F433163

General Info

Members Datasets Scaffolds Average Seq Length
395 193 391 222

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100000002|Ga0068861_10000000219
Length 238
Sequence MPMVAATAPLLYRRPMLKLIIGNKAYSSWSLRGWLAARQSGLPFEESVVPLYDADWDKRREGDEFAPSSGKVPILWDGDVVVWDSLAIIEYLNEKSGGDKFWPVGEAARAMARSMAAEMHSGFAALRKNHSMNIRQVYPASPVLPDVQSELTRLYELWAQARARFGGEGEFLFGKFGAADIMFAPVVTRIVTYSLPMPRFAPAYMNAVLQHPFMQDWIAAAQEEDWVIEKFEQPAPAI

Samples

Sample ID Description Type Environment
1 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
2 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
3 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
4 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
159 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
189 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
192 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
193 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.25
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.56
Nodule 0
Rhizoplane 1.27
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10005664 3300002067 Bacteria 4131
2 Ga0065165_1006943 3300005262 Bacteria 5743
3 Ga0070658_10003377 3300005327 Bacteria 13153
4 Ga0070658_10133677 3300005327 Bacteria 2068
5 Ga0070676_10408001 3300005328 Bacteria 947
6 Ga0070683_100071884 3300005329 Bacteria 3228
7 Ga0070683_100105793 3300005329 Bacteria 2652
8 Ga0070670_100006664 3300005331 Bacteria 9787
9 Ga0070670_100016187 3300005331 Bacteria 6401
10 Ga0070670_100017912 3300005331 Bacteria 6080
11 Ga0070670_100070749 3300005331 Bacteria 2995
12 Ga0070670_100101890 3300005331 Bacteria 2472
13 Ga0070670_100109064 3300005331 Bacteria 2385
14 Ga0070670_100387344 3300005331 Bacteria 1232
15 Ga0068869_100019342 3300005334 Bacteria 4651
16 Ga0070666_10000090 3300005335 Bacteria 64025
17 Ga0070666_10468874 3300005335 Bacteria 911
18 Ga0070680_100079719 3300005336 Bacteria 2699
19 Ga0070680_100440375 3300005336 Bacteria 1113
20 Ga0070682_100134569 3300005337 Bacteria 1677
21 Ga0070682_100141471 3300005337 Bacteria 1641
22 Ga0068868_100131399 3300005338 Bacteria 2049
23 Ga0068868_100230379 3300005338 Bacteria 1554
24 Ga0070660_100001476 3300005339 Bacteria 16095
25 Ga0070691_10071076 3300005341 Bacteria 1689
26 Ga0070661_100003051 3300005344 Bacteria 11522
27 Ga0070661_100146786 3300005344 Bacteria 1781
28 Ga0070668_100003127 3300005347 Bacteria 12231
29 Ga0070668_100015800 3300005347 Bacteria 5648
30 Ga0070668_100188249 3300005347 Bacteria 1689
31 Ga0070668_100463088 3300005347 Bacteria 1092
32 Ga0070669_100000024 3300005353 Bacteria 173107
33 Ga0070669_100060876 3300005353 Bacteria 2774
34 Ga0070675_100077163 3300005354 Bacteria 2773
35 Ga0070675_100224909 3300005354 Bacteria 1635
36 Ga0070675_100321928 3300005354 Bacteria 1366
37 Ga0070671_100050916 3300005355 Bacteria 3445
38 Ga0070674_100079868 3300005356 Bacteria 2334
39 Ga0070673_100104585 3300005364 Bacteria 2338
40 Ga0070673_100530640 3300005364 Bacteria 1067
41 Ga0070659_100002899 3300005366 Bacteria 12212
42 Ga0070659_100137312 3300005366 Bacteria 1989
43 Ga0070667_100157665 3300005367 Bacteria 1997
44 Ga0070714_100034445 3300005435 Bacteria 4241
45 Ga0070705_100005144 3300005440 Bacteria 6351
46 Ga0070705_100023737 3300005440 Bacteria 3299
47 Ga0070700_100209602 3300005441 Bacteria 1374
48 Ga0070700_100612469 3300005441 Bacteria 855
49 Ga0070708_100490611 3300005445 Bacteria 1159
50 Ga0070663_100028995 3300005455 Bacteria 3776
51 Ga0070662_100000183 3300005457 Bacteria 36515
52 Ga0070662_100040147 3300005457 Bacteria 3331
53 Ga0070681_10004781 3300005458 Bacteria 12980
54 Ga0070685_10131643 3300005466 Bacteria 1565
55 Ga0070679_100001448 3300005530 Bacteria 20991
56 Ga0070679_100040999 3300005530 Bacteria 4608
57 Ga0070679_100064644 3300005530 Bacteria 3646
58 Ga0070679_100128653 3300005530 Bacteria 2514
59 Ga0070684_100219514 3300005535 Bacteria 1735
60 Ga0068853_100002487 3300005539 Bacteria 13809
61 Ga0068853_100009036 3300005539 Bacteria 8025
62 Ga0068853_100896469 3300005539 Bacteria 852
63 Ga0070672_100010025 3300005543 Bacteria 6556
64 Ga0070672_100018227 3300005543 Bacteria 5070
65 Ga0070672_100128235 3300005543 Bacteria 2083
66 Ga0070672_100139888 3300005543 Bacteria 1996
67 Ga0070672_100790225 3300005543 Bacteria 835
68 Ga0070665_100975503 3300005548 Bacteria 860
69 Ga0068855_100004493 3300005563 Bacteria 17049
70 Ga0068855_100111889 3300005563 Bacteria 3134
71 Ga0070664_100002251 3300005564 Bacteria 15526
72 Ga0070664_100032625 3300005564 Bacteria 4356
73 Ga0070664_100070632 3300005564 Bacteria 2991
74 Ga0070664_100510263 3300005564 Bacteria 1109
75 Ga0068857_100126168 3300005577 Bacteria 2306
76 Ga0068854_100006566 3300005578 Bacteria 7406
77 Ga0068854_100132234 3300005578 Bacteria 1906
78 Ga0068854_100141488 3300005578 Bacteria 1847
79 Ga0068854_100428446 3300005578 Bacteria 1100
80 Ga0068854_100639835 3300005578 Bacteria 912
81 Ga0068856_100007608 3300005614 Bacteria 10573
82 Ga0068856_100025094 3300005614 Bacteria 5809
83 Ga0068856_100282694 3300005614 Bacteria 1676
84 Ga0068852_100009941 3300005616 Bacteria 7083
85 Ga0068852_100083040 3300005616 Bacteria 2848
86 Ga0068859_100007204 3300005617 Bacteria 11288
87 Ga0068859_100042533 3300005617 Bacteria 4564
88 Ga0068859_100067000 3300005617 Bacteria 3625
89 Ga0068859_100072442 3300005617 Bacteria 3482
90 Ga0068864_100002289 3300005618 Bacteria 15834
91 Ga0068864_100005347 3300005618 Bacteria 10520
92 Ga0068864_100195699 3300005618 Bacteria 1855
93 Ga0068866_10052200 3300005718 Bacteria 2086
94 Ga0068861_100000002 3300005719 Bacteria 111914
95 Ga0068861_100001546 3300005719 Bacteria 14602
96 Ga0068861_100030597 3300005719 Bacteria 3947
97 Ga0068861_100040066 3300005719 Bacteria 3501
98 Ga0068861_100311088 3300005719 Bacteria 1368
99 Ga0068863_100002025 3300005841 Bacteria 20082
100 Ga0068863_100057628 3300005841 Bacteria 3676
101 Ga0068863_100152656 3300005841 Bacteria 2210
102 Ga0068863_100292984 3300005841 Bacteria 1578
103 Ga0068858_100000884 3300005842 Bacteria 31099
104 Ga0068858_100003591 3300005842 Bacteria 15350
105 Ga0068858_100045206 3300005842 Bacteria 4080
106 Ga0068858_100401552 3300005842 Bacteria 1317
107 Ga0068860_100051804 3300005843 Bacteria 3905
108 Ga0068860_100107487 3300005843 Bacteria 2666
109 Ga0068860_100154440 3300005843 Bacteria 2211
110 Ga0068860_100279947 3300005843 Bacteria 1630
111 Ga0068860_100676297 3300005843 Bacteria 1041
112 Ga0068860_100881482 3300005843 Bacteria 910
113 Ga0068862_100000307 3300005844 Bacteria 53788
114 Ga0068862_100014854 3300005844 Bacteria 6468
115 Ga0068862_100034303 3300005844 Bacteria 4292
116 Ga0068862_100043614 3300005844 Bacteria 3824
117 Ga0068862_100252530 3300005844 Bacteria 1608
118 Ga0081539_10014155 3300005985 Bacteria 5927
119 Ga0070712_100375035 3300006175 Bacteria 1170
120 Ga0097621_100124963 3300006237 Bacteria 2185
121 Ga0097621_100740876 3300006237 Bacteria 907
122 Ga0097621_100786027 3300006237 Bacteria 881
123 Ga0068871_100003077 3300006358 Bacteria 11443
124 Ga0068865_100431293 3300006881 Bacteria 1086
125 Ga0068865_100575996 3300006881 Bacteria 948
126 Ga0068865_100607887 3300006881 Bacteria 925
127 Ga0097620_100007204 3300006931 Bacteria 11288
128 Ga0097620_100042538 3300006931 Bacteria 4564
129 Ga0097620_100066999 3300006931 Bacteria 3625
130 Ga0097620_100072441 3300006931 Bacteria 3482
131 Ga0105247_10006278 3300009101 Bacteria 7372
132 Ga0105243_10053642 3300009148 Bacteria 3199
133 Ga0105243_10080121 3300009148 Bacteria 2662
134 Ga0105241_10086940 3300009174 Bacteria 2459
135 Ga0105242_10060926 3300009176 Bacteria 3102
136 Ga0105242_10155501 3300009176 Bacteria 1997
137 Ga0105248_10001984 3300009177 Bacteria 22750
138 Ga0105248_10024724 3300009177 Bacteria 6680
139 Ga0105248_10160639 3300009177 Bacteria 2535
140 Ga0105238_11262827 3300009551 Bacteria 764
141 Ga0105249_10013187 3300009553 Bacteria 7293
142 Ga0105249_10076510 3300009553 Bacteria 3102
143 Ga0105249_10105856 3300009553 Bacteria 2653
144 Ga0105239_10547774 3300010375 Bacteria 1317
145 Ga0105246_10000234 3300011119 Bacteria 28511
146 Ga0157326_1000085 3300012513 Bacteria 9236
147 Ga0157373_10019882 3300013100 Bacteria 4885
148 Ga0157373_10067272 3300013100 Bacteria 2534
149 Ga0157373_10155635 3300013100 Bacteria 1608
150 Ga0157371_10001424 3300013102 Bacteria 24845
151 Ga0157371_10028143 3300013102 Bacteria 4072
152 Ga0157370_10212216 3300013104 Bacteria 1794
153 Ga0157370_10283556 3300013104 Bacteria 1530
154 Ga0157369_10005291 3300013105 Bacteria 15039
155 Ga0157369_10020827 3300013105 Bacteria 7330
156 Ga0157374_10046639 3300013296 Bacteria 4014
157 Ga0157378_10027285 3300013297 Bacteria 5040
158 Ga0157378_10632303 3300013297 Bacteria 1084
159 Ga0163162_10032769 3300013306 Bacteria 5160
160 Ga0163162_10045923 3300013306 Bacteria 4378
161 Ga0163162_10060493 3300013306 Bacteria 3823
162 Ga0163162_10088024 3300013306 Bacteria 3185
163 Ga0157372_10001357 3300013307 Bacteria 26480
164 Ga0157372_10026427 3300013307 Bacteria 6317
165 Ga0157372_10336059 3300013307 Bacteria 1759
166 Ga0157375_10015533 3300013308 Bacteria 6818
167 Ga0157375_10553577 3300013308 Bacteria 1312
168 Ga0163163_10008557 3300014325 Bacteria 9095
169 Ga0163163_10188922 3300014325 Bacteria 2108
170 Ga0157380_10211758 3300014326 Bacteria 1728
171 Ga0157380_10332846 3300014326 Bacteria 1413
172 Ga0157380_10422081 3300014326 Bacteria 1272
173 Ga0157380_10807996 3300014326 Bacteria 955
174 Ga0157377_10041306 3300014745 Bacteria 2558
175 Ga0157379_10030325 3300014968 Bacteria 4813
176 Ga0157379_10079256 3300014968 Bacteria 2941
177 Ga0157376_10092320 3300014969 Bacteria 2625
178 Ga0163161_10085258 3300017792 Bacteria 2330
179 Ga0163161_10407701 3300017792 Bacteria 1091
180 Ga0206356_10365627 3300020070 Bacteria 826
181 Ga0207697_10000244 3300025315 Bacteria 29795
182 Ga0207642_10069767 3300025899 Bacteria 1668
183 Ga0207710_10001144 3300025900 Bacteria 13507
184 Ga0207688_10366762 3300025901 Bacteria 889
185 Ga0207680_10001008 3300025903 Bacteria 13288
186 Ga0207643_10008046 3300025908 Bacteria 5655
187 Ga0207705_10000991 3300025909 Bacteria 23160
188 Ga0207705_10034493 3300025909 Bacteria 3618
189 Ga0207705_10185131 3300025909 Bacteria 1573
190 Ga0207654_10092260 3300025911 Bacteria 1849
191 Ga0207654_10233096 3300025911 Bacteria 1227
192 Ga0207707_10013904 3300025912 Bacteria 7017
193 Ga0207707_10623753 3300025912 Bacteria 911
194 Ga0207695_10012281 3300025913 Bacteria 10287
195 Ga0207660_10021870 3300025917 Bacteria 4304
196 Ga0207657_10000123 3300025919 Bacteria 77348
197 Ga0207649_10100175 3300025920 Bacteria 1916
198 Ga0207652_10001433 3300025921 Bacteria 21127
199 Ga0207652_10060515 3300025921 Bacteria 3267
200 Ga0207652_10100834 3300025921 Bacteria 2549
201 Ga0207652_10291484 3300025921 Bacteria 1472
202 Ga0207681_10000004 3300025923 Bacteria 559005
203 Ga0207681_10133332 3300025923 Bacteria 1839
204 Ga0207681_10143825 3300025923 Bacteria 1779
205 Ga0207681_10190375 3300025923 Bacteria 1569
206 Ga0207681_10677031 3300025923 Bacteria 856
207 Ga0207694_10009928 3300025924 Bacteria 7183
208 Ga0207650_10005890 3300025925 Bacteria 8368
209 Ga0207650_10012165 3300025925 Bacteria 5932
210 Ga0207650_10015745 3300025925 Bacteria 5272
211 Ga0207650_10151888 3300025925 Bacteria 1828
212 Ga0207650_10327594 3300025925 Bacteria 1256
213 Ga0207650_10384291 3300025925 Bacteria 1160
214 Ga0207659_10003230 3300025926 Bacteria 9749
215 Ga0207659_10276788 3300025926 Bacteria 1371
216 Ga0207659_10908172 3300025926 Bacteria 757
217 Ga0207664_10023859 3300025929 Bacteria 4590
218 Ga0207644_10000009 3300025931 Bacteria 251643
219 Ga0207644_10268126 3300025931 Bacteria 1367
220 Ga0207644_10430357 3300025931 Bacteria 1082
221 Ga0207644_10694048 3300025931 Bacteria 849
222 Ga0207690_10000792 3300025932 Bacteria 20378
223 Ga0207690_10377560 3300025932 Bacteria 1126
224 Ga0207706_10000193 3300025933 Bacteria 68202
225 Ga0207706_10065052 3300025933 Bacteria 3211
226 Ga0207706_10137257 3300025933 Bacteria 2152
227 Ga0207686_10102329 3300025934 Bacteria 1915
228 Ga0207686_10127894 3300025934 Bacteria 1739
229 Ga0207669_10110326 3300025937 Bacteria 1842
230 Ga0207669_10308186 3300025937 Bacteria 1206
231 Ga0207669_10353979 3300025937 Bacteria 1135
232 Ga0207691_10003024 3300025940 Bacteria 16412
233 Ga0207691_10003932 3300025940 Bacteria 14436
234 Ga0207691_10012414 3300025940 Bacteria 8166
235 Ga0207691_10073963 3300025940 Bacteria 3074
236 Ga0207711_10002937 3300025941 Bacteria 14903
237 Ga0207711_10073731 3300025941 Bacteria 2967
238 Ga0207711_10079011 3300025941 Bacteria 2871
239 Ga0207711_10828229 3300025941 Bacteria 861
240 Ga0207689_10076405 3300025942 Bacteria 2753
241 Ga0207661_10145155 3300025944 Bacteria 2046
242 Ga0207679_10089444 3300025945 Bacteria 2377
243 Ga0207679_10418729 3300025945 Bacteria 1182
244 Ga0207667_10002490 3300025949 Bacteria 22955
245 Ga0207667_10020154 3300025949 Bacteria 7424
246 Ga0207667_10021844 3300025949 Bacteria 7083
247 Ga0207667_10083749 3300025949 Bacteria 3302
248 Ga0207651_10081057 3300025960 Bacteria 2338
249 Ga0207712_10004250 3300025961 Bacteria 9037
250 Ga0207668_10001498 3300025972 Bacteria 13638
251 Ga0207668_10009080 3300025972 Bacteria 5942
252 Ga0207668_10196671 3300025972 Bacteria 1602
253 Ga0207640_10031461 3300025981 Bacteria 3279
254 Ga0207640_10105961 3300025981 Bacteria 1982
255 Ga0207640_10550778 3300025981 Bacteria 969
256 Ga0207640_10869951 3300025981 Bacteria 785
257 Ga0207658_10006328 3300025986 Bacteria 8083
258 Ga0207658_10279371 3300025986 Bacteria 1431
259 Ga0207658_10314272 3300025986 Bacteria 1354
260 Ga0207677_10167301 3300026023 Bacteria 1715
261 Ga0207703_10000593 3300026035 Bacteria 36861
262 Ga0207703_10057304 3300026035 Bacteria 3176
263 Ga0207703_10243438 3300026035 Bacteria 1618
264 Ga0207703_10316648 3300026035 Bacteria 1428
265 Ga0207639_10023368 3300026041 Bacteria 4464
266 Ga0207639_10199555 3300026041 Bacteria 1715
267 Ga0207639_10257821 3300026041 Bacteria 1524
268 Ga0207678_10017196 3300026067 Bacteria 6348
269 Ga0207678_10162954 3300026067 Bacteria 1904
270 Ga0207708_10197199 3300026075 Bacteria 1605
271 Ga0207702_10072618 3300026078 Bacteria 2966
272 Ga0207702_10221724 3300026078 Bacteria 1762
273 Ga0207641_10003711 3300026088 Bacteria 13451
274 Ga0207641_10015495 3300026088 Bacteria 6246
275 Ga0207641_10055196 3300026088 Bacteria 3373
276 Ga0207641_10096944 3300026088 Bacteria 2591
277 Ga0207641_10155272 3300026088 Bacteria 2076
278 Ga0207641_10342381 3300026088 Bacteria 1423
279 Ga0207648_10043632 3300026089 Bacteria 3936
280 Ga0207648_10920667 3300026089 Bacteria 817
281 Ga0207676_10001758 3300026095 Bacteria 15884
282 Ga0207676_10002368 3300026095 Bacteria 13463
283 Ga0207676_10005573 3300026095 Bacteria 8905
284 Ga0207676_10139339 3300026095 Bacteria 2074
285 Ga0207674_10004167 3300026116 Bacteria 17490
286 Ga0207674_10043643 3300026116 Bacteria 4622
287 Ga0207675_100000021 3300026118 Bacteria 116776
288 Ga0207675_100000199 3300026118 Bacteria 55487
289 Ga0207675_100017582 3300026118 Bacteria 6672
290 Ga0207675_100060130 3300026118 Bacteria 3547
291 Ga0207675_100095619 3300026118 Bacteria 2795
292 Ga0207675_100138099 3300026118 Bacteria 2314
293 Ga0207683_10010629 3300026121 Bacteria 7850
294 Ga0207683_10012312 3300026121 Bacteria 7300
295 Ga0207683_10124096 3300026121 Bacteria 2320
296 Ga0207698_10148664 3300026142 Bacteria 2030
297 Ga0207698_10152918 3300026142 Bacteria 2006
298 Ga0207698_10195190 3300026142 Bacteria 1807
299 Ga0207698_10591489 3300026142 Bacteria 1093
300 Ga0268266_10304199 3300028379 Bacteria 1488
301 Ga0268265_10000109 3300028380 Bacteria 104063
302 Ga0268265_10098684 3300028380 Bacteria 2353
303 Ga0268265_10115580 3300028380 Bacteria 2200
304 Ga0268265_10193144 3300028380 Bacteria 1760
305 Ga0268264_10000069 3300028381 Bacteria 270492
306 Ga0268264_10013425 3300028381 Bacteria 6743
307 Ga0268264_10067627 3300028381 Bacteria 3016
308 Ga0268264_10074285 3300028381 Bacteria 2887
309 Ga0268264_10106723 3300028381 Bacteria 2445
310 Ga0268264_10270682 3300028381 Bacteria 1587
311 Ga0268264_10637027 3300028381 Bacteria 1054
312 Ga0268264_10968541 3300028381 Bacteria 856
313 Ga0268264_11173369 3300028381 Bacteria 777
314 Ga0307517_10253367 3300028786 Bacteria 1030
315 Ga0307515_10313983 3300028794 Bacteria 1240
316 Ga0265330_10003094 3300031235 Bacteria 8805
317 Ga0265332_10000707 3300031238 Bacteria 21147
318 Ga0265325_10030872 3300031241 Bacteria 2872
319 Ga0265331_10000796 3300031250 Bacteria 26243
320 Ga0265327_10004935 3300031251 Bacteria 11480
321 Ga0307513_10015734 3300031456 Bacteria 9157
322 Ga0265314_10008967 3300031711 Bacteria 8514
323 Ga0265342_10009438 3300031712 Bacteria 6876
324 Ga0307413_10074432 3300031824 Bacteria 2151
325 Ga0307413_10078601 3300031824 Bacteria 2106
326 Ga0307407_10385925 3300031903 Bacteria 1001
327 Ga0307412_10011547 3300031911 Bacteria 5121
328 Ga0307412_10025389 3300031911 Bacteria 3670
329 Ga0307412_10027719 3300031911 Bacteria 3536
330 Ga0307412_10127629 3300031911 Bacteria 1842
331 Ga0307412_10722751 3300031911 Bacteria 857
332 Ga0307409_100027415 3300031995 Bacteria 4037
333 Ga0307416_100132022 3300032002 Bacteria 2250
334 Ga0307416_100197788 3300032002 Bacteria 1903
335 Ga0307416_100669938 3300032002 Bacteria 1124
336 Ga0307416_100833792 3300032002 Bacteria 1019
337 Ga0307414_10023488 3300032004 Bacteria 3912
338 Ga0307414_10109773 3300032004 Bacteria 2096
339 Ga0307414_10305188 3300032004 Bacteria 1348
340 Ga0307411_10328555 3300032005 Bacteria 1238
341 Ga0307510_10006416 3300033180 Bacteria 14025
342 Ga0373937_0068284 3300036401 Bacteria 3277
343 Ga0436363_0059392 3300039450 Bacteria 1170
344 Ga0451807_1297295 3300041486 Bacteria 1262
345 Ga0439443_007125 3300042003 Bacteria 1550
346 Ga0450912_000681 3300042116 Bacteria 1801
347 Ga0450912_004538 3300042116 Bacteria 1034
348 Ga0451577_0276933 3300042876 Bacteria 1520
349 Ga0451576_0022217 3300045051 Bacteria 6883
350 Ga0451576_0498698 3300045051 Bacteria 1279
351 Ga0495638_0044311 3300046460 Bacteria 2803
352 Ga0495580_0135412 3300046472 Bacteria 1708
353 Ga0495583_0027608 3300046506 Bacteria 2800
354 Ga0495643_0018963 3300046522 Bacteria 3985
355 Ga0495654_0030535 3300046530 Bacteria 2741
356 Ga0495654_0225840 3300046530 Bacteria 790
357 Ga0495598_0007691 3300046537 Bacteria 2482
358 Ga0495598_0022981 3300046537 Bacteria 1674
359 Ga0495621_0100649 3300046539 Bacteria 1099
360 Ga0495668_0016018 3300046616 Bacteria 4366
361 Ga0495625_0057206 3300046660 Bacteria 2774
362 Ga0495671_0009331 3300046692 Bacteria 5482
363 Ga0495677_0005540 3300047445 Bacteria 4782
364 Ga0496104_0467404 3300048907 Bacteria 1173
365 Ga0496109_0217262 3300048912 Bacteria 1798
366 Ga0496113_0238457 3300048916 Bacteria 1451
367 Ga0496114_0042215 3300048917 Bacteria 3780
368 Ga0496121_0163288 3300048924 Bacteria 1626
369 Ga0496125_0040040 3300048928 Bacteria 4025
370 Ga0496126_0014316 3300048929 Bacteria 8021
371 Ga0501034_0103060 3300049571 Bacteria 2847
372 Ga0501037_0602346 3300049573 Bacteria 738
373 Ga0501282_013743 3300049778 Bacteria 877
374 nmdc:mga07m45_104049_c1 3300050496 Bacteria 1632
375 nmdc:mga07m45_166478_c1 3300050496 Bacteria 1280
376 Ga0495595_0138520 3300053084 Bacteria 1193
377 Ga0500643_000001 3300053087 Bacteria 1440111
378 Ga0500643_000172 3300053087 Bacteria 63436
379 Ga0500643_000195 3300053087 Bacteria 57960
380 Ga0500643_001414 3300053087 Bacteria 13869
381 Ga0500643_002858 3300053087 Bacteria 8604
382 Ga0500608_000074 3300053122 Bacteria 42636
383 Ga0500559_0002598 3300053136 Bacteria 9225
384 Ga0500559_0011642 3300053136 Bacteria 3755
385 Ga0500559_0013910 3300053136 Bacteria 3403
386 Ga0500564_000068 3300053138 Bacteria 27518
387 Ga0500573_0076728 3300053140 Bacteria 1902
388 Ga0500616_0001475 3300053153 Bacteria 22359
389 Ga0500567_007764 3300053723 Bacteria 5058
390 Ga0500625_000004 3300053729 Bacteria 245905
391 Ga0500661_003069 3300055283 Bacteria 3138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10109773 Ga0307414_101097733 196
2 3300048924 Ga0496121_0163288 Ga0496121_0163288_422_1018 196
3 3300031824 Ga0307413_10074432 Ga0307413_100744323 200
4 3300031911 Ga0307412_10027719 Ga0307412_100277195 200
5 3300032002 Ga0307416_100833792 Ga0307416_1008337922 200
6 3300042003 Ga0439443_007125 Ga0439443_007125_556_1215 201
7 3300042116 Ga0450912_004538 Ga0450912_004538_71_730 201
8 3300050496 nmdc:mga07m45_166478_c1 nmdc:mga07m45_166478_c1_312_974 201
9 3300005354 Ga0070675_100321928 Ga0070675_1003219282 203
10 3300005457 Ga0070662_100040147 Ga0070662_1000401473 203
11 3300005563 Ga0068855_100111889 Ga0068855_1001118893 203
12 3300006237 Ga0097621_100740876 Ga0097621_1007408762 203
13 3300011119 Ga0105246_10000234 Ga0105246_100002343 203
14 3300013100 Ga0157373_10155635 Ga0157373_101556353 203
15 3300013308 Ga0157375_10553577 Ga0157375_105535772 203
16 3300014745 Ga0157377_10041306 Ga0157377_100413062 203
17 3300025926 Ga0207659_10276788 Ga0207659_102767882 203
18 3300025933 Ga0207706_10065052 Ga0207706_100650523 203
19 3300025949 Ga0207667_10021844 Ga0207667_100218443 203
20 3300005336 Ga0070680_100440375 Ga0070680_1004403751 204
21 3300005366 Ga0070659_100137312 Ga0070659_1001373123 204
22 3300005455 Ga0070663_100028995 Ga0070663_1000289954 204
23 3300005539 Ga0068853_100896469 Ga0068853_1008964692 204
24 3300005564 Ga0070664_100070632 Ga0070664_1000706324 204
25 3300025921 Ga0207652_10291484 Ga0207652_102914843 204
26 3300025932 Ga0207690_10377560 Ga0207690_103775602 204
27 3300026067 Ga0207678_10017196 Ga0207678_100171968 204
28 3300049573 Ga0501037_0602346 Ga0501037_0602346_33_701 204
29 3300025912 Ga0207707_10623753 Ga0207707_106237531 205
30 3300048928 Ga0496125_0040040 Ga0496125_0040040_2908_3573 205
31 3300009553 Ga0105249_10105856 Ga0105249_101058562 206
32 3300025949 Ga0207667_10083749 Ga0207667_100837491 207
33 3300026041 Ga0207639_10257821 Ga0207639_102578213 207
34 3300026116 Ga0207674_10043643 Ga0207674_100436435 207
35 3300032004 Ga0307414_10023488 Ga0307414_100234882 207
36 3300005344 Ga0070661_100146786 Ga0070661_1001467861 208
37 3300025920 Ga0207649_10100175 Ga0207649_101001752 208
38 3300031824 Ga0307413_10078601 Ga0307413_100786012 208
39 3300031911 Ga0307412_10025389 Ga0307412_100253893 208
40 3300031995 Ga0307409_100027415 Ga0307409_1000274153 208
41 3300048929 Ga0496126_0014316 Ga0496126_0014316_1831_2496 209
42 3300031712 Ga0265342_10009438 Ga0265342_100094384 210
43 3300031911 Ga0307412_10722751 Ga0307412_107227512 210
44 3300049778 Ga0501282_013743 Ga0501282_013743_152_817 210
45 3300005327 Ga0070658_10003377 Ga0070658_100033773 211
46 3300005337 Ga0070682_100141471 Ga0070682_1001414712 211
47 3300005339 Ga0070660_100001476 Ga0070660_10000147615 211
48 3300005458 Ga0070681_10004781 Ga0070681_100047812 211
49 3300005563 Ga0068855_100004493 Ga0068855_10000449316 211
50 3300005564 Ga0070664_100002251 Ga0070664_10000225110 211
51 3300005564 Ga0070664_100510263 Ga0070664_1005102631 211
52 3300005578 Ga0068854_100006566 Ga0068854_1000065669 211
53 3300010375 Ga0105239_10547774 Ga0105239_105477742 211
54 3300013100 Ga0157373_10019882 Ga0157373_100198824 211
55 3300013105 Ga0157369_10005291 Ga0157369_100052915 211
56 3300025909 Ga0207705_10034493 Ga0207705_100344933 211
57 3300025919 Ga0207657_10000123 Ga0207657_1000012333 211
58 3300025921 Ga0207652_10060515 Ga0207652_100605154 211
59 3300025932 Ga0207690_10000792 Ga0207690_1000079227 211
60 3300025945 Ga0207679_10089444 Ga0207679_100894444 211
61 3300025949 Ga0207667_10002490 Ga0207667_100024909 211
62 3300025981 Ga0207640_10105961 Ga0207640_101059612 211
63 3300032002 Ga0307416_100669938 Ga0307416_1006699382 211
64 3300005329 Ga0070683_100071884 Ga0070683_1000718843 212
65 3300005336 Ga0070680_100079719 Ga0070680_1000797192 212
66 3300005341 Ga0070691_10071076 Ga0070691_100710763 212
67 3300005366 Ga0070659_100002899 Ga0070659_1000028995 212
68 3300005457 Ga0070662_100000183 Ga0070662_10000018319 212
69 3300005530 Ga0070679_100001448 Ga0070679_10000144812 212
70 3300005539 Ga0068853_100002487 Ga0068853_1000024873 212
71 3300005614 Ga0068856_100025094 Ga0068856_1000250942 212
72 3300013102 Ga0157371_10001424 Ga0157371_1000142424 212
73 3300013307 Ga0157372_10026427 Ga0157372_100264276 212
74 3300025911 Ga0207654_10233096 Ga0207654_102330962 212
75 3300025912 Ga0207707_10013904 Ga0207707_100139046 212
76 3300025917 Ga0207660_10021870 Ga0207660_100218702 212
77 3300025933 Ga0207706_10000193 Ga0207706_1000019351 212
78 3300026041 Ga0207639_10023368 Ga0207639_100233686 212
79 3300026078 Ga0207702_10072618 Ga0207702_100726184 212
80 3300005328 Ga0070676_10408001 Ga0070676_104080012 213
81 3300005331 Ga0070670_100070749 Ga0070670_1000707491 213
82 3300005331 Ga0070670_100101890 Ga0070670_1001018902 213
83 3300005331 Ga0070670_100387344 Ga0070670_1003873442 213
84 3300005335 Ga0070666_10468874 Ga0070666_104688742 213
85 3300005347 Ga0070668_100015800 Ga0070668_1000158007 213
86 3300005347 Ga0070668_100463088 Ga0070668_1004630882 213
87 3300005445 Ga0070708_100490611 Ga0070708_1004906112 213
88 3300005543 Ga0070672_100139888 Ga0070672_1001398882 213
89 3300005616 Ga0068852_100083040 Ga0068852_1000830403 213
90 3300005617 Ga0068859_100072442 Ga0068859_1000724422 213
91 3300005618 Ga0068864_100195699 Ga0068864_1001956992 213
92 3300005719 Ga0068861_100040066 Ga0068861_1000400663 213
93 3300005841 Ga0068863_100057628 Ga0068863_1000576283 213
94 3300005841 Ga0068863_100292984 Ga0068863_1002929842 213
95 3300005842 Ga0068858_100401552 Ga0068858_1004015522 213
96 3300005843 Ga0068860_100676297 Ga0068860_1006762972 213
97 3300005843 Ga0068860_100881482 Ga0068860_1008814822 213
98 3300005844 Ga0068862_100043614 Ga0068862_1000436142 213
99 3300005844 Ga0068862_100252530 Ga0068862_1002525302 213
100 3300005985 Ga0081539_10014155 Ga0081539_100141555 213
101 3300006237 Ga0097621_100786027 Ga0097621_1007860271 213
102 3300006881 Ga0068865_100431293 Ga0068865_1004312932 213
103 3300006881 Ga0068865_100607887 Ga0068865_1006078872 213
104 3300006931 Ga0097620_100072441 Ga0097620_1000724412 213
105 3300025901 Ga0207688_10366762 Ga0207688_103667621 213
106 3300025923 Ga0207681_10143825 Ga0207681_101438252 213
107 3300025925 Ga0207650_10327594 Ga0207650_103275941 213
108 3300025925 Ga0207650_10384291 Ga0207650_103842911 213
109 3300025931 Ga0207644_10430357 Ga0207644_104303572 213
110 3300025940 Ga0207691_10003932 Ga0207691_100039323 213
111 3300025945 Ga0207679_10418729 Ga0207679_104187292 213
112 3300025972 Ga0207668_10196671 Ga0207668_101966712 213
113 3300025981 Ga0207640_10869951 Ga0207640_108699511 213
114 3300025986 Ga0207658_10314272 Ga0207658_103142722 213
115 3300026035 Ga0207703_10316648 Ga0207703_103166482 213
116 3300026088 Ga0207641_10055196 Ga0207641_100551962 213
117 3300026088 Ga0207641_10096944 Ga0207641_100969442 213
118 3300026118 Ga0207675_100060130 Ga0207675_1000601303 213
119 3300026142 Ga0207698_10195190 Ga0207698_101951901 213
120 3300028379 Ga0268266_10304199 Ga0268266_103041992 213
121 3300028380 Ga0268265_10098684 Ga0268265_100986842 213
122 3300028380 Ga0268265_10115580 Ga0268265_101155802 213
123 3300028381 Ga0268264_10074285 Ga0268264_100742852 213
124 3300028381 Ga0268264_10106723 Ga0268264_101067232 213
125 3300028381 Ga0268264_10637027 Ga0268264_106370272 213
126 3300028381 Ga0268264_11173369 Ga0268264_111733691 213
127 3300031235 Ga0265330_10003094 Ga0265330_100030949 213
128 3300031238 Ga0265332_10000707 Ga0265332_1000070719 213
129 3300031241 Ga0265325_10030872 Ga0265325_100308724 213
130 3300031250 Ga0265331_10000796 Ga0265331_1000079619 213
131 3300031251 Ga0265327_10004935 Ga0265327_100049358 213
132 3300031711 Ga0265314_10008967 Ga0265314_100089673 213
133 3300036401 Ga0373937_0068284 Ga0373937_0068284_1604_2299 213
134 3300046472 Ga0495580_0135412 Ga0495580_0135412_45_740 213
135 3300048912 Ga0496109_0217262 Ga0496109_0217262_1099_1770 213
136 3300053084 Ga0495595_0138520 Ga0495595_0138520_40_738 213
137 3300005327 Ga0070658_10133677 Ga0070658_101336773 214
138 3300005331 Ga0070670_100006664 Ga0070670_10000666411 214
139 3300005331 Ga0070670_100016187 Ga0070670_1000161876 214
140 3300005331 Ga0070670_100017912 Ga0070670_1000179122 214
141 3300005334 Ga0068869_100019342 Ga0068869_1000193422 214
142 3300005337 Ga0070682_100134569 Ga0070682_1001345692 214
143 3300005338 Ga0068868_100131399 Ga0068868_1001313992 214
144 3300005338 Ga0068868_100230379 Ga0068868_1002303792 214
145 3300005344 Ga0070661_100003051 Ga0070661_1000030511 214
146 3300005347 Ga0070668_100003127 Ga0070668_1000031272 214
147 3300005353 Ga0070669_100060876 Ga0070669_1000608762 214
148 3300005354 Ga0070675_100077163 Ga0070675_1000771632 214
149 3300005354 Ga0070675_100224909 Ga0070675_1002249092 214
150 3300005355 Ga0070671_100050916 Ga0070671_1000509162 214
151 3300005356 Ga0070674_100079868 Ga0070674_1000798682 214
152 3300005364 Ga0070673_100104585 Ga0070673_1001045852 214
153 3300005364 Ga0070673_100530640 Ga0070673_1005306402 214
154 3300005435 Ga0070714_100034445 Ga0070714_1000344452 214
155 3300005440 Ga0070705_100023737 Ga0070705_1000237373 214
156 3300005441 Ga0070700_100209602 Ga0070700_1002096022 214
157 3300005441 Ga0070700_100612469 Ga0070700_1006124691 214
158 3300005466 Ga0070685_10131643 Ga0070685_101316432 214
159 3300005530 Ga0070679_100040999 Ga0070679_1000409996 214
160 3300005530 Ga0070679_100064644 Ga0070679_1000646442 214
161 3300005530 Ga0070679_100128653 Ga0070679_1001286532 214
162 3300005539 Ga0068853_100009036 Ga0068853_1000090368 214
163 3300005543 Ga0070672_100010025 Ga0070672_1000100253 214
164 3300005543 Ga0070672_100018227 Ga0070672_1000182272 214
165 3300005543 Ga0070672_100128235 Ga0070672_1001282352 214
166 3300005548 Ga0070665_100975503 Ga0070665_1009755031 214
167 3300005564 Ga0070664_100032625 Ga0070664_1000326253 214
168 3300005577 Ga0068857_100126168 Ga0068857_1001261681 214
169 3300005578 Ga0068854_100141488 Ga0068854_1001414881 214
170 3300005578 Ga0068854_100639835 Ga0068854_1006398351 214
171 3300005614 Ga0068856_100007608 Ga0068856_1000076089 214
172 3300005616 Ga0068852_100009941 Ga0068852_1000099413 214
173 3300005617 Ga0068859_100067000 Ga0068859_1000670002 214
174 3300005618 Ga0068864_100005347 Ga0068864_10000534711 214
175 3300005718 Ga0068866_10052200 Ga0068866_100522003 214
176 3300005719 Ga0068861_100030597 Ga0068861_1000305973 214
177 3300005719 Ga0068861_100311088 Ga0068861_1003110882 214
178 3300005841 Ga0068863_100002025 Ga0068863_10000202518 214
179 3300005841 Ga0068863_100152656 Ga0068863_1001526562 214
180 3300005842 Ga0068858_100045206 Ga0068858_1000452062 214
181 3300005843 Ga0068860_100051804 Ga0068860_1000518043 214
182 3300005843 Ga0068860_100154440 Ga0068860_1001544402 214
183 3300005843 Ga0068860_100279947 Ga0068860_1002799472 214
184 3300005844 Ga0068862_100014854 Ga0068862_1000148542 214
185 3300005844 Ga0068862_100034303 Ga0068862_1000343034 214
186 3300006237 Ga0097621_100124963 Ga0097621_1001249632 214
187 3300006358 Ga0068871_100003077 Ga0068871_1000030773 214
188 3300006881 Ga0068865_100575996 Ga0068865_1005759961 214
189 3300006931 Ga0097620_100066999 Ga0097620_1000669992 214
190 3300009148 Ga0105243_10053642 Ga0105243_100536423 214
191 3300009148 Ga0105243_10080121 Ga0105243_100801212 214
192 3300009174 Ga0105241_10086940 Ga0105241_100869403 214
193 3300009176 Ga0105242_10060926 Ga0105242_100609262 214
194 3300009176 Ga0105242_10155501 Ga0105242_101555012 214
195 3300009553 Ga0105249_10076510 Ga0105249_100765102 214
196 3300013100 Ga0157373_10067272 Ga0157373_100672722 214
197 3300013104 Ga0157370_10212216 Ga0157370_102122161 214
198 3300013105 Ga0157369_10020827 Ga0157369_100208278 214
199 3300013296 Ga0157374_10046639 Ga0157374_100466393 214
200 3300013297 Ga0157378_10027285 Ga0157378_100272852 214
201 3300013297 Ga0157378_10632303 Ga0157378_106323031 214
202 3300013306 Ga0163162_10032769 Ga0163162_100327693 214
203 3300013306 Ga0163162_10060493 Ga0163162_100604933 214
204 3300013307 Ga0157372_10001357 Ga0157372_1000135722 214
205 3300013307 Ga0157372_10336059 Ga0157372_103360593 214
206 3300013308 Ga0157375_10015533 Ga0157375_100155338 214
207 3300014325 Ga0163163_10008557 Ga0163163_100085579 214
208 3300014326 Ga0157380_10211758 Ga0157380_102117582 214
209 3300014326 Ga0157380_10332846 Ga0157380_103328462 214
210 3300014326 Ga0157380_10422081 Ga0157380_104220812 214
211 3300014326 Ga0157380_10807996 Ga0157380_108079962 214
212 3300014968 Ga0157379_10079256 Ga0157379_100792562 214
213 3300014969 Ga0157376_10092320 Ga0157376_100923202 214
214 3300017792 Ga0163161_10085258 Ga0163161_100852582 214
215 3300017792 Ga0163161_10407701 Ga0163161_104077012 214
216 3300020070 Ga0206356_10365627 Ga0206356_103656271 214
217 3300025899 Ga0207642_10069767 Ga0207642_100697672 214
218 3300025908 Ga0207643_10008046 Ga0207643_100080462 214
219 3300025909 Ga0207705_10000991 Ga0207705_100009916 214
220 3300025909 Ga0207705_10185131 Ga0207705_101851311 214
221 3300025911 Ga0207654_10092260 Ga0207654_100922602 214
222 3300025913 Ga0207695_10012281 Ga0207695_100122819 214
223 3300025921 Ga0207652_10001433 Ga0207652_100014335 214
224 3300025921 Ga0207652_10100834 Ga0207652_101008342 214
225 3300025923 Ga0207681_10133332 Ga0207681_101333322 214
226 3300025923 Ga0207681_10190375 Ga0207681_101903752 214
227 3300025923 Ga0207681_10677031 Ga0207681_106770311 214
228 3300025924 Ga0207694_10009928 Ga0207694_100099289 214
229 3300025925 Ga0207650_10005890 Ga0207650_100058906 214
230 3300025925 Ga0207650_10015745 Ga0207650_100157455 214
231 3300025925 Ga0207650_10151888 Ga0207650_101518882 214
232 3300025926 Ga0207659_10003230 Ga0207659_100032302 214
233 3300025926 Ga0207659_10908172 Ga0207659_109081721 214
234 3300025929 Ga0207664_10023859 Ga0207664_100238592 214
235 3300025931 Ga0207644_10268126 Ga0207644_102681262 214
236 3300025931 Ga0207644_10694048 Ga0207644_106940482 214
237 3300025933 Ga0207706_10137257 Ga0207706_101372572 214
238 3300025934 Ga0207686_10102329 Ga0207686_101023293 214
239 3300025934 Ga0207686_10127894 Ga0207686_101278942 214
240 3300025937 Ga0207669_10110326 Ga0207669_101103261 214
241 3300025937 Ga0207669_10308186 Ga0207669_103081862 214
242 3300025937 Ga0207669_10353979 Ga0207669_103539792 214
243 3300025940 Ga0207691_10003024 Ga0207691_100030247 214
244 3300025940 Ga0207691_10012414 Ga0207691_100124144 214
245 3300025940 Ga0207691_10073963 Ga0207691_100739633 214
246 3300025941 Ga0207711_10828229 Ga0207711_108282291 214
247 3300025942 Ga0207689_10076405 Ga0207689_100764053 214
248 3300025944 Ga0207661_10145155 Ga0207661_101451552 214
249 3300025949 Ga0207667_10020154 Ga0207667_100201542 214
250 3300025960 Ga0207651_10081057 Ga0207651_100810572 214
251 3300025972 Ga0207668_10009080 Ga0207668_100090803 214
252 3300025981 Ga0207640_10031461 Ga0207640_100314613 214
253 3300025986 Ga0207658_10279371 Ga0207658_102793712 214
254 3300026023 Ga0207677_10167301 Ga0207677_101673012 214
255 3300026035 Ga0207703_10243438 Ga0207703_102434382 214
256 3300026067 Ga0207678_10162954 Ga0207678_101629543 214
257 3300026075 Ga0207708_10197199 Ga0207708_101971992 214
258 3300026078 Ga0207702_10221724 Ga0207702_102217242 214
259 3300026088 Ga0207641_10003711 Ga0207641_1000371111 214
260 3300026088 Ga0207641_10155272 Ga0207641_101552722 214
261 3300026088 Ga0207641_10342381 Ga0207641_103423811 214
262 3300026089 Ga0207648_10043632 Ga0207648_100436322 214
263 3300026089 Ga0207648_10920667 Ga0207648_109206671 214
264 3300026095 Ga0207676_10002368 Ga0207676_100023684 214
265 3300026095 Ga0207676_10139339 Ga0207676_101393392 214
266 3300026116 Ga0207674_10004167 Ga0207674_1000416713 214
267 3300026118 Ga0207675_100017582 Ga0207675_1000175826 214
268 3300026118 Ga0207675_100095619 Ga0207675_1000956193 214
269 3300026118 Ga0207675_100138099 Ga0207675_1001380993 214
270 3300026121 Ga0207683_10010629 Ga0207683_100106297 214
271 3300026121 Ga0207683_10012312 Ga0207683_100123123 214
272 3300026121 Ga0207683_10124096 Ga0207683_101240962 214
273 3300026142 Ga0207698_10148664 Ga0207698_101486642 214
274 3300028380 Ga0268265_10193144 Ga0268265_101931442 214
275 3300028381 Ga0268264_10013425 Ga0268264_100134255 214
276 3300028381 Ga0268264_10067627 Ga0268264_100676271 214
277 3300028381 Ga0268264_10270682 Ga0268264_102706822 214
278 3300028381 Ga0268264_10968541 Ga0268264_109685411 214
279 3300031903 Ga0307407_10385925 Ga0307407_103859251 214
280 3300032002 Ga0307416_100132022 Ga0307416_1001320222 214
281 3300032005 Ga0307411_10328555 Ga0307411_103285552 214
282 3300041486 Ga0451807_1297295 Ga0451807_1297295_275_967 214
283 3300048907 Ga0496104_0467404 Ga0496104_0467404_226_891 214
284 3300048916 Ga0496113_0238457 Ga0496113_0238457_738_1418 214
285 iso_pu_bacteria 3000865235 3000867042 214
286 3300046616 Ga0495668_0016018 Ga0495668_0016018_2527_3195 215
287 3300046660 Ga0495625_0057206 Ga0495625_0057206_1869_2537 215
288 iso_pu_bacteria 2896184354 2896187341 215
289 iso_pu_bacteria 2896253425 2896254198 215
290 3300005543 Ga0070672_100790225 Ga0070672_1007902251 216
291 3300009551 Ga0105238_11262827 Ga0105238_112628271 216
292 3300046537 Ga0495598_0007691 Ga0495598_0007691_1813_2469 216
293 3300053087 Ga0500643_000195 Ga0500643_000195_36104_36769 216
294 3300042876 Ga0451577_0276933 Ga0451577_0276933_815_1486 217
295 3300045051 Ga0451576_0022217 Ga0451576_0022217_6186_6857 217
296 3300045051 Ga0451576_0498698 Ga0451576_0498698_566_1237 217
297 3300046537 Ga0495598_0022981 Ga0495598_0022981_874_1533 217
298 3300046539 Ga0495621_0100649 Ga0495621_0100649_346_1005 217
299 iso_pu_bacteria 2885429604 2885430401 217
300 3300005329 Ga0070683_100105793 Ga0070683_1001057931 219
301 3300005535 Ga0070684_100219514 Ga0070684_1002195142 219
302 3300005614 Ga0068856_100282694 Ga0068856_1002826943 219
303 3300006175 Ga0070712_100375035 Ga0070712_1003750352 219
304 3300012513 Ga0157326_1000085 Ga0157326_10000858 219
305 3300026142 Ga0207698_10591489 Ga0207698_105914892 219
306 3300028794 Ga0307515_10313983 Ga0307515_103139831 219
307 3300031911 Ga0307412_10127629 Ga0307412_101276292 219
308 3300042116 Ga0450912_000681 Ga0450912_000681_262_927 219
309 3300046460 Ga0495638_0044311 Ga0495638_0044311_346_1011 219
310 3300046522 Ga0495643_0018963 Ga0495643_0018963_1585_2250 219
311 3300048917 Ga0496114_0042215 Ga0496114_0042215_543_1208 219
312 3300049571 Ga0501034_0103060 Ga0501034_0103060_52_717 219
313 3300053087 Ga0500643_000001 Ga0500643_000001_248740_249405 219
314 3300053153 Ga0500616_0001475 Ga0500616_0001475_5896_6561 219
315 3300005578 Ga0068854_100428446 Ga0068854_1004284462 220
316 3300013102 Ga0157371_10028143 Ga0157371_100281434 220
317 3300013104 Ga0157370_10283556 Ga0157370_102835563 220
318 3300025981 Ga0207640_10550778 Ga0207640_105507781 220
319 3300026041 Ga0207639_10199555 Ga0207639_101995553 220
320 3300026142 Ga0207698_10152918 Ga0207698_101529182 220
321 3300031911 Ga0307412_10011547 Ga0307412_100115475 220
322 3300005262 Ga0065165_1006943 Ga0065165_10069435 221
323 3300005331 Ga0070670_100109064 Ga0070670_1001090642 221
324 3300005335 Ga0070666_10000090 Ga0070666_1000009022 221
325 3300005347 Ga0070668_100188249 Ga0070668_1001882492 221
326 3300005353 Ga0070669_100000024 Ga0070669_10000002469 221
327 3300005367 Ga0070667_100157665 Ga0070667_1001576652 221
328 3300005440 Ga0070705_100005144 Ga0070705_1000051442 221
329 3300005617 Ga0068859_100042533 Ga0068859_1000425333 221
330 3300005719 Ga0068861_100001546 Ga0068861_1000015463 221
331 3300005842 Ga0068858_100003591 Ga0068858_1000035912 221
332 3300005843 Ga0068860_100107487 Ga0068860_1001074872 221
333 3300005844 Ga0068862_100000307 Ga0068862_10000030715 221
334 3300006931 Ga0097620_100042538 Ga0097620_1000425383 221
335 3300009101 Ga0105247_10006278 Ga0105247_100062783 221
336 3300009177 Ga0105248_10024724 Ga0105248_100247245 221
337 3300009553 Ga0105249_10013187 Ga0105249_100131872 221
338 3300013306 Ga0163162_10088024 Ga0163162_100880242 221
339 3300014325 Ga0163163_10188922 Ga0163163_101889222 221
340 3300025315 Ga0207697_10000244 Ga0207697_100002443 221
341 3300025900 Ga0207710_10001144 Ga0207710_100011447 221
342 3300025903 Ga0207680_10001008 Ga0207680_100010088 221
343 3300025923 Ga0207681_10000004 Ga0207681_10000004245 221
344 3300025925 Ga0207650_10012165 Ga0207650_100121654 221
345 3300025931 Ga0207644_10000009 Ga0207644_1000000967 221
346 3300025941 Ga0207711_10073731 Ga0207711_100737312 221
347 3300025961 Ga0207712_10004250 Ga0207712_100042508 221
348 3300025972 Ga0207668_10001498 Ga0207668_100014983 221
349 3300025986 Ga0207658_10006328 Ga0207658_100063282 221
350 3300026035 Ga0207703_10057304 Ga0207703_100573042 221
351 3300026088 Ga0207641_10015495 Ga0207641_100154952 221
352 3300026095 Ga0207676_10005573 Ga0207676_100055733 221
353 3300026118 Ga0207675_100000199 Ga0207675_10000019934 221
354 3300028380 Ga0268265_10000109 Ga0268265_1000010964 221
355 3300028381 Ga0268264_10000069 Ga0268264_10000069179 221
356 3300032002 Ga0307416_100197788 Ga0307416_1001977882 221
357 3300032004 Ga0307414_10305188 Ga0307414_103051882 221
358 3300039450 Ga0436363_0059392 Ga0436363_0059392_359_1024 221
359 3300046530 Ga0495654_0030535 Ga0495654_0030535_1541_2206 221
360 3300046530 Ga0495654_0225840 Ga0495654_0225840_107_775 221
361 3300046692 Ga0495671_0009331 Ga0495671_0009331_2865_3533 221
362 3300050496 nmdc:mga07m45_104049_c1 nmdc:mga07m45_104049_c1_776_1441 221
363 3300053122 Ga0500608_000074 Ga0500608_000074_15038_15703 221
364 3300053136 Ga0500559_0011642 Ga0500559_0011642_1585_2250 221
365 3300053138 Ga0500564_000068 Ga0500564_000068_15110_15775 221
366 3300053140 Ga0500573_0076728 Ga0500573_0076728_60_725 221
367 3300053723 Ga0500567_007764 Ga0500567_007764_2297_2962 221
368 3300053729 Ga0500625_000004 Ga0500625_000004_214788_215453 221
369 3300055283 Ga0500661_003069 Ga0500661_003069_266_931 221
370 3300002067 JGI24735J21928_10005664 JGI24735J21928_100056642 222
371 3300005578 Ga0068854_100132234 Ga0068854_1001322343 222
372 3300005617 Ga0068859_100007204 Ga0068859_1000072049 222
373 3300005618 Ga0068864_100002289 Ga0068864_1000022892 222
374 3300005719 Ga0068861_100000002 Ga0068861_10000000219 222
375 3300005842 Ga0068858_100000884 Ga0068858_10000088414 222
376 3300006931 Ga0097620_100007204 Ga0097620_1000072043 222
377 3300009177 Ga0105248_10001984 Ga0105248_1000198411 222
378 3300009177 Ga0105248_10160639 Ga0105248_101606393 222
379 3300013306 Ga0163162_10045923 Ga0163162_100459233 222
380 3300014968 Ga0157379_10030325 Ga0157379_100303254 222
381 3300025941 Ga0207711_10002937 Ga0207711_1000293713 222
382 3300025941 Ga0207711_10079011 Ga0207711_100790112 222
383 3300026035 Ga0207703_10000593 Ga0207703_1000059332 222
384 3300026095 Ga0207676_10001758 Ga0207676_100017583 222
385 3300026118 Ga0207675_100000021 Ga0207675_1000000212 222
386 3300028786 Ga0307517_10253367 Ga0307517_102533672 222
387 3300031456 Ga0307513_10015734 Ga0307513_100157343 222
388 3300033180 Ga0307510_10006416 Ga0307510_1000641618 222
389 3300046506 Ga0495583_0027608 Ga0495583_0027608_665_1333 222
390 3300047445 Ga0495677_0005540 Ga0495677_0005540_2284_2952 222
391 3300053087 Ga0500643_000172 Ga0500643_000172_49225_49893 222
392 3300053087 Ga0500643_001414 Ga0500643_001414_1195_1863 222
393 3300053087 Ga0500643_002858 Ga0500643_002858_3273_3941 222
394 3300053136 Ga0500559_0002598 Ga0500559_0002598_4620_5288 222
395 3300053136 Ga0500559_0013910 Ga0500559_0013910_1209_1877 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

26

95

0.96

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

23

100

0.83

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

22

94

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8834 2 207
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8715 2 207
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8548 2 207
4mp4-assembly1.cif.gz_A crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8489 2 207
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8467 2 207
ID Description Score Start End Superfamily
3bbyA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8727 2 80 3.40.30.10
af_P77544_4_214_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8493 2 207 3.40.50.720
4mp4C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8428 86 194 1.20.1050.10
af_P77544_4_214_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8234 2 207 3.40.50.720
4mp4C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8222 86 194 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A2W4ZCE3-F1-model_v4 Glutathione S-transferase 0.989 1 196 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A5PCQ9-F1-model_v4 Glutathione S-transferase, N-terminal 0.9866 2 218 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A0B9A480-F1-model_v4 Glutathione S-transferase-like protein 0.9834 1 219 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A431J993-F1-model_v4 deleted 0.9833 3 160
AF-A0A2W5C6Y9-F1-model_v4 Glutathione S-transferase 0.9803 1 222 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
92.03 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map