Bacteria 35894
11 Ga0055524_1000002 3300003775 Bacteria 459550
12 Ga0055524_1001701 3300003775 Bacteria 12261
13 Ga0055536_1003360 3300003781 Bacteria 8642
14 Ga0055534_1000050 3300003784 Bacteria 92561
15 Ga0055528_1000001 3300003790 Bacteria 402384
16 Ga0055528_1000295 3300003790 Bacteria 42305
17 Ga0055530_10002961 3300003791 Bacteria 10232
18 Ga0055531_10018707 3300003794 Bacteria 2845
19 Ga0055531_10020960 3300003794 Bacteria 2559
20 Ga0058692_1000062 3300003856 Bacteria 93121
21 Ga0065704_10004123 3300005289 Bacteria 5103
22 Ga0065712_10071340 3300005290 Bacteria 5329
23 Ga0065715_10091476 3300005293 Bacteria 5765
24 Ga0070676_10004058 3300005328 Bacteria 7694
25 Ga0070683_100015340 3300005329 Bacteria 6726
26 Ga0070670_100000524 3300005331 Bacteria 30806
27 Ga0068869_100001869 3300005334 Bacteria 12650
28 Ga0070666_10057790 3300005335 Bacteria 2622
29 Ga0070680_100000968 3300005336 Bacteria 20318
30 Ga0070680_100007296 3300005336 Bacteria 8427
31 Ga0070680_100046383 3300005336 Bacteria 3535
32 Ga0070689_100000298 3300005340 Bacteria 28844
33 Ga0070692_10053527 3300005345 Bacteria 2105
34 Ga0070668_100002342 3300005347 Bacteria 13925
35 Ga0070668_100007940 3300005347 Bacteria 7880
36 Ga0070668_100015901 3300005347 Bacteria 5629
37 Ga0070668_100048514 3300005347 Bacteria 3266
38 Ga0070668_100068660 3300005347 Bacteria 2756
39 Ga0070669_100097911 3300005353 Bacteria 2209
40 Ga0070674_100030977 3300005356 Bacteria 3540
41 Ga0070673_100003142 3300005364 Bacteria 10229
42 Ga0070688_100000861 3300005365 Bacteria 15075
43 Ga0070667_100023050 3300005367 Bacteria 5164
44 Ga0070710_10055102 3300005437 Bacteria 2245
45 Ga0070701_10032265 3300005438 Bacteria 2607
46 Ga0070694_100062696 3300005444 Bacteria 2541
47 Ga0070678_100043867 3300005456 Bacteria 3189
48 Ga0070678_100080499 3300005456 Bacteria 2467
49 Ga0070684_100000398 3300005535 Bacteria 29681
50 Ga0070684_100118882 3300005535 Bacteria 2376
51 Ga0070672_100069883 3300005543 Bacteria 2789
52 Ga0070665_100020598 3300005548 Bacteria 6626
53 Ga0068855_100000777 3300005563 Bacteria 39367
54 Ga0070664_100000454 3300005564 Bacteria 31058
55 Ga0070664_100024678 3300005564 Bacteria 4976
56 Ga0068859_100001621 3300005617 Bacteria 22990
57 Ga0068859_100008320 3300005617 Bacteria 10513
58 Ga0068864_100001211 3300005618 Bacteria 21438
59 Ga0068861_100000504 3300005719 Bacteria 22770
60 Ga0068861_100011288 3300005719 Bacteria 6203
61 Ga0068861_100014140 3300005719 Bacteria 5597
62 Ga0068870_10007617 3300005840 Bacteria 4839
63 Ga0068863_100001906 3300005841 Bacteria 20711
64 Ga0068863_100174926 3300005841 Bacteria 2060
65 Ga0068858_100042701 3300005842 Bacteria 4204
66 Ga0068860_100000327 3300005843 Bacteria 64590
67 Ga0068860_100020350 3300005843 Bacteria 6427
68 Ga0068862_100000325 3300005844 Bacteria 51933
69 Ga0068862_100004822 3300005844 Bacteria 11359
70 Ga0068862_100063473 3300005844 Bacteria 3178
71 Ga0081538_10019337 3300005981 Bacteria 5067
72 Ga0081540_1000195 3300005983 Bacteria 62863
73 Ga0081539_10023824 3300005985 Bacteria 3994
74 Ga0075428_100000933 3300006844 Bacteria 30902
75 Ga0075428_100006725 3300006844 Bacteria 12792
76 Ga0075430_100007262 3300006846 Bacteria 9355
77 Ga0075430_100123565 3300006846 Bacteria 2157
78 Ga0075431_100000094 3300006847 Bacteria 54906
79 Ga0075431_100000503 3300006847 Bacteria 32649
80 Ga0075431_100027276 3300006847 Bacteria 5859
81 Ga0075434_100082032 3300006871 Bacteria 3222
82 Ga0075429_100000147 3300006880 Bacteria 43414
83 Ga0075429_100001370 3300006880 Bacteria 19935
84 Ga0097620_100001621 3300006931 Bacteria 22990
85 Ga0097620_100008320 3300006931 Bacteria 10513
86 Ga0099795_10002447 3300007788 Bacteria 4369
87 Ga0105251_10000008 3300009011 Bacteria 213669
88 Ga0105251_10002377 3300009011 Bacteria 14882
89 Ga0105240_10020714 3300009093 Bacteria 8762
90 Ga0105240_10130635 3300009093 Bacteria 3013
91 Ga0105240_10218970 3300009093 Bacteria 2219
92 Ga0111539_10005666 3300009094 Bacteria 16156
93 Ga0111539_10020050 3300009094 Bacteria 8237
94 Ga0111539_10039841 3300009094 Bacteria 5659
95 Ga0111539_10043891 3300009094 Bacteria 5358
96 Ga0105247_10046509 3300009101 Bacteria 2664
97 Ga0114129_10003130 3300009147 Bacteria 23215
98 Ga0114129_10076014 3300009147 Bacteria 4676
99 Ga0105243_10001525 3300009148 Bacteria 20239
100 Ga0105237_10074509 3300009545 Bacteria 3386
101 Ga0105249_10021708 3300009553 Bacteria 5747
102 Ga0099796_10001955 3300010159 Bacteria 4371
103 Ga0099796_10009379 3300010159 Bacteria 2647
104 Ga0105239_10027054 3300010375 Bacteria 6314
105 Ga0157371_10000158 3300013102 Bacteria 99529
106 Ga0157371_10047472 3300013102 Bacteria 3053
107 Ga0157371_10186963 3300013102 Bacteria 1482
108 Ga0157370_10008312 3300013104 Bacteria 11198
109 Ga0157370_10027830 3300013104 Bacteria 5571
110 Ga0157369_10033905 3300013105 Bacteria 5606
111 Ga0157369_10081817 3300013105 Bacteria 3455
112 Ga0157374_10122287 3300013296 Bacteria 2513
113 Ga0163162_10323866 3300013306 Bacteria 1674
114 Ga0157375_10056084 3300013308 Bacteria 3888
115 Ga0163163_10001204 3300014325 Bacteria 21896
116 Ga0157380_10000208 3300014326 Bacteria 34802
117 Ga0182008_10000360 3300014497 Bacteria 35424
118 Ga0157377_10005233 3300014745 Bacteria 6074
119 Ga0182006_1008606 3300015261 Bacteria 4623
120 Ga0182007_10000019 3300015262 Bacteria 194770
121 Ga0182005_1000048 3300015265 Bacteria 123394
122 Ga0182005_1000088 3300015265 Bacteria 69427
123 Ga0182005_1004813 3300015265 Bacteria 4298
124 Ga0183360_10003 3300015689 Bacteria 713221
125 Ga0163161_10010242 3300017792 Bacteria 6492
126 Ga0163161_10028148 3300017792 Bacteria 3989
127 Ga0213876_10105278 3300021384 Bacteria 1497
128 Ga0207425_1015747 3300025245 Bacteria 1690
129 Ga0209677_101544 3300025253 Bacteria 9817
130 Ga0209148_1009148 3300025254 Bacteria 1948
131 Ga0209129_1000153 3300025258 Bacteria 110699
132 Ga0209565_1000002 3300025263 Bacteria 1423083
133 Ga0209673_1000002 3300025273 Bacteria 1423083
134 Ga0209673_1000317 3300025273 Bacteria 88898
135 Ga0209673_1004512 3300025273 Bacteria 7416
136 Ga0209673_1008538 3300025273 Bacteria 4548
137 Ga0209130_1002935 3300025284 Bacteria 7792
138 Ga0209675_1000002 3300025291 Bacteria 1423083
139 Ga0209676_1000143 3300025292 Bacteria 175267
140 Ga0209676_1001178 3300025292 Bacteria 28316
141 Ga0209676_1001205 3300025292 Bacteria 27639
142 Ga0209676_1003335 3300025292 Bacteria 10027
143 Ga0209676_1006683 3300025292 Bacteria 5618
144 Ga0209676_1008522 3300025292 Bacteria 4560
145 Ga0209676_1014702 3300025292 Bacteria 2928
146 Ga0209676_1016599 3300025292 Bacteria 2648
147 Ga0209025_1000134 3300025294 Bacteria 194505
148 Ga0209025_1001827 3300025294 Bacteria 25060
149 Ga0209025_1012945 3300025294 Bacteria 5290
150 Ga0209025_1053508 3300025294 Bacteria 1582
151 Ga0209564_1000004 3300025295 Bacteria 1424639
152 Ga0209564_1001398 3300025295 Bacteria 25072
153 Ga0209564_1007086 3300025295 Bacteria 5864
154 Ga0209758_1000153 3300025297 Bacteria 161668
155 Ga0209758_1008037 3300025297 Bacteria 6967
156 Ga0209758_1024943 3300025297 Bacteria 2643
157 Ga0209050_1000109 3300025298 Bacteria 219706
158 Ga0209050_1001299 3300025298 Bacteria 28212
159 Ga0209050_1015645 3300025298 Bacteria 3167
160 Ga0209050_1021635 3300025298 Bacteria 2337
161 Ga0209256_1000004 3300025299 Bacteria 1424643
162 Ga0209256_1000624 3300025299 Bacteria 48696
163 Ga0209256_1005891 3300025299 Bacteria 6785
164 Ga0209256_1009412 3300025299 Bacteria 4290
165 Ga0209256_1013227 3300025299 Bacteria 3078
166 Ga0207426_1000390 3300025302 Bacteria 74933
167 Ga0209051_1003796 3300025303 Bacteria 9670
168 Ga0209051_1025885 3300025303 Bacteria 2377
169 Ga0209257_1000474 3300025304 Bacteria 73194
170 Ga0209257_1000751 3300025304 Bacteria 48987
171 Ga0209257_1000965 3300025304 Bacteria 39472
172 Ga0209257_1001919 3300025304 Bacteria 22458
173 Ga0209257_1002607 3300025304 Bacteria 17450
174 Ga0207713_1000170 3300025735 Bacteria 94864
175 Ga0207713_1023310 3300025735 Bacteria 2915
176 Ga0207692_10016934 3300025898 Bacteria 3240
177 Ga0207710_10023692 3300025900 Bacteria 2639
178 Ga0207645_10010680 3300025907 Bacteria 6298
179 Ga0207695_10013943 3300025913 Bacteria 9554
180 Ga0207695_10099494 3300025913 Bacteria 2905
181 Ga0207693_10073883 3300025915 Bacteria 2669
182 Ga0207660_10013689 3300025917 Bacteria 5322
183 Ga0207657_10063230 3300025919 Bacteria 3165
184 Ga0207652_10078742 3300025921 Bacteria 2878
185 Ga0207681_10001316 3300025923 Bacteria 16023
186 Ga0207694_10005212 3300025924 Bacteria 10037
187 Ga0207650_10001091 3300025925 Bacteria 20063
188 Ga0207650_10050005 3300025925 Bacteria 3089
189 Ga0207659_10002663 3300025926 Bacteria 10638
190 Ga0207644_10009249 3300025931 Bacteria 6464
191 Ga0207706_10007038 3300025933 Bacteria 10397
192 Ga0207709_10001660 3300025935 Bacteria 15022
193 Ga0207709_10018566 3300025935 Bacteria 3896
194 Ga0207670_10001483 3300025936 Bacteria 12327
195 Ga0207669_10031127 3300025937 Bacteria 2977
196 Ga0207691_10020769 3300025940 Bacteria 6209
197 Ga0207711_10013463 3300025941 Bacteria 6794
198 Ga0207689_10006588 3300025942 Bacteria 10238
199 Ga0207679_10040795 3300025945 Bacteria 3325
200 Ga0207679_10106360 3300025945 Bacteria 2205
201 Ga0207651_10050726 3300025960 Bacteria 2819
202 Ga0207712_10006532 3300025961 Bacteria 7355
203 Ga0207668_10011503 3300025972 Bacteria 5381
204 Ga0207668_10046700 3300025972 Bacteria 2960
205 Ga0207668_10107140 3300025972 Bacteria 2089
206 Ga0207668_10133386 3300025972 Bacteria 1899
207 Ga0207658_10009878 3300025986 Bacteria 6483
208 Ga0207703_10026308 3300026035 Bacteria 4578
209 Ga0207678_10102697 3300026067 Bacteria 2441
210 Ga0207641_10009957 3300026088 Bacteria 7825
211 Ga0207641_10018507 3300026088 Bacteria 5712
212 Ga0207648_10004231 3300026089 Bacteria 14834
213 Ga0207676_10011655 3300026095 Bacteria 6288
214 Ga0207676_10088550 3300026095 Bacteria 2534
215 Ga0207675_100000845 3300026118 Bacteria 30452
216 Ga0207675_100033721 3300026118 Bacteria 4770
217 Ga0207683_10067123 3300026121 Bacteria 3164
218 Ga0209371_1000159 3300027312 Bacteria 105294
219 Ga0209970_1002174 3300027614 Bacteria 3363
220 Ga0209974_10005586 3300027876 Bacteria 4415
221 Ga0207428_10011022 3300027907 Bacteria 8035
222 Ga0207428_10024743 3300027907 Bacteria 5039
223 Ga0207428_10028452 3300027907 Bacteria 4644
224 Ga0268266_10122875 3300028379 Bacteria 2312
225 Ga0268265_10001485 3300028380 Bacteria 19646
226 Ga0268265_10001835 3300028380 Bacteria 16951
227 Ga0268265_10048942 3300028380 Bacteria 3176
228 Ga0268264_10012786 3300028381 Bacteria 6908
229 Ga0307517_10140190 3300028786 Bacteria 1701
230 Ga0265338_10017990 3300028800 Bacteria 7588
231 Ga0268256_1000131 3300030500 Bacteria 105216
232 Ga0265340_10043169 3300031247 Bacteria 2211
233 Ga0307513_10007804 3300031456 Bacteria 13802
234 Ga0307509_10000062 3300031507 Bacteria 143809
235 Ga0307408_100011744 3300031548 Bacteria 5791
236 Ga0316575_10020212 3300031665 Bacteria 2554
237 Ga0316575_10049225 3300031665 Bacteria 1677
238 Ga0316576_10014193 3300031727 Bacteria 5317
239 Ga0316578_10014058 3300031728 Bacteria 4263
240 Ga0307405_10026940 3300031731 Bacteria 3325
241 Ga0316577_10022144 3300031733 Bacteria 3528
242 Ga0307406_10002823 3300031901 Bacteria 9465
243 Ga0307406_10041349 3300031901 Bacteria 2872
244 Ga0307412_10012405 3300031911 Bacteria 4968
245 Ga0307416_100022586 3300032002 Bacteria 4544
246 Ga0307416_100047110 3300032002 Bacteria 3409
247 Ga0307416_100225918 3300032002 Bacteria 1800
248 Ga0307414_10001711 3300032004 Bacteria 11427
249 Ga0307414_10012928 3300032004 Bacteria 4956
250 Ga0307411_10065193 3300032005 Bacteria 2442
251 Ga0316580_10001134 3300032139 Bacteria 6736
252 Ga0307510_10000122 3300033180 Bacteria 62024
253 Ga0373955_0067777 3300035172 Bacteria 1987
254 Ga0316574_0001748 3300035398 Bacteria 10518
255 Ga0316574_0005517 3300035398 Bacteria 6751
256 Ga0316574_0008906 3300035398 Bacteria 5600
257 Ga0373937_0011717 3300036401 Bacteria 7690
258 Ga0316582_0148181 3300036647 Bacteria 1585
259 Ga0316584_0003954 3300036712 Bacteria 9742
260 Ga0395901_0202013 3300038443 Bacteria 2083
261 Ga0436365_0535738 3300039437 Bacteria 1904
262 Ga0436360_0303267 3300039438 Bacteria 2205
263 Ga0436363_0198659 3300039450 Bacteria 7739
264 Ga0439436_0004920 3300041404 Bacteria 4098
265 Ga0439447_002973 3300041407 Bacteria 6076
266 Ga0439465_0005576 3300041413 Bacteria 4010
267 Ga0439449_0006669 3300042007 Bacteria 4413
268 Ga0439449_0020631 3300042007 Bacteria 2469
269 Ga0450914_001523 3300042118 Bacteria 1476
270 Ga0451577_0035692 3300042876 Bacteria 4478
271 Ga0466972_0000242 3300044658 Bacteria 37309
272 Ga0453684_0077570 3300044712 Bacteria 4162
273 Ga0451576_0046763 3300045051 Bacteria 4555
274 Ga0451576_0058765 3300045051 Bacteria 4016
275 Ga0495638_0003743 3300046460 Bacteria 11835
276 Ga0495638_0040693 3300046460 Bacteria 2944
277 Ga0495638_0065073 3300046460 Bacteria 2245
278 Ga0495650_0009517 3300046471 Bacteria 5518
279 Ga0495616_0064510 3300046513 Bacteria 1787
280 Ga0495642_0005810 3300046528 Bacteria 4731
281 Ga0495656_0019493 3300046615 Bacteria 2618
282 Ga0495668_0000500 3300046616 Bacteria 48965
283 Ga0495625_0007324 3300046660 Bacteria 9636
284 Ga0495636_0008944 3300047318 Bacteria 3944
285 Ga0495672_0051818 3300047320 Bacteria 2415
286 Ga0495673_0007087 3300047469 Bacteria 6496
287 Ga0495602_0075749 3300048088 Bacteria 2855
288 Ga0496106_0019370 3300048909 Bacteria 5047
289 Ga0496109_0167169 3300048912 Bacteria 2063
290 Ga0496116_0022585 3300048919 Bacteria 4710
291 Ga0496116_0033341 3300048919 Bacteria 3656
292 Ga0496117_0000176 3300048920 Bacteria 131822
293 Ga0496117_0001903 3300048920 Bacteria 27999
294 Ga0496117_0004441 3300048920 Bacteria 15465
295 Ga0496118_0002382 3300048921 Bacteria 25392
296 Ga0496118_0012199 3300048921 Bacteria 8281
297 Ga0496118_0062466 3300048921 Bacteria 2749
298 Ga0496118_0066819 3300048921 Bacteria 2623
299 Ga0496119_0000587 3300048922 Bacteria 49190
300 Ga0496119_0000626 3300048922 Bacteria 47693
301 Ga0496120_0000377 3300048923 Bacteria 72242
302 Ga0496121_0000562 3300048924 Bacteria 69996
303 Ga0496121_0003187 3300048924 Bacteria 23648
304 Ga0496121_0027105 3300048924 Bacteria 5372
305 Ga0496121_0052761 3300048924 Bacteria 3411
306 Ga0496122_0000424 3300048925 Bacteria 89287
307 Ga0496122_0133513 3300048925 Bacteria 1570
308 Ga0496123_0000282 3300048926 Bacteria 99907
309 Ga0496123_0009582 3300048926 Bacteria 8698
310 Ga0496123_0010164 3300048926 Bacteria 8355
311 Ga0496124_0000823 3300048927 Bacteria 50544
312 Ga0496124_0002068 3300048927 Bacteria 27193
313 Ga0496124_0009765 3300048927 Bacteria 9820
314 Ga0496125_0000486 3300048928 Bacteria 69727
315 Ga0496125_0004219 3300048928 Bacteria 16745
316 Ga0496125_0023558 3300048928 Bacteria 5680
317 Ga0496126_0004671 3300048929 Bacteria 16196
318 Ga0496126_0011473 3300048929 Bacteria 9167
319 Ga0496126_0057488 3300048929 Bacteria 3511
320 Ga0501299_006083 3300049522 Bacteria 1881
321 Ga0501043_0004118 3300049579 Bacteria 11874
322 Ga0501079_0043934 3300049741 Bacteria 3449
323 Ga0501081_0004812 3300049743 Bacteria 8675
324 Ga0501279_006375 3300049775 Bacteria 1557
325 nmdc:mga05p37_26657_c1 3300050507 Bacteria 7028
326 nmdc:mga05p37_59776_c1 3300050507 Bacteria 4693
327 nmdc:mga09592_15972_c1 3300050508 Bacteria 6135
328 nmdc:mga09592_593_c1 3300050508 Bacteria 27434
329 nmdc:mga0qj67_37220_c1 3300050509 Bacteria 3811
330 nmdc:mga0qj67_714_c1 3300050509 Bacteria 22593
331 nmdc:mga06r32_740_c1 3300050510 Bacteria 28652
332 nmdc:mga06r32_88_c1 3300050510 Bacteria 63377
333 nmdc:mga08y16_38327_c1 3300050511 Bacteria 5034
334 nmdc:mga08y16_42890_c1 3300050511 Bacteria 4739
335 nmdc:mga08y16_77_c1 3300050511 Bacteria 82433
336 nmdc:mga0n895_8861_c1 3300050512 Bacteria 8756
337 Ga0495601_0009446 3300053077 Bacteria 5769
338 Ga0500643_000097 3300053087 Bacteria 92120
339 Ga0500573_0014869 3300053140 Bacteria 4408
340 Ga0500645_010179 3300053730 Bacteria 3125
341 2513642452 2513237094 Bacteria 8789602
342 2547502002 2547132130 Bacteria 4660562
343 2578456440 2576861471 Bacteria 4648976
344 2585204815 2582581294 Bacteria 6626667
345 2596374815 2595698237 Bacteria 6712432
346 2643818051 2643221559 Bacteria 4424915
347 2643880204 2643221573 Bacteria 4784121
348 2643937710 2643221586 Bacteria 4446529
349 2643975336 2643221593 Bacteria 6296053
350 2644078623 2643221612 Bacteria 4361984
351 2644662248 2643221720 Bacteria 4694283
352 2644693400 2643221727 Bacteria 4415595
353 2644698861 2643221728 Bacteria 4797149
354 2747950113 2747842428 Bacteria 4689383
355 2748018153 2747842501 Bacteria 5293829
356 2765581062 2765235840 Bacteria 4663337
357 2816517942 2816332141 Bacteria 4436036
358 2819661767 2818991457 Bacteria 5323295
359 2842394097 2842391507 Bacteria 4486072
360 2842761268 2842757796 Bacteria 3981385
361 2852651685 2852649853 Bacteria 4036942
362 2852688416 2852684882 Bacteria 5463342
363 2857444576 2857442823 Bacteria 4562550
364 2874223713 2874220319 Bacteria 4594709
365 2894415945 2894414249 Bacteria 4405451
366 2919089264 2919089067 Bacteria 4560942
367 2919134187 2919130084 Bacteria 5301837
368 2919136491 2919134579 Bacteria 4480386
369 2923516322 2923516293 Bacteria 3716336
370 2928125525 2928125067 Bacteria 5937560
371 2928499354 2928496128 Bacteria 4631123
372 2929199771 2929195423 Bacteria 5325372
373 2931382885 2931380184 Bacteria 4455911
374 2937612512 2937610967 Bacteria 4618818
375 2939590320 2939589442 Bacteria 4214238
376 2939626718 2939622612 Bacteria 4698046
377 2939628524 2939626828 Bacteria 4695272
378 2939634855 2939631187 Bacteria 6118131
379 2941479403 2941475908 Bacteria 4145589
380 2941493129 2941489479 Bacteria 6313767
381 2953994911 2953994433 Bacteria 4303959
382 2961050477 2961047084 Bacteria 4594415
383 2961064369 2961064222 Bacteria 4749990
384 2974307098 2974307012 Bacteria 4172388
385 2977247843 2977247770 Bacteria 4160543
386 2984517701 2984514374 Bacteria 4172479
387 2989775138 2989771324 Bacteria 5605128
388 2995949215 2995948881 Bacteria 6358104
389 8003017818 8003014200 Bacteria 4059994
390 8019659093 8019648815 Bacteria 10014479
391 8021626182 8021622325 Bacteria 4844743
392 8021627203 8021626552 Bacteria 4665214
393 8021651171 8021648035 Bacteria 4772378
394 8024492729 8024486573 Bacteria 6540512
395 8054566673 8054563764 Bacteria 5592885
396 Ga0065707_10082218
397 SwRhRL2b_contig_3837291
398 JGI25152J39213_1000525
399 JGI25151J46595_10000693
400 JGI25153J46596_10009809
401 rootL2_10279950
402 Ga0055526_1000003
403 Ga0055526_1007078
404 Ga0055526_1016361
405 Ga0055537_1000287
406 Ga0055524_1000002
407 Ga0055524_1001701
408 Ga0055536_1003360
409 Ga0055534_1000050
410 Ga0055528_1000001
411 Ga0055528_1000295
412 Ga0055530_10002961
413 Ga0055531_10018707
414 Ga0055531_10020960
415 Ga0058692_1000062
416 Ga0065704_10004123
417 Ga0065712_10071340
418 Ga0065715_10091476
419 Ga0070676_10004058
420 Ga0070683_100015340
421 Ga0070670_100000524
422 Ga0068869_100001869
423 Ga0070666_10057790
424 Ga0070680_100000968
425 Ga0070680_100007296
426 Ga0070680_100046383
427 Ga0070689_100000298
428 Ga0070692_10053527
429 Ga0070668_100002342
430 Ga0070668_100007940
431 Ga0070668_100015901
432 Ga0070668_100048514
433 Ga0070668_100068660
434 Ga0070669_100097911
435 Ga0070674_100030977
436 Ga0070673_100003142
437 Ga0070688_100000861
438 Ga0070667_100023050
439 Ga0070710_10055102
440 Ga0070701_10032265
441 Ga0070694_100062696
442 Ga0070678_100043867
443 Ga0070678_100080499
444 Ga0070684_100000398
445 Ga0070684_100118882
446 Ga0070672_100069883
447 Ga0070665_100020598
448 Ga0068855_100000777
449 Ga0070664_100000454
450 Ga0070664_100024678
451 Ga0068859_100001621
452 Ga0068859_100008320
453 Ga0068864_100001211
454 Ga0068861_100000504
455 Ga0068861_100011288
456 Ga0068861_100014140
457 Ga0068870_10007617
458 Ga0068863_100001906
459 Ga0068863_100174926
460 Ga0068858_100042701
461 Ga0068860_100000327
462 Ga0068860_100020350
463 Ga0068862_100000325
464 Ga0068862_100004822
465 Ga0068862_100063473
466 Ga0081538_10019337
467 Ga0081540_1000195
468 Ga0081539_10023824
469 Ga0075428_100000933
470 Ga0075428_100006725
471 Ga0075430_100007262
472 Ga0075430_100123565
473 Ga0075431_100000094
474 Ga0075431_100000503
475 Ga0075431_100027276
476 Ga0075434_100082032
477 Ga0075429_100000147
478 Ga0075429_100001370
479 Ga0097620_100001621
480 Ga0097620_100008320
481 Ga0099795_10002447
482 Ga0105251_10000008
483 Ga0105251_10002377
484 Ga0105240_10020714
485 Ga0105240_10130635
486 Ga0105240_10218970
487 Ga0111539_10005666
488 Ga0111539_10020050
489 Ga0111539_10039841
490 Ga0111539_10043891
491 Ga0105247_10046509
492 Ga0114129_10003130
493 Ga0114129_10076014
494 Ga0105243_10001525
495 Ga0105237_10074509
496 Ga0105249_10021708
497 Ga0099796_10001955
498 Ga0099796_10009379
499 Ga0105239_10027054
500 Ga0157371_10000158
501 Ga0157371_10047472
502 Ga0157371_10186963
503 Ga0157370_10008312
504 Ga0157370_10027830
505 Ga0157369_10033905
506 Ga0157369_10081817
507 Ga0157374_10122287
508 Ga0163162_10323866
509 Ga0157375_10056084
510 Ga0163163_10001204
511 Ga0157380_10000208
512 Ga0182008_10000360
513 Ga0157377_10005233
514 Ga0182006_1008606
515 Ga0182007_10000019
516 Ga0182005_1000048
517 Ga0182005_1000088
518 Ga0182005_1004813
519 Ga0183360_10003
520 Ga0163161_10010242
521 Ga0163161_10028148
522 Ga0213876_10105278
523 Ga0207425_1015747
524 Ga0209677_101544
525 Ga0209148_1009148
526 Ga0209129_1000153
527 Ga0209565_1000002
528 Ga0209673_1000002
529 Ga0209673_1000317
530 Ga0209673_1004512
531 Ga0209673_1008538
532 Ga0209130_1002935
533 Ga0209675_1000002
534 Ga0209676_1000143
535 Ga0209676_1001178
536 Ga0209676_1001205
537 Ga0209676_1003335
538 Ga0209676_1006683
539 Ga0209676_1008522
540 Ga0209676_1014702
541 Ga0209676_1016599
542 Ga0209025_1000134
543 Ga0209025_1001827
544 Ga0209025_1012945
545 Ga0209025_1053508
546 Ga0209564_1000004
547 Ga0209564_1001398
548 Ga0209564_1007086
549 Ga0209758_1000153
550 Ga0209758_1008037
551 Ga0209758_1024943
552 Ga0209050_1000109
553 Ga0209050_1001299
554 Ga0209050_1015645
555 Ga0209050_1021635
556 Ga0209256_1000004
557 Ga0209256_1000624
558 Ga0209256_1005891
559 Ga0209256_1009412
560 Ga0209256_1013227
561 Ga0207426_1000390
562 Ga0209051_1003796
563 Ga0209051_1025885
564 Ga0209257_1000474
565 Ga0209257_1000751
566 Ga0209257_1000965
567 Ga0209257_1001919
568 Ga0209257_1002607
569 Ga0207713_1000170
570 Ga0207713_1023310
571 Ga0207692_10016934
572 Ga0207710_10023692
573 Ga0207645_10010680
574 Ga0207695_10013943
575 Ga0207695_10099494
576 Ga0207693_10073883
577 Ga0207660_10013689
578 Ga0207657_10063230
579 Ga0207652_10078742
580 Ga0207681_10001316
581 Ga0207694_10005212
582 Ga0207650_10001091
583 Ga0207650_10050005
584 Ga0207659_10002663
585 Ga0207644_10009249
586 Ga0207706_10007038
587 Ga0207709_10001660
588 Ga0207709_10018566
589 Ga0207670_10001483
590 Ga0207669_10031127
591 Ga0207691_10020769
592 Ga0207711_10013463
593 Ga0207689_10006588
594 Ga0207679_10040795
595 Ga0207679_10106360
596 Ga0207651_10050726
597 Ga0207712_10006532
598 Ga0207668_10011503
599 Ga0207668_10046700
600 Ga0207668_10107140
601 Ga0207668_10133386
602 Ga0207658_10009878
603 Ga0207703_10026308
604 Ga0207678_10102697
605 Ga0207641_10009957
606 Ga0207641_10018507
607 Ga0207648_10004231
608 Ga0207676_10011655
609 Ga0207676_10088550
610 Ga0207675_100000845
611 Ga0207675_100033721
612 Ga0207683_10067123
613 Ga0209371_1000159
614 Ga0209970_1002174
615 Ga0209974_10005586
616 Ga0207428_10011022
617 Ga0207428_10024743
618 Ga0207428_10028452
619 Ga0268266_10122875
620 Ga0268265_10001485
621 Ga0268265_10001835
622 Ga0268265_10048942
623 Ga0268264_10012786
624 Ga0307517_10140190
625 Ga0265338_10017990
626 Ga0268256_1000131
627 Ga0265340_10043169
628 Ga0307513_10007804
629 Ga0307509_10000062
630 Ga0307408_100011744
631 Ga0316575_10020212
632 Ga0316575_10049225
633 Ga0316576_10014193
634 Ga0316578_10014058
635 Ga0307405_10026940
636 Ga0316577_10022144
637 Ga0307406_10002823
638 Ga0307406_10041349
639 Ga0307412_10012405
640 Ga0307416_100022586
641 Ga0307416_100047110
642 Ga0307416_100225918
643 Ga0307414_10001711
644 Ga0307414_10012928
645 Ga0307411_10065193
646 Ga0316580_10001134
647 Ga0307510_10000122
648 Ga0373955_0067777
649 Ga0316574_0001748
650 Ga0316574_0005517
651 Ga0316574_0008906
652 Ga0373937_0011717
653 Ga0316582_0148181
654 Ga0316584_0003954
655 Ga0395901_0202013
656 Ga0436365_0535738
657 Ga0436360_0303267
658 Ga0436363_0198659
659 Ga0439436_0004920
660 Ga0439447_002973
661 Ga0439465_0005576
662 Ga0439449_0006669
663 Ga0439449_0020631
664 Ga0450914_001523
665 Ga0451577_0035692
666 Ga0466972_0000242
667 Ga0453684_0077570
668 Ga0451576_0046763
669 Ga0451576_0058765
670 Ga0495638_0003743
671 Ga0495638_0040693
672 Ga0495638_0065073
673 Ga0495650_0009517
674 Ga0495616_0064510
675 Ga0495642_0005810
676 Ga0495656_0019493
677 Ga0495668_0000500
678 Ga0495625_0007324
679 Ga0495636_0008944
680 Ga0495672_0051818
681 Ga0495673_0007087
682 Ga0495602_0075749
683 Ga0496106_0019370
684 Ga0496109_0167169
685 Ga0496116_0022585
686 Ga0496116_0033341
687 Ga0496117_0000176
688 Ga0496117_0001903
689 Ga0496117_0004441
690 Ga0496118_0002382
691 Ga0496118_0012199
692 Ga0496118_0062466
693 Ga0496118_0066819
694 Ga0496119_0000587
695 Ga0496119_0000626
696 Ga0496120_0000377
697 Ga0496121_0000562
698 Ga0496121_0003187
699 Ga0496121_0027105
700 Ga0496121_0052761
701 Ga0496122_0000424
702 Ga0496122_0133513
703 Ga0496123_0000282
704 Ga0496123_0009582
705 Ga0496123_0010164
706 Ga0496124_0000823
707 Ga0496124_0002068
708 Ga0496124_0009765
709 Ga0496125_0000486
710 Ga0496125_0004219
711 Ga0496125_0023558
712 Ga0496126_0004671
713 Ga0496126_0011473
714 Ga0496126_0057488
715 Ga0501299_006083
716 Ga0501043_0004118
717 Ga0501079_0043934
718 Ga0501081_0004812
719 Ga0501279_006375
720 nmdc:mga05p37_26657_c1
721 nmdc:mga05p37_59776_c1
722 nmdc:mga09592_15972_c1
723 nmdc:mga09592_593_c1
724 nmdc:mga0qj67_37220_c1
725 nmdc:mga0qj67_714_c1
726 nmdc:mga06r32_740_c1
727 nmdc:mga06r32_88_c1
728 nmdc:mga08y16_38327_c1
729 nmdc:mga08y16_42890_c1
730 nmdc:mga08y16_77_c1
731 nmdc:mga0n895_8861_c1
732 Ga0495601_0009446
733 Ga0500643_000097
734 Ga0500573_0014869
735 Ga0500645_010179
736 2513642452
737 2547502002
738 2578456440
739 2585204815
740 2596374815
741 2643818051
742 2643880204
743 2643937710
744 2643975336
745 2644078623
746 2644662248
747 2644693400
748 2644698861
749 2747950113
750 2748018153
751 2765581062
752 2816517942
753 2819661767
754 2842394097
755 2842761268
756 2852651685
757 2852688416
758 2857444576
759 2874223713
760 2894415945
761 2919089264
762 2919134187
763 2919136491
764 2923516322
765 2928125525
766 2928499354
767 2929199771
768 2931382885
769 2937612512
770 2939590320
771 2939626718
772 2939628524
773 2939634855
774 2941479403
775 2941493129
776 2953994911
777 2961050477
778 2961064369
779 2974307098
780 2977247843
781 2984517701
782 2989775138
783 2995949215
784 8003017818
785 8019659093
786 8021626182
787 8021627203
788 8021651171
789 8024492729
790 8054566673

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

57

483

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.891 1 402
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8882 1 404
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.8725 2 404
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8253 1 404
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.8239 1 402
ID Description Score Start End Superfamily
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5123 14 364 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.4898 14 364 1.20.1630.10
af_Q4FZV2_37_153_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4755 22 149 1.10.10.1740
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.4698 12 150 1.20.120.80
af_O80854_5_217_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4655 1 146 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A0K6IUC4-F1-model_v4 Bacterial Cytochrome Ubiquinol Oxidase 0.9894 141 254 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A2S3VW54-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9868 1 197 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A3C1NGB6-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9837 1 202 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A8B4PMX7-F1-model_v4 deleted 0.9835 1 258
AF-A0A2X3EXR3-F1-model_v4 Cytochrome oxidase bd-II, subunit I (EC 1.10.3.-) 0.983 1 244 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069

Map