F433160

General Info

Members Datasets Scaffolds Average Seq Length
395 199 790 244

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100022329|Ga0070664_1000223295
Length 266
Sequence MGCRRTHSQRPVGSVVRMVARRTVVLGGTKGMGRALSRLMASRGDRVCLLGRDAVELAKSADDLTARGASHAGFALCDLDVPRGFAGALAKASQQLSGIDVVVVTAAAFATQAQLESDRDRLQYLLGLNFTNTILFCETAREHLMQAGSVNPTLCVFSSVAGDRGRKPVVFYGATKAGLSRYLEGLDHRFASRGLRVICVKPGFVRTSMTDGLPEPPFAGDPDAVAVRVLTAIDRGTPVVYAPPVWALIMAVIRLLPRAIMRRVDF

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
132 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
194 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
195 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 0
Rhizoplane 3.04
Rhizosphere 89.11
Stem 0
Stem Tuber 0
Unclassified 15.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100022329 3300005564 Bacteria 5217
2 JGI24751J29686_10009447 3300002459 Unclassified 2004
3 JGI25406J46586_10000821 3300003203 Bacteria 14594
4 JGI25406J46586_10001120 3300003203 Bacteria 12551
5 rootH2_10037687 3300003320 Unclassified 2618
6 rootH2_10093615 3300003320 Bacteria 7170
7 rootH1_10076783 3300003323 Bacteria 8287
8 rootH1_10103604 3300003323 Bacteria 6540
9 rootH1_10135944 3300003323 Bacteria 10874
10 Ga0065712_10012209 3300005290 Bacteria 1946
11 Ga0070676_10003816 3300005328 Bacteria 7906
12 Ga0070690_100004505 3300005330 Bacteria 7749
13 Ga0070670_100021682 3300005331 Bacteria 5523
14 Ga0070670_100029243 3300005331 Bacteria 4742
15 Ga0070670_100269438 3300005331 Bacteria 1486
16 Ga0070677_10014979 3300005333 Bacteria 2740
17 Ga0070677_10120832 3300005333 Bacteria 1183
18 Ga0070680_100160332 3300005336 Bacteria 1890
19 Ga0070682_100029588 3300005337 Unclassified 3299
20 Ga0070660_100007747 3300005339 Bacteria 7490
21 Ga0070660_100371957 3300005339 Unclassified 1179
22 Ga0070689_100026479 3300005340 Bacteria 4366
23 Ga0070687_100001450 3300005343 Bacteria 8352
24 Ga0070661_100457395 3300005344 Bacteria 1016
25 Ga0070668_100045944 3300005347 Unclassified 3351
26 Ga0070668_100527394 3300005347 Unclassified 1025
27 Ga0070675_100026592 3300005354 Bacteria 4645
28 Ga0070675_100969342 3300005354 Unclassified 780
29 Ga0070674_100010420 3300005356 Bacteria 5622
30 Ga0070673_100000799 3300005364 Bacteria 17550
31 Ga0070673_100031365 3300005364 Bacteria 3987
32 Ga0070673_100120435 3300005364 Unclassified 2189
33 Ga0070688_100049720 3300005365 Bacteria 2610
34 Ga0070688_100073543 3300005365 Bacteria 2192
35 Ga0070688_100104184 3300005365 Unclassified 1875
36 Ga0070667_100148717 3300005367 Unclassified 2056
37 Ga0070667_100721289 3300005367 Bacteria 923
38 Ga0070701_10108989 3300005438 Unclassified 1545
39 Ga0070700_100005899 3300005441 Bacteria 6510
40 Ga0070678_100028985 3300005456 Bacteria 3784
41 Ga0070678_100150677 3300005456 Unclassified 1873
42 Ga0070678_100235658 3300005456 Unclassified 1528
43 Ga0070662_100679302 3300005457 Bacteria 870
44 Ga0070681_10018793 3300005458 Bacteria 6917
45 Ga0070681_10105294 3300005458 Bacteria 2763
46 Ga0068867_100010439 3300005459 Bacteria 6555
47 Ga0068867_100326837 3300005459 Bacteria 1272
48 Ga0068867_100775243 3300005459 Bacteria 853
49 Ga0070685_10011509 3300005466 Bacteria 4631
50 Ga0070685_10184134 3300005466 Bacteria 1347
51 Ga0070685_10357634 3300005466 Unclassified 1000
52 Ga0070699_100075234 3300005518 Bacteria 2939
53 Ga0070679_100009812 3300005530 Bacteria 9058
54 Ga0070679_100011310 3300005530 Bacteria 8509
55 Ga0070679_100194799 3300005530 Bacteria 1994
56 Ga0070684_100493801 3300005535 Bacteria 1133
57 Ga0070672_100006596 3300005543 Bacteria 7814
58 Ga0070672_100008416 3300005543 Bacteria 7052
59 Ga0070672_100444742 3300005543 Bacteria 1116
60 Ga0070686_100006472 3300005544 Bacteria 6512
61 Ga0070686_100012380 3300005544 Bacteria 4856
62 Ga0070686_100157825 3300005544 Unclassified 1595
63 Ga0070704_100172820 3300005549 Bacteria 1720
64 Ga0068855_100044605 3300005563 Bacteria 5247
65 Ga0070664_100113595 3300005564 Bacteria 2366
66 Ga0068856_100009276 3300005614 Bacteria 9558
67 Ga0068856_101123126 3300005614 Bacteria 803
68 Ga0070702_100082669 3300005615 Bacteria 1927
69 Ga0068859_100002658 3300005617 Bacteria 18141
70 Ga0068859_100464813 3300005617 Bacteria 1361
71 Ga0068859_100717843 3300005617 Bacteria 1090
72 Ga0068864_100470880 3300005618 Bacteria 1204
73 Ga0068861_100027862 3300005719 Bacteria 4119
74 Ga0068851_10129769 3300005834 Unclassified 1362
75 Ga0068863_100107400 3300005841 Bacteria 2656
76 Ga0068858_100223716 3300005842 Bacteria 1783
77 Ga0068860_100010558 3300005843 Bacteria 9125
78 Ga0068860_100046100 3300005843 Unclassified 4156
79 Ga0068860_100384440 3300005843 Bacteria 1386
80 Ga0068862_100014539 3300005844 Bacteria 6534
81 Ga0081539_10000029 3300005985 Bacteria 322399
82 Ga0081539_10000036 3300005985 Bacteria 296724
83 Ga0081539_10008575 3300005985 Bacteria 8844
84 Ga0081539_10052955 3300005985 Bacteria 2275
85 Ga0075365_10001159 3300006038 Bacteria 11567
86 Ga0075368_10038468 3300006042 Bacteria 1873
87 Ga0075363_100023459 3300006048 Bacteria 3127
88 Ga0075364_10005754 3300006051 Bacteria 7231
89 Ga0075364_10150131 3300006051 Bacteria 1570
90 Ga0070716_100048209 3300006173 Bacteria 2407
91 Ga0075367_10077225 3300006178 Bacteria 2011
92 Ga0075367_10127647 3300006178 Bacteria 1570
93 Ga0075369_10000597 3300006186 Bacteria 11455
94 Ga0075427_10004466 3300006194 Bacteria 1961
95 Ga0097621_100016404 3300006237 Bacteria 5600
96 Ga0097621_100052113 3300006237 Bacteria 3333
97 Ga0097621_100266083 3300006237 Unclassified 1505
98 Ga0097621_100519004 3300006237 Unclassified 1081
99 Ga0097621_100522633 3300006237 Bacteria 1077
100 Ga0075370_10042821 3300006353 Bacteria 2558
101 Ga0068871_100133272 3300006358 Unclassified 2108
102 Ga0068871_100184351 3300006358 Unclassified 1795
103 Ga0068871_100739958 3300006358 Bacteria 903
104 Ga0068865_100080313 3300006881 Unclassified 2338
105 Ga0068865_100103729 3300006881 Unclassified 2086
106 Ga0097620_100002658 3300006931 Bacteria 18141
107 Ga0097620_100464815 3300006931 Bacteria 1361
108 Ga0097620_100717858 3300006931 Bacteria 1090
109 Ga0105245_10004385 3300009098 Bacteria 12490
110 Ga0105245_10155856 3300009098 Unclassified 2163
111 Ga0105241_10009819 3300009174 Bacteria 7033
112 Ga0105248_10012991 3300009177 Bacteria 9179
113 Ga0105248_10033256 3300009177 Bacteria 5759
114 Ga0105248_10133925 3300009177 Bacteria 2796
115 Ga0105248_10231736 3300009177 Bacteria 2079
116 Ga0105248_10368063 3300009177 Bacteria 1618
117 Ga0105248_10515968 3300009177 Unclassified 1348
118 Ga0105238_10166947 3300009551 Bacteria 2177
119 Ga0105249_10070105 3300009553 Bacteria 3236
120 Ga0157374_10041304 3300013296 Unclassified 4250
121 Ga0157374_10614183 3300013296 Bacteria 1098
122 Ga0157378_10055971 3300013297 Unclassified 3514
123 Ga0163162_10313645 3300013306 Bacteria 1701
124 Ga0157375_10422236 3300013308 Bacteria 1499
125 Ga0163163_10018835 3300014325 Bacteria 6474
126 Ga0157380_10179721 3300014326 Unclassified 1858
127 Ga0157380_10229622 3300014326 Unclassified 1666
128 Ga0157376_10070072 3300014969 Unclassified 2975
129 Ga0157376_10090469 3300014969 Bacteria 2649
130 Ga0157376_10147145 3300014969 Bacteria 2120
131 Ga0157376_10184975 3300014969 Bacteria 1907
132 Ga0157376_10210545 3300014969 Unclassified 1794
133 Ga0207653_10021022 3300025885 Unclassified 2068
134 Ga0207642_10216234 3300025899 Bacteria 1068
135 Ga0207645_10011073 3300025907 Bacteria 6171
136 Ga0207705_10038216 3300025909 Bacteria 3436
137 Ga0207654_10004699 3300025911 Bacteria 6912
138 Ga0207707_10091955 3300025912 Bacteria 2651
139 Ga0207660_10210887 3300025917 Unclassified 1521
140 Ga0207662_10013192 3300025918 Bacteria 4619
141 Ga0207652_10004815 3300025921 Bacteria 10931
142 Ga0207652_10008555 3300025921 Bacteria 8237
143 Ga0207681_10038391 3300025923 Unclassified 3172
144 Ga0207694_10060047 3300025924 Bacteria 2958
145 Ga0207650_10017125 3300025925 Bacteria 5072
146 Ga0207650_10095549 3300025925 Bacteria 2278
147 Ga0207650_10114360 3300025925 Bacteria 2093
148 Ga0207659_10254673 3300025926 Bacteria 1425
149 Ga0207687_10006857 3300025927 Bacteria 7500
150 Ga0207644_10477131 3300025931 Bacteria 1027
151 Ga0207690_10136913 3300025932 Bacteria 1799
152 Ga0207706_10650251 3300025933 Bacteria 903
153 Ga0207670_10004530 3300025936 Bacteria 7496
154 Ga0207670_10009442 3300025936 Bacteria 5567
155 Ga0207670_10269703 3300025936 Bacteria 1322
156 Ga0207669_10001676 3300025937 Bacteria 9424
157 Ga0207669_10069351 3300025937 Bacteria 2206
158 Ga0207704_10000361 3300025938 Bacteria 21152
159 Ga0207665_10099585 3300025939 Bacteria 2027
160 Ga0207691_10003392 3300025940 Bacteria 15494
161 Ga0207691_10008983 3300025940 Bacteria 9586
162 Ga0207691_10191950 3300025940 Unclassified 1781
163 Ga0207711_10077496 3300025941 Bacteria 2898
164 Ga0207711_10349258 3300025941 Bacteria 1369
165 Ga0207711_10398262 3300025941 Unclassified 1279
166 Ga0207711_10498728 3300025941 Bacteria 1135
167 Ga0207711_10576773 3300025941 Unclassified 1049
168 Ga0207689_10127470 3300025942 Bacteria 2093
169 Ga0207661_10276403 3300025944 Unclassified 1500
170 Ga0207667_10033584 3300025949 Bacteria 5515
171 Ga0207651_10014723 3300025960 Bacteria 4525
172 Ga0207668_10066551 3300025972 Unclassified 2554
173 Ga0207658_10107911 3300025986 Unclassified 2195
174 Ga0207658_10654414 3300025986 Unclassified 947
175 Ga0207703_10596747 3300026035 Unclassified 1044
176 Ga0207708_10000910 3300026075 Bacteria 22248
177 Ga0207702_10033788 3300026078 Bacteria 4273
178 Ga0207641_10301880 3300026088 Unclassified 1513
179 Ga0207641_10364345 3300026088 Bacteria 1381
180 Ga0207648_10004487 3300026089 Bacteria 14320
181 Ga0207648_10360467 3300026089 Bacteria 1312
182 Ga0207675_100027078 3300026118 Bacteria 5338
183 Ga0207675_100247517 3300026118 Bacteria 1724
184 Ga0207675_100319217 3300026118 Bacteria 1516
185 Ga0207675_100905117 3300026118 Bacteria 899
186 Ga0207683_10007501 3300026121 Bacteria 9351
187 Ga0207683_10048581 3300026121 Bacteria 3715
188 Ga0207683_10371528 3300026121 Bacteria 1314
189 Ga0207698_10382306 3300026142 Bacteria 1340
190 Ga0209813_10018315 3300027866 Bacteria 1933
191 Ga0268266_10046240 3300028379 Bacteria 3727
192 Ga0268265_10451983 3300028380 Bacteria 1200
193 Ga0268265_11010218 3300028380 Bacteria 822
194 Ga0268264_10053394 3300028381 Unclassified 3371
195 Ga0268264_10210567 3300028381 Bacteria 1784
196 Ga0265328_10172142 3300031239 Bacteria 818
197 Ga0307513_10048574 3300031456 Unclassified 4605
198 Ga0307513_10056509 3300031456 Bacteria 4189
199 Ga0307408_100039921 3300031548 Bacteria 3321
200 Ga0265314_10022407 3300031711 Bacteria 4838
201 Ga0307407_10043562 3300031903 Bacteria 2524
202 Ga0307416_100612789 3300032002 Bacteria 1170
203 Ga0307415_100019131 3300032126 Bacteria 4152
204 Ga0373950_0000005 3300034818 Bacteria 404272
205 Ga0373936_0142690 3300035113 Unclassified 1035
206 Ga0373955_0076489 3300035172 Bacteria 1883
207 Ga0373955_0100648 3300035172 Unclassified 1659
208 Ga0373935_0508584 3300035692 Bacteria 875
209 Ga0373927_0119887 3300035695 Unclassified 1717
210 Ga0373933_0022175 3300035724 Bacteria 3614
211 Ga0373947_0104270 3300035725 Bacteria 1785
212 Ga0373937_0027773 3300036401 Bacteria 5120
213 Ga0373937_0106531 3300036401 Bacteria 2605
214 Ga0373925_0240299 3300037068 Unclassified 1450
215 Ga0439436_0065472 3300041404 Bacteria 1015
216 Ga0451797_0617303 3300041453 Bacteria 2099
217 Ga0451800_1125647 3300041459 Unclassified 1114
218 Ga0451807_0536500 3300041486 Unclassified 1140
219 Ga0451807_1507404 3300041486 Bacteria 2937
220 Ga0451807_2151318 3300041486 Bacteria 5416
221 Ga0451849_0641032 3300041505 Bacteria 5770
222 Ga0451853_0389133 3300041512 Bacteria 5296
223 Ga0466959_0343626 3300045049 Bacteria 1018
224 Ga0451576_0225178 3300045051 Bacteria 1958
225 Ga0495617_027107 3300046452 Unclassified 1929
226 Ga0495592_0196984 3300046454 Bacteria 1362
227 Ga0495662_0282501 3300046476 Unclassified 817
228 Ga0495664_0225071 3300046477 Unclassified 1135
229 Ga0495586_0007971 3300046535 Bacteria 5649
230 Ga0495634_0002114 3300046642 Bacteria 16758
231 Ga0495599_0219851 3300046678 Bacteria 1163
232 Ga0495674_0001339 3300047319 Bacteria 24024
233 Ga0495672_0005297 3300047320 Bacteria 10265
234 Ga0495675_0360771 3300047444 Bacteria 853
235 Ga0495602_0194343 3300048088 Unclassified 1553
236 Ga0496100_0381066 3300048903 Bacteria 1071
237 Ga0496101_0043380 3300048904 Bacteria 3215
238 Ga0496104_0210602 3300048907 Bacteria 1855
239 Ga0496106_0252658 3300048909 Bacteria 1410
240 Ga0496107_0227524 3300048910 Bacteria 1387
241 Ga0496114_0000065 3300048917 Bacteria 77292
242 Ga0496115_0003399 3300048918 Bacteria 11427
243 Ga0501031_0029511 3300049568 Bacteria 3577
244 Ga0501031_0048597 3300049568 Bacteria 2764
245 Ga0501032_0021253 3300049569 Bacteria 4513
246 Ga0501032_0028506 3300049569 Bacteria 3837
247 Ga0501032_0032498 3300049569 Bacteria 3576
248 Ga0501033_0001768 3300049570 Bacteria 18891
249 Ga0501033_0035221 3300049570 Bacteria 3753
250 Ga0501033_0044326 3300049570 Bacteria 3311
251 Ga0501033_0048929 3300049570 Bacteria 3139
252 Ga0501033_0307802 3300049570 Bacteria 1114
253 Ga0501034_0016573 3300049571 Bacteria 7554
254 Ga0501034_0023954 3300049571 Bacteria 6212
255 Ga0501034_0069192 3300049571 Bacteria 3540
256 Ga0501034_0070975 3300049571 Bacteria 3493
257 Ga0501034_0080778 3300049571 Bacteria 3254
258 Ga0501034_0228159 3300049571 Bacteria 1812
259 Ga0501036_0012173 3300049572 Bacteria 7126
260 Ga0501036_0022686 3300049572 Bacteria 5282
261 Ga0501036_0039109 3300049572 Bacteria 4016
262 Ga0501036_0079149 3300049572 Bacteria 2780
263 Ga0501036_0140669 3300049572 Bacteria 2037
264 Ga0501037_0007815 3300049573 Bacteria 7831
265 Ga0501037_0065254 3300049573 Bacteria 2652
266 Ga0501037_0074200 3300049573 Bacteria 2472
267 Ga0501037_0119624 3300049573 Bacteria 1894
268 Ga0501038_0004496 3300049574 Bacteria 12971
269 Ga0501038_0012380 3300049574 Bacteria 7797
270 Ga0501038_0015325 3300049574 Bacteria 6969
271 Ga0501038_0017741 3300049574 Bacteria 6433
272 Ga0501038_0061356 3300049574 Bacteria 3215
273 Ga0501038_0063460 3300049574 Bacteria 3152
274 Ga0501039_0043264 3300049575 Bacteria 3479
275 Ga0501039_0055692 3300049575 Bacteria 3063
276 Ga0501039_0188526 3300049575 Bacteria 1622
277 Ga0501042_0042222 3300049578 Bacteria 3245
278 Ga0501042_0319014 3300049578 Bacteria 1123
279 Ga0501043_0000717 3300049579 Bacteria 29385
280 Ga0501043_0013306 3300049579 Bacteria 6434
281 Ga0501043_0015836 3300049579 Bacteria 5909
282 Ga0501043_0015873 3300049579 Bacteria 5903
283 Ga0501043_0034693 3300049579 Bacteria 3968
284 Ga0501043_0050517 3300049579 Bacteria 3269
285 Ga0501046_0023571 3300049580 Bacteria 5061
286 Ga0501046_0030978 3300049580 Bacteria 4340
287 Ga0501046_0042836 3300049580 Bacteria 3607
288 Ga0501046_0053254 3300049580 Bacteria 3187
289 Ga0501046_0090830 3300049580 Bacteria 2349
290 Ga0501047_0000504 3300049581 Bacteria 42147
291 Ga0501047_0013660 3300049581 Bacteria 7707
292 Ga0501047_0013953 3300049581 Bacteria 7634
293 Ga0501047_0015435 3300049581 Bacteria 7277
294 Ga0501047_0026091 3300049581 Bacteria 5619
295 Ga0501047_0037691 3300049581 Bacteria 4675
296 Ga0501047_0105209 3300049581 Bacteria 2702
297 Ga0501047_0243173 3300049581 Unclassified 1649
298 Ga0501047_0377402 3300049581 Bacteria 1252
299 Ga0501048_0009547 3300049582 Bacteria 7283
300 Ga0501048_0041888 3300049582 Bacteria 3280
301 Ga0501048_0049670 3300049582 Bacteria 2989
302 Ga0501048_0222684 3300049582 Bacteria 1338
303 Ga0501067_0000155 3300049583 Bacteria 37990
304 Ga0501067_0002873 3300049583 Bacteria 9487
305 Ga0501067_0007422 3300049583 Bacteria 6092
306 Ga0501067_0022486 3300049583 Bacteria 3489
307 Ga0501067_0056654 3300049583 Bacteria 2171
308 Ga0501067_0082664 3300049583 Unclassified 1781
309 Ga0501067_0278032 3300049583 Bacteria 932
310 Ga0501068_0004423 3300049584 Bacteria 7644
311 Ga0501068_0007003 3300049584 Bacteria 6236
312 Ga0501068_0013314 3300049584 Bacteria 4677
313 Ga0501068_0021053 3300049584 Bacteria 3806
314 Ga0501068_0063237 3300049584 Bacteria 2251
315 Ga0501069_0025777 3300049585 Bacteria 3215
316 Ga0501069_0036397 3300049585 Bacteria 2714
317 Ga0501069_0073419 3300049585 Unclassified 1918
318 Ga0501070_0009680 3300049586 Bacteria 8148
319 Ga0501070_0116322 3300049586 Bacteria 2208
320 Ga0501070_0543058 3300049586 Bacteria 931
321 Ga0501071_0025182 3300049587 Bacteria 4166
322 Ga0501072_0020095 3300049588 Bacteria 5171
323 Ga0501072_0157068 3300049588 Bacteria 1813
324 Ga0501072_0189768 3300049588 Bacteria 1639
325 Ga0501073_0001323 3300049589 Bacteria 18248
326 Ga0501073_0011751 3300049589 Bacteria 6393
327 Ga0501073_0014656 3300049589 Bacteria 5695
328 Ga0501073_0019053 3300049589 Bacteria 4959
329 Ga0501073_0032637 3300049589 Bacteria 3712
330 Ga0501073_0058344 3300049589 Bacteria 2697
331 Ga0501073_0107229 3300049589 Unclassified 1938
332 Ga0501073_0226158 3300049589 Bacteria 1292
333 Ga0501073_0228501 3300049589 Bacteria 1285
334 Ga0501074_0033391 3300049590 Bacteria 3728
335 Ga0501074_0043747 3300049590 Bacteria 3241
336 Ga0501076_0035223 3300049592 Bacteria 3917
337 Ga0501076_0268287 3300049592 Bacteria 1398
338 Ga0501076_0295963 3300049592 Bacteria 1326
339 Ga0501077_0338109 3300049593 Unclassified 960
340 Ga0501079_0005370 3300049741 Bacteria 9545
341 Ga0501079_0009541 3300049741 Bacteria 7358
342 Ga0501079_0370168 3300049741 Bacteria 1123
343 Ga0501080_0044299 3300049742 Bacteria 4142
344 Ga0501080_0045306 3300049742 Bacteria 4094
345 Ga0501080_0089155 3300049742 Bacteria 2865
346 Ga0501080_0100778 3300049742 Bacteria 2679
347 Ga0501080_0179568 3300049742 Bacteria 1948
348 Ga0501080_0189806 3300049742 Bacteria 1888
349 Ga0501083_0009607 3300049744 Bacteria 6834
350 Ga0501083_0017650 3300049744 Bacteria 4974
351 Ga0501083_0029728 3300049744 Bacteria 3755
352 Ga0501083_0034945 3300049744 Bacteria 3435
353 Ga0501083_0050377 3300049744 Bacteria 2803
354 Ga0501083_0073206 3300049744 Bacteria 2277
355 Ga0501083_0099551 3300049744 Bacteria 1917
356 Ga0501035_0052867 3300049822 Bacteria 3634
357 Ga0501035_0058245 3300049822 Bacteria 3443
358 Ga0501035_0065374 3300049822 Bacteria 3230
359 Ga0501035_0071667 3300049822 Bacteria 3067
360 Ga0501035_0072190 3300049822 Bacteria 3055
361 Ga0501044_0011273 3300049823 Bacteria 9688
362 Ga0501044_0021369 3300049823 Bacteria 6906
363 Ga0501044_0027370 3300049823 Bacteria 6026
364 Ga0501044_0193266 3300049823 Bacteria 1996
365 Ga0501044_0206311 3300049823 Bacteria 1921
366 Ga0501044_0314061 3300049823 Bacteria 1493
367 Ga0501045_0033603 3300049824 Bacteria 3719
368 nmdc:mga03n38_13161_c1 3300050490 Bacteria 3134
369 nmdc:mga00v17_61384_c1 3300050491 Bacteria 2311
370 nmdc:mga00v17_83796_c1 3300050491 Bacteria 1995
371 nmdc:mga0yw44_2283_c1 3300050492 Bacteria 8093
372 nmdc:mga06z11_40616_c1 3300050494 Bacteria 2323
373 nmdc:mga04h51_4453_c1 3300050495 Bacteria 3486
374 nmdc:mga07m45_47404_c1 3300050496 Bacteria 2416
375 nmdc:mga0n895_163437_c1 3300050512 Bacteria 2258
376 nmdc:mga0n895_582772_c1 3300050512 Bacteria 1122
377 nmdc:mga0sz30_61_c1 3300050516 Bacteria 41450
378 Ga0500635_0058668 3300053080 Bacteria 1337
379 Ga0500650_0113516 3300053098 Unclassified 1264
380 Ga0500555_000202 3300053103 Bacteria 27708
381 Ga0500645_000636 3300053730 Bacteria 22311
382 Ga0501084_0001258 3300054114 Bacteria 19952
383 Ga0501084_0007506 3300054114 Bacteria 8990
384 Ga0501084_0040122 3300054114 Bacteria 3915
385 Ga0501084_0057625 3300054114 Bacteria 3250
386 Ga0501084_0121014 3300054114 Bacteria 2201
387 Ga0501082_0008288 3300060353 Bacteria 8963
388 Ga0501082_0026534 3300060353 Bacteria 4993
389 Ga0501082_0044398 3300060353 Bacteria 3833
390 Ga0501082_0058248 3300060353 Bacteria 3328
391 Ga0501082_0096076 3300060353 Bacteria 2561
392 Ga0501082_0231822 3300060353 Bacteria 1607
393 Ga0501082_0355576 3300060353 Bacteria 1277
394 Ga0501082_0397971 3300060353 Unclassified 1202
395 Ga0530510_0151140 3300061734 Bacteria 1715
396 Ga0070664_100022329
397 JGI24751J29686_10009447
398 JGI25406J46586_10000821
399 JGI25406J46586_10001120
400 rootH2_10037687
401 rootH2_10093615
402 rootH1_10076783
403 rootH1_10103604
404 rootH1_10135944
405 Ga0065712_10012209
406 Ga0070676_10003816
407 Ga0070690_100004505
408 Ga0070670_100021682
409 Ga0070670_100029243
410 Ga0070670_100269438
411 Ga0070677_10014979
412 Ga0070677_10120832
413 Ga0070680_100160332
414 Ga0070682_100029588
415 Ga0070660_100007747
416 Ga0070660_100371957
417 Ga0070689_100026479
418 Ga0070687_100001450
419 Ga0070661_100457395
420 Ga0070668_100045944
421 Ga0070668_100527394
422 Ga0070675_100026592
423 Ga0070675_100969342
424 Ga0070674_100010420
425 Ga0070673_100000799
426 Ga0070673_100031365
427 Ga0070673_100120435
428 Ga0070688_100049720
429 Ga0070688_100073543
430 Ga0070688_100104184
431 Ga0070667_100148717
432 Ga0070667_100721289
433 Ga0070701_10108989
434 Ga0070700_100005899
435 Ga0070678_100028985
436 Ga0070678_100150677
437 Ga0070678_100235658
438 Ga0070662_100679302
439 Ga0070681_10018793
440 Ga0070681_10105294
441 Ga0068867_100010439
442 Ga0068867_100326837
443 Ga0068867_100775243
444 Ga0070685_10011509
445 Ga0070685_10184134
446 Ga0070685_10357634
447 Ga0070699_100075234
448 Ga0070679_100009812
449 Ga0070679_100011310
450 Ga0070679_100194799
451 Ga0070684_100493801
452 Ga0070672_100006596
453 Ga0070672_100008416
454 Ga0070672_100444742
455 Ga0070686_100006472
456 Ga0070686_100012380
457 Ga0070686_100157825
458 Ga0070704_100172820
459 Ga0068855_100044605
460 Ga0070664_100113595
461 Ga0068856_100009276
462 Ga0068856_101123126
463 Ga0070702_100082669
464 Ga0068859_100002658
465 Ga0068859_100464813
466 Ga0068859_100717843
467 Ga0068864_100470880
468 Ga0068861_100027862
469 Ga0068851_10129769
470 Ga0068863_100107400
471 Ga0068858_100223716
472 Ga0068860_100010558
473 Ga0068860_100046100
474 Ga0068860_100384440
475 Ga0068862_100014539
476 Ga0081539_10000029
477 Ga0081539_10000036
478 Ga0081539_10008575
479 Ga0081539_10052955
480 Ga0075365_10001159
481 Ga0075368_10038468
482 Ga0075363_100023459
483 Ga0075364_10005754
484 Ga0075364_10150131
485 Ga0070716_100048209
486 Ga0075367_10077225
487 Ga0075367_10127647
488 Ga0075369_10000597
489 Ga0075427_10004466
490 Ga0097621_100016404
491 Ga0097621_100052113
492 Ga0097621_100266083
493 Ga0097621_100519004
494 Ga0097621_100522633
495 Ga0075370_10042821
496 Ga0068871_100133272
497 Ga0068871_100184351
498 Ga0068871_100739958
499 Ga0068865_100080313
500 Ga0068865_100103729
501 Ga0097620_100002658
502 Ga0097620_100464815
503 Ga0097620_100717858
504 Ga0105245_10004385
505 Ga0105245_10155856
506 Ga0105241_10009819
507 Ga0105248_10012991
508 Ga0105248_10033256
509 Ga0105248_10133925
510 Ga0105248_10231736
511 Ga0105248_10368063
512 Ga0105248_10515968
513 Ga0105238_10166947
514 Ga0105249_10070105
515 Ga0157374_10041304
516 Ga0157374_10614183
517 Ga0157378_10055971
518 Ga0163162_10313645
519 Ga0157375_10422236
520 Ga0163163_10018835
521 Ga0157380_10179721
522 Ga0157380_10229622
523 Ga0157376_10070072
524 Ga0157376_10090469
525 Ga0157376_10147145
526 Ga0157376_10184975
527 Ga0157376_10210545
528 Ga0207653_10021022
529 Ga0207642_10216234
530 Ga0207645_10011073
531 Ga0207705_10038216
532 Ga0207654_10004699
533 Ga0207707_10091955
534 Ga0207660_10210887
535 Ga0207662_10013192
536 Ga0207652_10004815
537 Ga0207652_10008555
538 Ga0207681_10038391
539 Ga0207694_10060047
540 Ga0207650_10017125
541 Ga0207650_10095549
542 Ga0207650_10114360
543 Ga0207659_10254673
544 Ga0207687_10006857
545 Ga0207644_10477131
546 Ga0207690_10136913
547 Ga0207706_10650251
548 Ga0207670_10004530
549 Ga0207670_10009442
550 Ga0207670_10269703
551 Ga0207669_10001676
552 Ga0207669_10069351
553 Ga0207704_10000361
554 Ga0207665_10099585
555 Ga0207691_10003392
556 Ga0207691_10008983
557 Ga0207691_10191950
558 Ga0207711_10077496
559 Ga0207711_10349258
560 Ga0207711_10398262
561 Ga0207711_10498728
562 Ga0207711_10576773
563 Ga0207689_10127470
564 Ga0207661_10276403
565 Ga0207667_10033584
566 Ga0207651_10014723
567 Ga0207668_10066551
568 Ga0207658_10107911
569 Ga0207658_10654414
570 Ga0207703_10596747
571 Ga0207708_10000910
572 Ga0207702_10033788
573 Ga0207641_10301880
574 Ga0207641_10364345
575 Ga0207648_10004487
576 Ga0207648_10360467
577 Ga0207675_100027078
578 Ga0207675_100247517
579 Ga0207675_100319217
580 Ga0207675_100905117
581 Ga0207683_10007501
582 Ga0207683_10048581
583 Ga0207683_10371528
584 Ga0207698_10382306
585 Ga0209813_10018315
586 Ga0268266_10046240
587 Ga0268265_10451983
588 Ga0268265_11010218
589 Ga0268264_10053394
590 Ga0268264_10210567
591 Ga0265328_10172142
592 Ga0307513_10048574
593 Ga0307513_10056509
594 Ga0307408_100039921
595 Ga0265314_10022407
596 Ga0307407_10043562
597 Ga0307416_100612789
598 Ga0307415_100019131
599 Ga0373950_0000005
600 Ga0373936_0142690
601 Ga0373955_0076489
602 Ga0373955_0100648
603 Ga0373935_0508584
604 Ga0373927_0119887
605 Ga0373933_0022175
606 Ga0373947_0104270
607 Ga0373937_0027773
608 Ga0373937_0106531
609 Ga0373925_0240299
610 Ga0439436_0065472
611 Ga0451797_0617303
612 Ga0451800_1125647
613 Ga0451807_0536500
614 Ga0451807_1507404
615 Ga0451807_2151318
616 Ga0451849_0641032
617 Ga0451853_0389133
618 Ga0466959_0343626
619 Ga0451576_0225178
620 Ga0495617_027107
621 Ga0495592_0196984
622 Ga0495662_0282501
623 Ga0495664_0225071
624 Ga0495586_0007971
625 Ga0495634_0002114
626 Ga0495599_0219851
627 Ga0495674_0001339
628 Ga0495672_0005297
629 Ga0495675_0360771
630 Ga0495602_0194343
631 Ga0496100_0381066
632 Ga0496101_0043380
633 Ga0496104_0210602
634 Ga0496106_0252658
635 Ga0496107_0227524
636 Ga0496114_0000065
637 Ga0496115_0003399
638 Ga0501031_0029511
639 Ga0501031_0048597
640 Ga0501032_0021253
641 Ga0501032_0028506
642 Ga0501032_0032498
643 Ga0501033_0001768
644 Ga0501033_0035221
645 Ga0501033_0044326
646 Ga0501033_0048929
647 Ga0501033_0307802
648 Ga0501034_0016573
649 Ga0501034_0023954
650 Ga0501034_0069192
651 Ga0501034_0070975
652 Ga0501034_0080778
653 Ga0501034_0228159
654 Ga0501036_0012173
655 Ga0501036_0022686
656 Ga0501036_0039109
657 Ga0501036_0079149
658 Ga0501036_0140669
659 Ga0501037_0007815
660 Ga0501037_0065254
661 Ga0501037_0074200
662 Ga0501037_0119624
663 Ga0501038_0004496
664 Ga0501038_0012380
665 Ga0501038_0015325
666 Ga0501038_0017741
667 Ga0501038_0061356
668 Ga0501038_0063460
669 Ga0501039_0043264
670 Ga0501039_0055692
671 Ga0501039_0188526
672 Ga0501042_0042222
673 Ga0501042_0319014
674 Ga0501043_0000717
675 Ga0501043_0013306
676 Ga0501043_0015836
677 Ga0501043_0015873
678 Ga0501043_0034693
679 Ga0501043_0050517
680 Ga0501046_0023571
681 Ga0501046_0030978
682 Ga0501046_0042836
683 Ga0501046_0053254
684 Ga0501046_0090830
685 Ga0501047_0000504
686 Ga0501047_0013660
687 Ga0501047_0013953
688 Ga0501047_0015435
689 Ga0501047_0026091
690 Ga0501047_0037691
691 Ga0501047_0105209
692 Ga0501047_0243173
693 Ga0501047_0377402
694 Ga0501048_0009547
695 Ga0501048_0041888
696 Ga0501048_0049670
697 Ga0501048_0222684
698 Ga0501067_0000155
699 Ga0501067_0002873
700 Ga0501067_0007422
701 Ga0501067_0022486
702 Ga0501067_0056654
703 Ga0501067_0082664
704 Ga0501067_0278032
705 Ga0501068_0004423
706 Ga0501068_0007003
707 Ga0501068_0013314
708 Ga0501068_0021053
709 Ga0501068_0063237
710 Ga0501069_0025777
711 Ga0501069_0036397
712 Ga0501069_0073419
713 Ga0501070_0009680
714 Ga0501070_0116322
715 Ga0501070_0543058
716 Ga0501071_0025182
717 Ga0501072_0020095
718 Ga0501072_0157068
719 Ga0501072_0189768
720 Ga0501073_0001323
721 Ga0501073_0011751
722 Ga0501073_0014656
723 Ga0501073_0019053
724 Ga0501073_0032637
725 Ga0501073_0058344
726 Ga0501073_0107229
727 Ga0501073_0226158
728 Ga0501073_0228501
729 Ga0501074_0033391
730 Ga0501074_0043747
731 Ga0501076_0035223
732 Ga0501076_0268287
733 Ga0501076_0295963
734 Ga0501077_0338109
735 Ga0501079_0005370
736 Ga0501079_0009541
737 Ga0501079_0370168
738 Ga0501080_0044299
739 Ga0501080_0045306
740 Ga0501080_0089155
741 Ga0501080_0100778
742 Ga0501080_0179568
743 Ga0501080_0189806
744 Ga0501083_0009607
745 Ga0501083_0017650
746 Ga0501083_0029728
747 Ga0501083_0034945
748 Ga0501083_0050377
749 Ga0501083_0073206
750 Ga0501083_0099551
751 Ga0501035_0052867
752 Ga0501035_0058245
753 Ga0501035_0065374
754 Ga0501035_0071667
755 Ga0501035_0072190
756 Ga0501044_0011273
757 Ga0501044_0021369
758 Ga0501044_0027370
759 Ga0501044_0193266
760 Ga0501044_0206311
761 Ga0501044_0314061
762 Ga0501045_0033603
763 nmdc:mga03n38_13161_c1
764 nmdc:mga00v17_61384_c1
765 nmdc:mga00v17_83796_c1
766 nmdc:mga0yw44_2283_c1
767 nmdc:mga06z11_40616_c1
768 nmdc:mga04h51_4453_c1
769 nmdc:mga07m45_47404_c1
770 nmdc:mga0n895_163437_c1
771 nmdc:mga0n895_582772_c1
772 nmdc:mga0sz30_61_c1
773 Ga0500635_0058668
774 Ga0500650_0113516
775 Ga0500555_000202
776 Ga0500645_000636
777 Ga0501084_0001258
778 Ga0501084_0007506
779 Ga0501084_0040122
780 Ga0501084_0057625
781 Ga0501084_0121014
782 Ga0501082_0008288
783 Ga0501082_0026534
784 Ga0501082_0044398
785 Ga0501082_0058248
786 Ga0501082_0096076
787 Ga0501082_0231822
788 Ga0501082_0355576
789 Ga0501082_0397971
790 Ga0530510_0151140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

21

217

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

27

229

0.93

PF08659

KR

KR domain

22

207

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x7g-assembly1.cif.gz_B-2 actinorhodin polyketide ketoreductase, act kr, with nadp bound 0.909 2 221
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9058 2 220
4gh5-assembly1.cif.gz_C crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s-hpcdh) 0.9018 2 220
7e24-assembly2.cif.gz_C crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.9013 1 218
1g6k-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant e96a complexed with nad+ 0.9004 2 223
ID Description Score Start End Superfamily
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.941 3 242 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9298 3 242 3.40.50.720
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9207 1 73 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.918 2 51 3.40.50.720
af_F1QWW8_53_297_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9176 1 220 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y5DZ93-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9922 59 245 GO:0016020
GO:0016491
AF-A0A4U1JGS4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9916 2 245 GO:0016020
GO:0016491
AF-A0A7C3EKD1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9845 2 245 GO:0016020
GO:0016491
AF-A0A4U1JGS4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9835 2 245 GO:0016020
GO:0016491
AF-A0A7Y5DZ93-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9817 59 245 GO:0016020
GO:0016491

Map