F433210

General Info

Members Datasets Scaffolds Average Seq Length
395 194 394 208

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10399787|Ga0157373_103997872
Length 233
Sequence MNIQLSNAGKRFNRDWIFRCLNYTFREGSSYAITGPNGSGKSTLLQTVAGAIAPSEGSVEYLCKAQDSRDKTRETRLKVQNSETGNRQLTTHPSPLTTENIYNHIAIVAPYLEVIEEMTASEFLHFHNSFKPILSTISITQILEIVGLKIAAHKQIRYFSSGMKQRIKLAQAIFSNVPVLLLDEPCTNLDSHGYDLYHRLINDYCKNKLIIVSSNDVNEYDFCAEKLSILDYK

Samples

Sample ID Description Type Environment
1 2914759650 Rhizosphaericola mali Isolate Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
176 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
177 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 0.25
Rhizosphere 96.96
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000222 3300003215 Bacteria 49028
2 rootL2_10053294 3300003322 Bacteria 7637
3 rootL2_10088268 3300003322 Bacteria 2263
4 JGI25160J50197_1010117 3300003354 Bacteria 3436
5 Ga0065165_1048952 3300005262 Bacteria 1211
6 Ga0065712_10084280 3300005290 Bacteria 2770
7 Ga0065715_10098163 3300005293 Bacteria 3585
8 Ga0065707_10118901 3300005295 Bacteria 2174
9 Ga0070658_10007507 3300005327 Bacteria 8800
10 Ga0070658_10036308 3300005327 Bacteria 3972
11 Ga0070658_10050266 3300005327 Bacteria 3378
12 Ga0070658_10092646 3300005327 Unclassified 2491
13 Ga0070658_10095473 3300005327 Bacteria 2455
14 Ga0070658_10318584 3300005327 Bacteria 1328
15 Ga0070658_10517771 3300005327 Bacteria 1031
16 Ga0070676_10008698 3300005328 Bacteria 5477
17 Ga0070676_10026348 3300005328 Bacteria 3292
18 Ga0070683_100011449 3300005329 Bacteria 7669
19 Ga0070683_100387911 3300005329 Bacteria 1331
20 Ga0070690_100069215 3300005330 Bacteria 2290
21 Ga0070670_100034233 3300005331 Bacteria 4372
22 Ga0070670_100093057 3300005331 Bacteria 2592
23 Ga0070670_100410548 3300005331 Bacteria 1196
24 Ga0070677_10036847 3300005333 Bacteria 1905
25 Ga0070677_10100029 3300005333 Bacteria 1277
26 Ga0068869_100014850 3300005334 Bacteria 5206
27 Ga0068869_100074347 3300005334 Bacteria 2522
28 Ga0068869_100365622 3300005334 Bacteria 1179
29 Ga0070666_10048552 3300005335 Bacteria 2852
30 Ga0070680_100005356 3300005336 Bacteria 9708
31 Ga0070680_100010278 3300005336 Bacteria 7213
32 Ga0070680_100038232 3300005336 Bacteria 3881
33 Ga0070680_100060402 3300005336 Bacteria 3102
34 Ga0070682_100478252 3300005337 Unclassified 960
35 Ga0068868_100025590 3300005338 Bacteria 4491
36 Ga0068868_100051576 3300005338 Bacteria 3237
37 Ga0068868_100290014 3300005338 Bacteria 1387
38 Ga0070660_100036683 3300005339 Bacteria 3714
39 Ga0070689_100016658 3300005340 Bacteria 5380
40 Ga0070661_100026364 3300005344 Bacteria 4179
41 Ga0070661_100250625 3300005344 Unclassified 1366
42 Ga0070692_10220543 3300005345 Bacteria 1121
43 Ga0070668_100113089 3300005347 Bacteria 2162
44 Ga0070669_100002586 3300005353 Bacteria 13083
45 Ga0070669_100045460 3300005353 Bacteria 3200
46 Ga0070669_100511944 3300005353 Bacteria 997
47 Ga0070675_100039675 3300005354 Unclassified 3843
48 Ga0070675_100041354 3300005354 Bacteria 3765
49 Ga0070675_100070361 3300005354 Bacteria 2900
50 Ga0070675_100144622 3300005354 Bacteria 2035
51 Ga0070671_100115503 3300005355 Bacteria 2256
52 Ga0070674_100058336 3300005356 Bacteria 2683
53 Ga0070673_100002320 3300005364 Bacteria 11558
54 Ga0070673_100057834 3300005364 Bacteria 3065
55 Ga0070673_100057949 3300005364 Bacteria 3062
56 Ga0070688_100039930 3300005365 Bacteria 2873
57 Ga0070688_100184261 3300005365 Bacteria 1450
58 Ga0070659_100006059 3300005366 Bacteria 8722
59 Ga0070659_100013991 3300005366 Bacteria 5988
60 Ga0070659_100083839 3300005366 Bacteria 2548
61 Ga0070667_101335823 3300005367 Bacteria 672
62 Ga0070714_100102465 3300005435 Bacteria 2524
63 Ga0070701_10016735 3300005438 Bacteria 3415
64 Ga0070663_100027944 3300005455 Bacteria 3835
65 Ga0070663_100029468 3300005455 Bacteria 3751
66 Ga0070663_100509331 3300005455 Unclassified 1001
67 Ga0070678_100010519 3300005456 Bacteria 5659
68 Ga0070662_100014173 3300005457 Bacteria 5319
69 Ga0070662_100016460 3300005457 Bacteria 4967
70 Ga0070681_10006309 3300005458 Bacteria 11529
71 Ga0070681_10058624 3300005458 Bacteria 3830
72 Ga0070681_10064592 3300005458 Bacteria 3630
73 Ga0070681_10153833 3300005458 Bacteria 2226
74 Ga0070681_10353543 3300005458 Unclassified 1379
75 Ga0068867_100289793 3300005459 Bacteria 1345
76 Ga0068867_100347224 3300005459 Bacteria 1237
77 Ga0068867_100403854 3300005459 Bacteria 1153
78 Ga0070679_100003113 3300005530 Bacteria 15162
79 Ga0070679_100011382 3300005530 Bacteria 8475
80 Ga0070679_100020303 3300005530 Bacteria 6474
81 Ga0070679_100024865 3300005530 Bacteria 5870
82 Ga0070679_100043828 3300005530 Bacteria 4455
83 Ga0070679_100072151 3300005530 Bacteria 3444
84 Ga0070679_101072840 3300005530 Bacteria 750
85 Ga0070684_100008744 3300005535 Bacteria 7939
86 Ga0068853_100019856 3300005539 Bacteria 5581
87 Ga0068853_100027308 3300005539 Bacteria 4795
88 Ga0068853_100057612 3300005539 Bacteria 3354
89 Ga0068853_100132528 3300005539 Unclassified 2232
90 Ga0068853_100384345 3300005539 Bacteria 1311
91 Ga0068853_100657413 3300005539 Bacteria 998
92 Ga0070672_100028088 3300005543 Bacteria 4205
93 Ga0070672_100178336 3300005543 Bacteria 1769
94 Ga0070693_100020320 3300005547 Bacteria 3500
95 Ga0070665_100025737 3300005548 Bacteria 5927
96 Ga0070704_100039378 3300005549 Bacteria 3245
97 Ga0068855_100007558 3300005563 Bacteria 13149
98 Ga0068855_100014228 3300005563 Bacteria 9584
99 Ga0068855_100160035 3300005563 Bacteria 2556
100 Ga0068855_100212086 3300005563 Unclassified 2175
101 Ga0068855_100302653 3300005563 Unclassified 1770
102 Ga0070664_100010561 3300005564 Bacteria 7486
103 Ga0070664_100208213 3300005564 Bacteria 1747
104 Ga0070664_100494415 3300005564 Archaea 1127
105 Ga0068857_100018006 3300005577 Bacteria 6196
106 Ga0068857_100024473 3300005577 Bacteria 5315
107 Ga0068857_100105628 3300005577 Bacteria 2528
108 Ga0068857_100299804 3300005577 Unclassified 1481
109 Ga0068857_101092664 3300005577 Bacteria 770
110 Ga0068854_100051524 3300005578 Bacteria 2949
111 Ga0068854_100111467 3300005578 Bacteria 2064
112 Ga0068856_100012329 3300005614 Bacteria 8277
113 Ga0068856_100128644 3300005614 Bacteria 2536
114 Ga0068856_100184407 3300005614 Unclassified 2100
115 Ga0068856_100315120 3300005614 Bacteria 1582
116 Ga0068852_100001052 3300005616 Bacteria 18192
117 Ga0068852_100009604 3300005616 Bacteria 7188
118 Ga0068852_100064086 3300005616 Bacteria 3202
119 Ga0068852_100136932 3300005616 Bacteria 2261
120 Ga0068859_100030574 3300005617 Bacteria 5405
121 Ga0068859_100041755 3300005617 Bacteria 4606
122 Ga0068866_10181444 3300005718 Bacteria 1244
123 Ga0068866_10284178 3300005718 Bacteria 1026
124 Ga0068861_100007759 3300005719 Bacteria 7371
125 Ga0068861_100262045 3300005719 Unclassified 1480
126 Ga0068861_100617033 3300005719 Bacteria 997
127 Ga0068861_100750031 3300005719 Bacteria 912
128 Ga0068851_10009552 3300005834 Bacteria 4514
129 Ga0068851_10112689 3300005834 Bacteria 1454
130 Ga0068863_100488463 3300005841 Bacteria 1212
131 Ga0068860_100005457 3300005843 Bacteria 12891
132 Ga0068860_100007551 3300005843 Bacteria 10877
133 Ga0068860_100203303 3300005843 Bacteria 1920
134 Ga0068860_100860648 3300005843 Bacteria 921
135 Ga0068860_101191912 3300005843 Bacteria 782
136 Ga0068862_100065589 3300005844 Bacteria 3128
137 Ga0068862_100281635 3300005844 Bacteria 1524
138 Ga0081540_1017173 3300005983 Bacteria 4489
139 Ga0097621_100039821 3300006237 Bacteria 3776
140 Ga0097621_100357256 3300006237 Bacteria 1301
141 Ga0068871_100009941 3300006358 Bacteria 6910
142 Ga0068871_100024223 3300006358 Bacteria 4703
143 Ga0068871_100149589 3300006358 Bacteria 1990
144 Ga0068871_100175377 3300006358 Bacteria 1840
145 Ga0068871_100443835 3300006358 Bacteria 1162
146 Ga0075430_100010857 3300006846 Bacteria 7717
147 Ga0068865_100033594 3300006881 Bacteria 3435
148 Ga0097620_100021787 3300006931 Bacteria 6426
149 Ga0097620_100030569 3300006931 Bacteria 5405
150 Ga0097620_100041756 3300006931 Bacteria 4606
151 Ga0105240_10259462 3300009093 Bacteria 2005
152 Ga0111539_10013886 3300009094 Bacteria 10071
153 Ga0105245_10806980 3300009098 Bacteria 977
154 Ga0105247_10281350 3300009101 Bacteria 1148
155 Ga0114129_10360457 3300009147 Bacteria 1924
156 Ga0105243_10683537 3300009148 Bacteria 998
157 Ga0105241_10005853 3300009174 Bacteria 9076
158 Ga0105241_10168587 3300009174 Bacteria 1806
159 Ga0105242_10162700 3300009176 Bacteria 1955
160 Ga0105242_10682370 3300009176 Unclassified 1003
161 Ga0105237_10009466 3300009545 Bacteria 10435
162 Ga0105237_10013588 3300009545 Bacteria 8530
163 Ga0105249_10020624 3300009553 Bacteria 5893
164 Ga0105239_10001925 3300010375 Bacteria 27067
165 Ga0105239_10018362 3300010375 Bacteria 7732
166 Ga0105246_10100632 3300011119 Bacteria 2103
167 Ga0157373_10002844 3300013100 Bacteria 13094
168 Ga0157373_10005846 3300013100 Bacteria 9208
169 Ga0157373_10013256 3300013100 Bacteria 6051
170 Ga0157373_10089811 3300013100 Bacteria 2164
171 Ga0157373_10175782 3300013100 Bacteria 1507
172 Ga0157373_10186515 3300013100 Unclassified 1461
173 Ga0157373_10399787 3300013100 Unclassified 985
174 Ga0157371_10012854 3300013102 Bacteria 6375
175 Ga0157371_10012951 3300013102 Bacteria 6352
176 Ga0157371_10018333 3300013102 Bacteria 5176
177 Ga0157371_10020286 3300013102 Bacteria 4892
178 Ga0157371_10021362 3300013102 Bacteria 4752
179 Ga0157371_10027544 3300013102 Bacteria 4122
180 Ga0157371_10058447 3300013102 Bacteria 2735
181 Ga0157371_10059200 3300013102 Bacteria 2716
182 Ga0157371_10085557 3300013102 Bacteria 2233
183 Ga0157371_10087123 3300013102 Unclassified 2211
184 Ga0157371_10093359 3300013102 Unclassified 2132
185 Ga0157371_10205987 3300013102 Unclassified 1411
186 Ga0157370_10126628 3300013104 Unclassified 2384
187 Ga0157370_10127251 3300013104 Bacteria 2378
188 Ga0157370_10169538 3300013104 Unclassified 2029
189 Ga0157370_10300094 3300013104 Bacteria 1483
190 Ga0157369_10017146 3300013105 Bacteria 8136
191 Ga0157369_10032227 3300013105 Bacteria 5765
192 Ga0157369_10063399 3300013105 Bacteria 3982
193 Ga0157369_10194262 3300013105 Unclassified 2132
194 Ga0157369_10370690 3300013105 Unclassified 1486
195 Ga0157369_10491018 3300013105 Unclassified 1270
196 Ga0157374_10011049 3300013296 Bacteria 7799
197 Ga0157378_10015316 3300013297 Bacteria 6716
198 Ga0157378_10023574 3300013297 Bacteria 5413
199 Ga0157378_10041090 3300013297 Bacteria 4101
200 Ga0157378_10092364 3300013297 Bacteria 2754
201 Ga0163162_10001619 3300013306 Bacteria 21066
202 Ga0163162_10008228 3300013306 Bacteria 10180
203 Ga0163162_10242965 3300013306 Bacteria 1931
204 Ga0163162_10905679 3300013306 Bacteria 995
205 Ga0157372_10021594 3300013307 Bacteria 6957
206 Ga0157372_10035298 3300013307 Bacteria 5504
207 Ga0157372_10083681 3300013307 Unclassified 3614
208 Ga0157372_10087032 3300013307 Bacteria 3544
209 Ga0157372_10118488 3300013307 Bacteria 3038
210 Ga0157372_10154553 3300013307 Bacteria 2650
211 Ga0157372_10884419 3300013307 Unclassified 1037
212 Ga0157372_11297575 3300013307 Bacteria 840
213 Ga0157375_10172060 3300013308 Bacteria 2314
214 Ga0157375_10484792 3300013308 Bacteria 1401
215 Ga0163163_10175107 3300014325 Bacteria 2192
216 Ga0157380_10011721 3300014326 Bacteria 6339
217 Ga0157380_10462430 3300014326 Unclassified 1222
218 Ga0157377_10000921 3300014745 Bacteria 12285
219 Ga0157377_10259550 3300014745 Bacteria 1130
220 Ga0157379_10133610 3300014968 Bacteria 2235
221 Ga0157376_10691463 3300014969 Bacteria 1024
222 Ga0209758_1000653 3300025297 Bacteria 52393
223 Ga0207426_1001367 3300025302 Bacteria 20677
224 Ga0207697_10049034 3300025315 Bacteria 1742
225 Ga0207656_10048556 3300025321 Bacteria 1828
226 Ga0207656_10060392 3300025321 Bacteria 1662
227 Ga0207642_10012655 3300025899 Bacteria 3054
228 Ga0207688_10002952 3300025901 Bacteria 9254
229 Ga0207647_10014478 3300025904 Bacteria 5436
230 Ga0207645_10001185 3300025907 Bacteria 21530
231 Ga0207645_10049781 3300025907 Bacteria 2676
232 Ga0207643_10007693 3300025908 Bacteria 5787
233 Ga0207705_10002314 3300025909 Bacteria 14742
234 Ga0207705_10025972 3300025909 Bacteria 4180
235 Ga0207705_10030734 3300025909 Bacteria 3833
236 Ga0207705_10086127 3300025909 Bacteria 2296
237 Ga0207705_10319282 3300025909 Bacteria 1193
238 Ga0207705_10403078 3300025909 Bacteria 1058
239 Ga0207705_10548314 3300025909 Bacteria 899
240 Ga0207654_10004425 3300025911 Bacteria 7089
241 Ga0207707_10027517 3300025912 Bacteria 4972
242 Ga0207707_10037072 3300025912 Bacteria 4260
243 Ga0207707_10161642 3300025912 Bacteria 1958
244 Ga0207707_10471735 3300025912 Unclassified 1072
245 Ga0207695_10010102 3300025913 Bacteria 11583
246 Ga0207695_10269517 3300025913 Bacteria 1598
247 Ga0207671_10014091 3300025914 Bacteria 6336
248 Ga0207671_10034297 3300025914 Bacteria 3771
249 Ga0207660_10054942 3300025917 Bacteria 2844
250 Ga0207660_10096981 3300025917 Bacteria 2196
251 Ga0207660_10154755 3300025917 Bacteria 1764
252 Ga0207660_10215732 3300025917 Bacteria 1504
253 Ga0207657_10012490 3300025919 Bacteria 8381
254 Ga0207657_10026531 3300025919 Bacteria 5321
255 Ga0207657_10039269 3300025919 Bacteria 4208
256 Ga0207657_10123918 3300025919 Bacteria 2124
257 Ga0207657_10197860 3300025919 Bacteria 1618
258 Ga0207652_10000137 3300025921 Bacteria 77723
259 Ga0207652_10000958 3300025921 Bacteria 26950
260 Ga0207652_10002121 3300025921 Bacteria 17027
261 Ga0207652_10010938 3300025921 Bacteria 7316
262 Ga0207652_10131386 3300025921 Bacteria 2233
263 Ga0207652_10368724 3300025921 Bacteria 1296
264 Ga0207681_10004428 3300025923 Bacteria 8650
265 Ga0207681_10268451 3300025923 Bacteria 1338
266 Ga0207659_10093908 3300025926 Bacteria 2246
267 Ga0207659_10196113 3300025926 Bacteria 1609
268 Ga0207644_10098881 3300025931 Bacteria 2188
269 Ga0207706_10007957 3300025933 Bacteria 9787
270 Ga0207706_10019953 3300025933 Bacteria 6025
271 Ga0207706_10045838 3300025933 Bacteria 3872
272 Ga0207686_10134280 3300025934 Bacteria 1701
273 Ga0207670_10008600 3300025936 Bacteria 5771
274 Ga0207704_10047770 3300025938 Bacteria 2561
275 Ga0207691_10064556 3300025940 Bacteria 3316
276 Ga0207689_10015149 3300025942 Bacteria 6534
277 Ga0207689_10015813 3300025942 Bacteria 6389
278 Ga0207689_10056581 3300025942 Bacteria 3228
279 Ga0207661_10061548 3300025944 Bacteria 3033
280 Ga0207661_10907513 3300025944 Bacteria 811
281 Ga0207661_11256321 3300025944 Unclassified 681
282 Ga0207679_10027228 3300025945 Bacteria 3952
283 Ga0207679_10115261 3300025945 Bacteria 2129
284 Ga0207679_10254788 3300025945 Archaea 1494
285 Ga0207667_10000697 3300025949 Bacteria 43571
286 Ga0207651_10008007 3300025960 Bacteria 5671
287 Ga0207651_10030169 3300025960 Bacteria 3448
288 Ga0207651_10066118 3300025960 Bacteria 2539
289 Ga0207651_10342809 3300025960 Bacteria 1256
290 Ga0207712_10175364 3300025961 Bacteria 1679
291 Ga0207668_10187354 3300025972 Bacteria 1637
292 Ga0207668_10193278 3300025972 Bacteria 1614
293 Ga0207640_10230872 3300025981 Bacteria 1423
294 Ga0207640_10274876 3300025981 Bacteria 1320
295 Ga0207658_10108187 3300025986 Bacteria 2192
296 Ga0207677_10005051 3300026023 Bacteria 7130
297 Ga0207677_10055680 3300026023 Bacteria 2706
298 Ga0207639_10042659 3300026041 Bacteria 3401
299 Ga0207639_10046260 3300026041 Bacteria 3282
300 Ga0207639_10175753 3300026041 Bacteria 1818
301 Ga0207678_10043535 3300026067 Bacteria 3884
302 Ga0207678_10559189 3300026067 Bacteria 1001
303 Ga0207702_10126458 3300026078 Bacteria 2295
304 Ga0207702_10499058 3300026078 Bacteria 1186
305 Ga0207702_10710984 3300026078 Bacteria 990
306 Ga0207641_10027937 3300026088 Bacteria 4660
307 Ga0207641_10462422 3300026088 Bacteria 1228
308 Ga0207648_10004723 3300026089 Bacteria 13919
309 Ga0207648_10017512 3300026089 Bacteria 6514
310 Ga0207648_10019923 3300026089 Bacteria 6054
311 Ga0207676_10571472 3300026095 Bacteria 1083
312 Ga0207674_10036119 3300026116 Bacteria 5153
313 Ga0207674_10036402 3300026116 Bacteria 5129
314 Ga0207674_10681501 3300026116 Bacteria 992
315 Ga0207674_10861356 3300026116 Unclassified 874
316 Ga0207675_100000673 3300026118 Bacteria 33675
317 Ga0207675_100081687 3300026118 Bacteria 3031
318 Ga0207675_100185135 3300026118 Bacteria 1995
319 Ga0207675_100690135 3300026118 Bacteria 1029
320 Ga0207683_10020811 3300026121 Bacteria 5613
321 Ga0207698_10001672 3300026142 Bacteria 12939
322 Ga0207698_10016323 3300026142 Bacteria 5002
323 Ga0207698_10115732 3300026142 Bacteria 2258
324 Ga0207698_10774560 3300026142 Unclassified 960
325 Ga0207428_10100043 3300027907 Bacteria 2241
326 Ga0268266_10096990 3300028379 Bacteria 2592
327 Ga0268264_10047492 3300028381 Bacteria 3569
328 Ga0268264_10153393 3300028381 Bacteria 2068
329 Ga0268264_10339351 3300028381 Bacteria 1427
330 Ga0268264_10561668 3300028381 Unclassified 1121
331 Ga0307515_10000455 3300028794 Bacteria 97670
332 Ga0265327_10000030 3300031251 Bacteria 333531
333 Ga0265327_10042972 3300031251 Bacteria 2423
334 Ga0307405_10019604 3300031731 Bacteria 3761
335 Ga0307413_10090076 3300031824 Bacteria 1995
336 Ga0307410_10196063 3300031852 Unclassified 1539
337 Ga0307407_10064805 3300031903 Bacteria 2149
338 Ga0307412_10087113 3300031911 Unclassified 2175
339 Ga0307416_100000341 3300032002 Bacteria 24168
340 Ga0307415_100016082 3300032126 Bacteria 4448
341 Ga0307507_10178368 3300033179 Bacteria 1525
342 Ga0395899_0002691 3300037312 Bacteria 14329
343 Ga0395899_0006410 3300037312 Bacteria 9120
344 Ga0395899_0041671 3300037312 Bacteria 3431
345 Ga0395899_0406167 3300037312 Unclassified 900
346 Ga0395900_0005508 3300037418 Bacteria 13250
347 Ga0395900_0032246 3300037418 Bacteria 5386
348 Ga0395900_0069896 3300037418 Bacteria 3609
349 Ga0395898_0043893 3300037466 Bacteria 4404
350 Ga0395898_0422986 3300037466 Unclassified 1269
351 Ga0395905_0191786 3300037471 Unclassified 1917
352 Ga0395901_0013053 3300038443 Bacteria 8433
353 Ga0395901_0080980 3300038443 Bacteria 3391
354 Ga0439453_0014617 3300041408 Bacteria 1348
355 Ga0451802_1572872 3300041460 Bacteria 1058
356 Ga0466957_0139718 3300044842 Bacteria 1560
357 Ga0495686_0063241 3300047472 Bacteria 2294
358 Ga0501032_0028025 3300049569 Bacteria 3871
359 Ga0501033_0072602 3300049570 Bacteria 2527
360 Ga0501034_0004054 3300049571 Bacteria 16437
361 Ga0501036_0002569 3300049572 Bacteria 14286
362 Ga0501037_0016240 3300049573 Bacteria 5479
363 Ga0501037_0202837 3300049573 Bacteria 1401
364 Ga0501038_0044290 3300049574 Bacteria 3868
365 Ga0501039_0010310 3300049575 Bacteria 7128
366 Ga0501043_0003981 3300049579 Bacteria 12097
367 Ga0501046_0016328 3300049580 Bacteria 6220
368 Ga0501047_0002595 3300049581 Bacteria 17203
369 Ga0501048_0017775 3300049582 Bacteria 5233
370 Ga0501067_0006010 3300049583 Bacteria 6728
371 Ga0501068_0108162 3300049584 Bacteria 1727
372 Ga0501070_0024963 3300049586 Bacteria 5012
373 Ga0501073_0001021 3300049589 Bacteria 20249
374 Ga0501074_0000870 3300049590 Bacteria 19252
375 Ga0501208_077543 3300049655 Bacteria 678
376 Ga0501223_013519 3300049663 Unclassified 1626
377 Ga0501228_005470 3300049666 Unclassified 1128
378 Ga0501257_012910 3300049686 Bacteria 1914
379 Ga0501261_016285 3300049690 Bacteria 1030
380 Ga0501079_0057970 3300049741 Bacteria 2988
381 Ga0501080_0028432 3300049742 Bacteria 5200
382 Ga0501083_0049309 3300049744 Bacteria 2838
383 Ga0501035_0001809 3300049822 Bacteria 21614
384 Ga0501044_0017021 3300049823 Bacteria 7801
385 Ga0501045_0147532 3300049824 Bacteria 1750
386 nmdc:mga05p37_119347_c1 3300050507 Unclassified 3240
387 nmdc:mga09592_25516_c1 3300050508 Unclassified 4893
388 nmdc:mga0qj67_35368_c1 3300050509 Unclassified 3905
389 nmdc:mga06r32_293986_c1 3300050510 Unclassified 1611
390 nmdc:mga08y16_31513_c1 3300050511 Bacteria 5576
391 Ga0500568_0000473 3300053139 Bacteria 29794
392 Ga0500622_0003581 3300053156 Bacteria 10248
393 Ga0501084_0222272 3300054114 Bacteria 1593
394 Ga0501082_0128216 3300060353 Bacteria 2201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049655 Ga0501208_077543 Ga0501208_077543_19_486 155
2 3300005334 Ga0068869_100365622 Ga0068869_1003656221 189
3 3300005338 Ga0068868_100290014 Ga0068868_1002900142 189
4 3300005564 Ga0070664_100494415 Ga0070664_1004944151 191
5 3300025945 Ga0207679_10254788 Ga0207679_102547882 191
6 3300041408 Ga0439453_0014617 Ga0439453_0014617_665_1282 191
7 3300005719 Ga0068861_100262045 Ga0068861_1002620452 192
8 3300025972 Ga0207668_10187354 Ga0207668_101873542 192
9 3300026118 Ga0207675_100185135 Ga0207675_1001851351 192
10 3300005983 Ga0081540_1017173 Ga0081540_10171734 200
11 3300006237 Ga0097621_100039821 Ga0097621_1000398212 200
12 3300006358 Ga0068871_100443835 Ga0068871_1004438351 200
13 3300009093 Ga0105240_10259462 Ga0105240_102594622 200
14 3300009545 Ga0105237_10013588 Ga0105237_100135882 200
15 3300010375 Ga0105239_10001925 Ga0105239_100019253 200
16 3300025913 Ga0207695_10269517 Ga0207695_102695172 200
17 3300025914 Ga0207671_10014091 Ga0207671_100140917 200
18 iso_pu_bacteria 2914759650 2914763160 201
19 3300005327 Ga0070658_10050266 Ga0070658_100502663 202
20 3300005329 Ga0070683_100011449 Ga0070683_1000114494 202
21 3300005330 Ga0070690_100069215 Ga0070690_1000692151 202
22 3300005331 Ga0070670_100410548 Ga0070670_1004105481 202
23 3300005336 Ga0070680_100060402 Ga0070680_1000604022 202
24 3300005338 Ga0068868_100025590 Ga0068868_1000255901 202
25 3300005344 Ga0070661_100026364 Ga0070661_1000263642 202
26 3300005354 Ga0070675_100039675 Ga0070675_1000396753 202
27 3300005355 Ga0070671_100115503 Ga0070671_1001155033 202
28 3300005366 Ga0070659_100006059 Ga0070659_1000060592 202
29 3300005455 Ga0070663_100509331 Ga0070663_1005093311 202
30 3300005457 Ga0070662_100014173 Ga0070662_1000141733 202
31 3300005458 Ga0070681_10058624 Ga0070681_100586242 202
32 3300005530 Ga0070679_100043828 Ga0070679_1000438282 202
33 3300005535 Ga0070684_100008744 Ga0070684_1000087444 202
34 3300005539 Ga0068853_100027308 Ga0068853_1000273083 202
35 3300005547 Ga0070693_100020320 Ga0070693_1000203202 202
36 3300005563 Ga0068855_100014228 Ga0068855_1000142285 202
37 3300005564 Ga0070664_100010561 Ga0070664_1000105612 202
38 3300005578 Ga0068854_100111467 Ga0068854_1001114672 202
39 3300005614 Ga0068856_100012329 Ga0068856_1000123294 202
40 3300005616 Ga0068852_100009604 Ga0068852_1000096044 202
41 3300005834 Ga0068851_10112689 Ga0068851_101126892 202
42 3300006358 Ga0068871_100009941 Ga0068871_1000099414 202
43 3300013100 Ga0157373_10005846 Ga0157373_100058463 202
44 3300013102 Ga0157371_10012854 Ga0157371_100128543 202
45 3300013104 Ga0157370_10300094 Ga0157370_103000942 202
46 3300013105 Ga0157369_10017146 Ga0157369_100171463 202
47 3300013296 Ga0157374_10011049 Ga0157374_100110493 202
48 3300013297 Ga0157378_10023574 Ga0157378_100235744 202
49 3300013306 Ga0163162_10905679 Ga0163162_109056792 202
50 3300013307 Ga0157372_10154553 Ga0157372_101545533 202
51 3300014745 Ga0157377_10259550 Ga0157377_102595502 202
52 3300014969 Ga0157376_10691463 Ga0157376_106914632 202
53 3300025321 Ga0207656_10060392 Ga0207656_100603922 202
54 3300025909 Ga0207705_10030734 Ga0207705_100307343 202
55 3300025912 Ga0207707_10037072 Ga0207707_100370722 202
56 3300025917 Ga0207660_10154755 Ga0207660_101547552 202
57 3300025921 Ga0207652_10368724 Ga0207652_103687242 202
58 3300025931 Ga0207644_10098881 Ga0207644_100988812 202
59 3300025933 Ga0207706_10007957 Ga0207706_100079574 202
60 3300025944 Ga0207661_10061548 Ga0207661_100615483 202
61 3300025945 Ga0207679_10027228 Ga0207679_100272282 202
62 3300025960 Ga0207651_10066118 Ga0207651_100661183 202
63 3300026041 Ga0207639_10046260 Ga0207639_100462603 202
64 3300026078 Ga0207702_10126458 Ga0207702_101264582 202
65 3300026142 Ga0207698_10016323 Ga0207698_100163233 202
66 3300053156 Ga0500622_0003581 Ga0500622_0003581_8784_9431 202
67 3300025919 Ga0207657_10012490 Ga0207657_100124903 203
68 3300003322 rootL2_10088268 rootL2_100882683 204
69 3300005327 Ga0070658_10517771 Ga0070658_105177711 204
70 3300005364 Ga0070673_100057949 Ga0070673_1000579493 204
71 3300005367 Ga0070667_101335823 Ga0070667_1013358231 204
72 3300005834 Ga0068851_10009552 Ga0068851_100095523 204
73 3300005841 Ga0068863_100488463 Ga0068863_1004884632 204
74 3300006358 Ga0068871_100175377 Ga0068871_1001753772 204
75 3300009098 Ga0105245_10806980 Ga0105245_108069802 204
76 3300013297 Ga0157378_10041090 Ga0157378_100410906 204
77 3300013306 Ga0163162_10008228 Ga0163162_100082285 204
78 3300013308 Ga0157375_10484792 Ga0157375_104847922 204
79 3300025321 Ga0207656_10048556 Ga0207656_100485563 204
80 3300025960 Ga0207651_10030169 Ga0207651_100301692 204
81 3300026023 Ga0207677_10005051 Ga0207677_100050515 204
82 3300026088 Ga0207641_10027937 Ga0207641_100279373 204
83 3300026095 Ga0207676_10571472 Ga0207676_105714722 204
84 3300031251 Ga0265327_10000030 Ga0265327_1000003084 204
85 3300003215 JGI25153J46596_10000222 JGI25153J46596_1000022231 205
86 3300003322 rootL2_10053294 rootL2_100532946 205
87 3300003354 JGI25160J50197_1010117 JGI25160J50197_10101172 205
88 3300005262 Ga0065165_1048952 Ga0065165_10489521 205
89 3300005290 Ga0065712_10084280 Ga0065712_100842804 205
90 3300005293 Ga0065715_10098163 Ga0065715_100981633 205
91 3300005295 Ga0065707_10118901 Ga0065707_101189013 205
92 3300005327 Ga0070658_10007507 Ga0070658_100075077 205
93 3300005327 Ga0070658_10036308 Ga0070658_100363082 205
94 3300005327 Ga0070658_10092646 Ga0070658_100926462 205
95 3300005327 Ga0070658_10095473 Ga0070658_100954731 205
96 3300005327 Ga0070658_10318584 Ga0070658_103185842 205
97 3300005328 Ga0070676_10008698 Ga0070676_100086982 205
98 3300005328 Ga0070676_10026348 Ga0070676_100263481 205
99 3300005329 Ga0070683_100387911 Ga0070683_1003879112 205
100 3300005331 Ga0070670_100034233 Ga0070670_1000342334 205
101 3300005331 Ga0070670_100093057 Ga0070670_1000930573 205
102 3300005333 Ga0070677_10036847 Ga0070677_100368472 205
103 3300005333 Ga0070677_10100029 Ga0070677_101000292 205
104 3300005334 Ga0068869_100014850 Ga0068869_1000148509 205
105 3300005334 Ga0068869_100074347 Ga0068869_1000743472 205
106 3300005335 Ga0070666_10048552 Ga0070666_100485522 205
107 3300005336 Ga0070680_100005356 Ga0070680_1000053569 205
108 3300005336 Ga0070680_100010278 Ga0070680_1000102786 205
109 3300005336 Ga0070680_100038232 Ga0070680_1000382322 205
110 3300005337 Ga0070682_100478252 Ga0070682_1004782521 205
111 3300005338 Ga0068868_100051576 Ga0068868_1000515762 205
112 3300005339 Ga0070660_100036683 Ga0070660_1000366834 205
113 3300005340 Ga0070689_100016658 Ga0070689_1000166585 205
114 3300005344 Ga0070661_100250625 Ga0070661_1002506251 205
115 3300005345 Ga0070692_10220543 Ga0070692_102205431 205
116 3300005347 Ga0070668_100113089 Ga0070668_1001130892 205
117 3300005353 Ga0070669_100002586 Ga0070669_1000025864 205
118 3300005353 Ga0070669_100045460 Ga0070669_1000454603 205
119 3300005353 Ga0070669_100511944 Ga0070669_1005119442 205
120 3300005354 Ga0070675_100041354 Ga0070675_1000413543 205
121 3300005354 Ga0070675_100070361 Ga0070675_1000703612 205
122 3300005354 Ga0070675_100144622 Ga0070675_1001446222 205
123 3300005356 Ga0070674_100058336 Ga0070674_1000583362 205
124 3300005364 Ga0070673_100002320 Ga0070673_1000023203 205
125 3300005364 Ga0070673_100057834 Ga0070673_1000578342 205
126 3300005365 Ga0070688_100039930 Ga0070688_1000399303 205
127 3300005365 Ga0070688_100184261 Ga0070688_1001842612 205
128 3300005366 Ga0070659_100013991 Ga0070659_1000139912 205
129 3300005366 Ga0070659_100083839 Ga0070659_1000838391 205
130 3300005435 Ga0070714_100102465 Ga0070714_1001024652 205
131 3300005438 Ga0070701_10016735 Ga0070701_100167352 205
132 3300005455 Ga0070663_100027944 Ga0070663_1000279442 205
133 3300005455 Ga0070663_100029468 Ga0070663_1000294684 205
134 3300005456 Ga0070678_100010519 Ga0070678_1000105192 205
135 3300005457 Ga0070662_100016460 Ga0070662_1000164604 205
136 3300005458 Ga0070681_10006309 Ga0070681_100063096 205
137 3300005458 Ga0070681_10064592 Ga0070681_100645924 205
138 3300005458 Ga0070681_10153833 Ga0070681_101538332 205
139 3300005458 Ga0070681_10353543 Ga0070681_103535432 205
140 3300005459 Ga0068867_100289793 Ga0068867_1002897932 205
141 3300005459 Ga0068867_100347224 Ga0068867_1003472241 205
142 3300005459 Ga0068867_100403854 Ga0068867_1004038542 205
143 3300005530 Ga0070679_100003113 Ga0070679_10000311312 205
144 3300005530 Ga0070679_100011382 Ga0070679_1000113824 205
145 3300005530 Ga0070679_100020303 Ga0070679_1000203036 205
146 3300005530 Ga0070679_100024865 Ga0070679_1000248654 205
147 3300005530 Ga0070679_100072151 Ga0070679_1000721514 205
148 3300005530 Ga0070679_101072840 Ga0070679_1010728401 205
149 3300005539 Ga0068853_100019856 Ga0068853_1000198564 205
150 3300005539 Ga0068853_100057612 Ga0068853_1000576122 205
151 3300005539 Ga0068853_100132528 Ga0068853_1001325283 205
152 3300005539 Ga0068853_100384345 Ga0068853_1003843452 205
153 3300005539 Ga0068853_100657413 Ga0068853_1006574132 205
154 3300005543 Ga0070672_100028088 Ga0070672_1000280882 205
155 3300005543 Ga0070672_100178336 Ga0070672_1001783362 205
156 3300005548 Ga0070665_100025737 Ga0070665_1000257372 205
157 3300005549 Ga0070704_100039378 Ga0070704_1000393782 205
158 3300005563 Ga0068855_100007558 Ga0068855_1000075588 205
159 3300005563 Ga0068855_100160035 Ga0068855_1001600351 205
160 3300005563 Ga0068855_100212086 Ga0068855_1002120862 205
161 3300005563 Ga0068855_100302653 Ga0068855_1003026532 205
162 3300005564 Ga0070664_100208213 Ga0070664_1002082132 205
163 3300005577 Ga0068857_100018006 Ga0068857_1000180063 205
164 3300005577 Ga0068857_100024473 Ga0068857_1000244734 205
165 3300005577 Ga0068857_100105628 Ga0068857_1001056282 205
166 3300005577 Ga0068857_100299804 Ga0068857_1002998042 205
167 3300005577 Ga0068857_101092664 Ga0068857_1010926641 205
168 3300005578 Ga0068854_100051524 Ga0068854_1000515242 205
169 3300005614 Ga0068856_100128644 Ga0068856_1001286442 205
170 3300005614 Ga0068856_100184407 Ga0068856_1001844072 205
171 3300005614 Ga0068856_100315120 Ga0068856_1003151202 205
172 3300005616 Ga0068852_100001052 Ga0068852_10000105218 205
173 3300005616 Ga0068852_100064086 Ga0068852_1000640862 205
174 3300005616 Ga0068852_100136932 Ga0068852_1001369322 205
175 3300005617 Ga0068859_100030574 Ga0068859_1000305744 205
176 3300005617 Ga0068859_100041755 Ga0068859_1000417552 205
177 3300005718 Ga0068866_10181444 Ga0068866_101814441 205
178 3300005718 Ga0068866_10284178 Ga0068866_102841782 205
179 3300005719 Ga0068861_100007759 Ga0068861_1000077596 205
180 3300005719 Ga0068861_100617033 Ga0068861_1006170332 205
181 3300005719 Ga0068861_100750031 Ga0068861_1007500312 205
182 3300005843 Ga0068860_100005457 Ga0068860_1000054574 205
183 3300005843 Ga0068860_100007551 Ga0068860_1000075519 205
184 3300005843 Ga0068860_100203303 Ga0068860_1002033033 205
185 3300005843 Ga0068860_100860648 Ga0068860_1008606482 205
186 3300005843 Ga0068860_101191912 Ga0068860_1011919121 205
187 3300005844 Ga0068862_100065589 Ga0068862_1000655895 205
188 3300005844 Ga0068862_100281635 Ga0068862_1002816351 205
189 3300006237 Ga0097621_100357256 Ga0097621_1003572562 205
190 3300006358 Ga0068871_100024223 Ga0068871_1000242232 205
191 3300006358 Ga0068871_100149589 Ga0068871_1001495892 205
192 3300006846 Ga0075430_100010857 Ga0075430_1000108575 205
193 3300006881 Ga0068865_100033594 Ga0068865_1000335942 205
194 3300006931 Ga0097620_100021787 Ga0097620_1000217878 205
195 3300006931 Ga0097620_100030569 Ga0097620_1000305694 205
196 3300006931 Ga0097620_100041756 Ga0097620_1000417565 205
197 3300009094 Ga0111539_10013886 Ga0111539_100138864 205
198 3300009101 Ga0105247_10281350 Ga0105247_102813502 205
199 3300009147 Ga0114129_10360457 Ga0114129_103604573 205
200 3300009148 Ga0105243_10683537 Ga0105243_106835372 205
201 3300009174 Ga0105241_10005853 Ga0105241_100058535 205
202 3300009174 Ga0105241_10168587 Ga0105241_101685873 205
203 3300009176 Ga0105242_10162700 Ga0105242_101627002 205
204 3300009176 Ga0105242_10682370 Ga0105242_106823702 205
205 3300009545 Ga0105237_10009466 Ga0105237_100094662 205
206 3300009553 Ga0105249_10020624 Ga0105249_100206242 205
207 3300010375 Ga0105239_10018362 Ga0105239_100183624 205
208 3300011119 Ga0105246_10100632 Ga0105246_101006322 205
209 3300013100 Ga0157373_10002844 Ga0157373_100028449 205
210 3300013100 Ga0157373_10013256 Ga0157373_100132561 205
211 3300013100 Ga0157373_10089811 Ga0157373_100898113 205
212 3300013100 Ga0157373_10175782 Ga0157373_101757822 205
213 3300013100 Ga0157373_10186515 Ga0157373_101865152 205
214 3300013100 Ga0157373_10399787 Ga0157373_103997872 205
215 3300013102 Ga0157371_10012951 Ga0157371_100129517 205
216 3300013102 Ga0157371_10018333 Ga0157371_100183332 205
217 3300013102 Ga0157371_10020286 Ga0157371_100202864 205
218 3300013102 Ga0157371_10021362 Ga0157371_100213622 205
219 3300013102 Ga0157371_10027544 Ga0157371_100275444 205
220 3300013102 Ga0157371_10058447 Ga0157371_100584472 205
221 3300013102 Ga0157371_10059200 Ga0157371_100592003 205
222 3300013102 Ga0157371_10085557 Ga0157371_100855572 205
223 3300013102 Ga0157371_10087123 Ga0157371_100871232 205
224 3300013102 Ga0157371_10093359 Ga0157371_100933593 205
225 3300013102 Ga0157371_10205987 Ga0157371_102059872 205
226 3300013104 Ga0157370_10126628 Ga0157370_101266283 205
227 3300013104 Ga0157370_10127251 Ga0157370_101272513 205
228 3300013104 Ga0157370_10169538 Ga0157370_101695382 205
229 3300013105 Ga0157369_10032227 Ga0157369_100322276 205
230 3300013105 Ga0157369_10063399 Ga0157369_100633993 205
231 3300013105 Ga0157369_10194262 Ga0157369_101942622 205
232 3300013105 Ga0157369_10370690 Ga0157369_103706902 205
233 3300013105 Ga0157369_10491018 Ga0157369_104910182 205
234 3300013297 Ga0157378_10015316 Ga0157378_1001531610 205
235 3300013297 Ga0157378_10092364 Ga0157378_100923643 205
236 3300013306 Ga0163162_10001619 Ga0163162_100016195 205
237 3300013306 Ga0163162_10242965 Ga0163162_102429651 205
238 3300013307 Ga0157372_10021594 Ga0157372_100215948 205
239 3300013307 Ga0157372_10035298 Ga0157372_100352985 205
240 3300013307 Ga0157372_10083681 Ga0157372_100836813 205
241 3300013307 Ga0157372_10087032 Ga0157372_100870322 205
242 3300013307 Ga0157372_10118488 Ga0157372_101184882 205
243 3300013307 Ga0157372_10884419 Ga0157372_108844191 205
244 3300013307 Ga0157372_11297575 Ga0157372_112975751 205
245 3300013308 Ga0157375_10172060 Ga0157375_101720603 205
246 3300014325 Ga0163163_10175107 Ga0163163_101751072 205
247 3300014326 Ga0157380_10011721 Ga0157380_100117214 205
248 3300014326 Ga0157380_10462430 Ga0157380_104624302 205
249 3300014745 Ga0157377_10000921 Ga0157377_1000092111 205
250 3300014968 Ga0157379_10133610 Ga0157379_101336103 205
251 3300025297 Ga0209758_1000653 Ga0209758_100065327 205
252 3300025302 Ga0207426_1001367 Ga0207426_10013677 205
253 3300025315 Ga0207697_10049034 Ga0207697_100490342 205
254 3300025899 Ga0207642_10012655 Ga0207642_100126552 205
255 3300025901 Ga0207688_10002952 Ga0207688_1000295210 205
256 3300025904 Ga0207647_10014478 Ga0207647_100144782 205
257 3300025907 Ga0207645_10001185 Ga0207645_1000118511 205
258 3300025907 Ga0207645_10049781 Ga0207645_100497812 205
259 3300025908 Ga0207643_10007693 Ga0207643_100076937 205
260 3300025909 Ga0207705_10002314 Ga0207705_100023141 205
261 3300025909 Ga0207705_10025972 Ga0207705_100259722 205
262 3300025909 Ga0207705_10086127 Ga0207705_100861273 205
263 3300025909 Ga0207705_10319282 Ga0207705_103192822 205
264 3300025909 Ga0207705_10403078 Ga0207705_104030782 205
265 3300025909 Ga0207705_10548314 Ga0207705_105483142 205
266 3300025911 Ga0207654_10004425 Ga0207654_100044255 205
267 3300025912 Ga0207707_10027517 Ga0207707_100275175 205
268 3300025912 Ga0207707_10161642 Ga0207707_101616422 205
269 3300025912 Ga0207707_10471735 Ga0207707_104717352 205
270 3300025913 Ga0207695_10010102 Ga0207695_100101029 205
271 3300025914 Ga0207671_10034297 Ga0207671_100342974 205
272 3300025917 Ga0207660_10054942 Ga0207660_100549422 205
273 3300025917 Ga0207660_10096981 Ga0207660_100969813 205
274 3300025917 Ga0207660_10215732 Ga0207660_102157322 205
275 3300025919 Ga0207657_10026531 Ga0207657_100265312 205
276 3300025919 Ga0207657_10039269 Ga0207657_100392693 205
277 3300025919 Ga0207657_10123918 Ga0207657_101239182 205
278 3300025919 Ga0207657_10197860 Ga0207657_101978602 205
279 3300025921 Ga0207652_10000137 Ga0207652_1000013750 205
280 3300025921 Ga0207652_10000958 Ga0207652_1000095818 205
281 3300025921 Ga0207652_10002121 Ga0207652_100021212 205
282 3300025921 Ga0207652_10010938 Ga0207652_100109383 205
283 3300025921 Ga0207652_10131386 Ga0207652_101313862 205
284 3300025923 Ga0207681_10004428 Ga0207681_100044287 205
285 3300025923 Ga0207681_10268451 Ga0207681_102684512 205
286 3300025926 Ga0207659_10093908 Ga0207659_100939083 205
287 3300025926 Ga0207659_10196113 Ga0207659_101961132 205
288 3300025933 Ga0207706_10019953 Ga0207706_100199534 205
289 3300025933 Ga0207706_10045838 Ga0207706_100458382 205
290 3300025934 Ga0207686_10134280 Ga0207686_101342802 205
291 3300025936 Ga0207670_10008600 Ga0207670_100086003 205
292 3300025938 Ga0207704_10047770 Ga0207704_100477702 205
293 3300025940 Ga0207691_10064556 Ga0207691_100645562 205
294 3300025942 Ga0207689_10015149 Ga0207689_100151492 205
295 3300025942 Ga0207689_10015813 Ga0207689_100158132 205
296 3300025942 Ga0207689_10056581 Ga0207689_100565813 205
297 3300025944 Ga0207661_10907513 Ga0207661_109075132 205
298 3300025944 Ga0207661_11256321 Ga0207661_112563211 205
299 3300025945 Ga0207679_10115261 Ga0207679_101152613 205
300 3300025949 Ga0207667_10000697 Ga0207667_1000069716 205
301 3300025960 Ga0207651_10008007 Ga0207651_100080072 205
302 3300025960 Ga0207651_10342809 Ga0207651_103428092 205
303 3300025961 Ga0207712_10175364 Ga0207712_101753642 205
304 3300025972 Ga0207668_10193278 Ga0207668_101932782 205
305 3300025981 Ga0207640_10230872 Ga0207640_102308722 205
306 3300025981 Ga0207640_10274876 Ga0207640_102748762 205
307 3300025986 Ga0207658_10108187 Ga0207658_101081873 205
308 3300026023 Ga0207677_10055680 Ga0207677_100556802 205
309 3300026041 Ga0207639_10042659 Ga0207639_100426592 205
310 3300026041 Ga0207639_10175753 Ga0207639_101757532 205
311 3300026067 Ga0207678_10043535 Ga0207678_100435352 205
312 3300026067 Ga0207678_10559189 Ga0207678_105591892 205
313 3300026078 Ga0207702_10499058 Ga0207702_104990582 205
314 3300026078 Ga0207702_10710984 Ga0207702_107109842 205
315 3300026088 Ga0207641_10462422 Ga0207641_104624221 205
316 3300026089 Ga0207648_10004723 Ga0207648_100047239 205
317 3300026089 Ga0207648_10017512 Ga0207648_100175123 205
318 3300026089 Ga0207648_10019923 Ga0207648_100199234 205
319 3300026116 Ga0207674_10036119 Ga0207674_100361193 205
320 3300026116 Ga0207674_10036402 Ga0207674_100364023 205
321 3300026116 Ga0207674_10681501 Ga0207674_106815011 205
322 3300026116 Ga0207674_10861356 Ga0207674_108613561 205
323 3300026118 Ga0207675_100000673 Ga0207675_1000006734 205
324 3300026118 Ga0207675_100081687 Ga0207675_1000816872 205
325 3300026118 Ga0207675_100690135 Ga0207675_1006901352 205
326 3300026121 Ga0207683_10020811 Ga0207683_100208118 205
327 3300026142 Ga0207698_10001672 Ga0207698_1000167210 205
328 3300026142 Ga0207698_10115732 Ga0207698_101157322 205
329 3300026142 Ga0207698_10774560 Ga0207698_107745602 205
330 3300027907 Ga0207428_10100043 Ga0207428_101000432 205
331 3300028379 Ga0268266_10096990 Ga0268266_100969902 205
332 3300028381 Ga0268264_10047492 Ga0268264_100474923 205
333 3300028381 Ga0268264_10153393 Ga0268264_101533933 205
334 3300028381 Ga0268264_10339351 Ga0268264_103393512 205
335 3300028381 Ga0268264_10561668 Ga0268264_105616682 205
336 3300028794 Ga0307515_10000455 Ga0307515_1000045564 205
337 3300031251 Ga0265327_10042972 Ga0265327_100429721 205
338 3300031731 Ga0307405_10019604 Ga0307405_100196043 205
339 3300031824 Ga0307413_10090076 Ga0307413_100900763 205
340 3300031852 Ga0307410_10196063 Ga0307410_101960631 205
341 3300031903 Ga0307407_10064805 Ga0307407_100648052 205
342 3300031911 Ga0307412_10087113 Ga0307412_100871132 205
343 3300032002 Ga0307416_100000341 Ga0307416_1000003414 205
344 3300032126 Ga0307415_100016082 Ga0307415_1000160824 205
345 3300033179 Ga0307507_10178368 Ga0307507_101783682 205
346 3300037312 Ga0395899_0002691 Ga0395899_0002691_7033_7656 205
347 3300037312 Ga0395899_0006410 Ga0395899_0006410_4667_5284 205
348 3300037312 Ga0395899_0041671 Ga0395899_0041671_2088_2708 205
349 3300037312 Ga0395899_0406167 Ga0395899_0406167_142_759 205
350 3300037418 Ga0395900_0005508 Ga0395900_0005508_11751_12374 205
351 3300037418 Ga0395900_0032246 Ga0395900_0032246_4183_4803 205
352 3300037418 Ga0395900_0069896 Ga0395900_0069896_230_847 205
353 3300037466 Ga0395898_0043893 Ga0395898_0043893_3107_3730 205
354 3300037466 Ga0395898_0422986 Ga0395898_0422986_32_649 205
355 3300037471 Ga0395905_0191786 Ga0395905_0191786_329_946 205
356 3300038443 Ga0395901_0013053 Ga0395901_0013053_7142_7759 205
357 3300038443 Ga0395901_0080980 Ga0395901_0080980_543_1166 205
358 3300041460 Ga0451802_1572872 Ga0451802_1572872_143_802 205
359 3300044842 Ga0466957_0139718 Ga0466957_0139718_832_1479 205
360 3300047472 Ga0495686_0063241 Ga0495686_0063241_855_1523 205
361 3300049569 Ga0501032_0028025 Ga0501032_0028025_46_669 205
362 3300049570 Ga0501033_0072602 Ga0501033_0072602_1315_1932 205
363 3300049571 Ga0501034_0004054 Ga0501034_0004054_14073_14696 205
364 3300049572 Ga0501036_0002569 Ga0501036_0002569_5912_6535 205
365 3300049573 Ga0501037_0016240 Ga0501037_0016240_1351_1974 205
366 3300049573 Ga0501037_0202837 Ga0501037_0202837_80_697 205
367 3300049574 Ga0501038_0044290 Ga0501038_0044290_49_669 205
368 3300049575 Ga0501039_0010310 Ga0501039_0010310_5573_6196 205
369 3300049579 Ga0501043_0003981 Ga0501043_0003981_1370_1993 205
370 3300049580 Ga0501046_0016328 Ga0501046_0016328_493_1116 205
371 3300049581 Ga0501047_0002595 Ga0501047_0002595_14131_14754 205
372 3300049582 Ga0501048_0017775 Ga0501048_0017775_1545_2168 205
373 3300049583 Ga0501067_0006010 Ga0501067_0006010_4796_5419 205
374 3300049584 Ga0501068_0108162 Ga0501068_0108162_927_1550 205
375 3300049586 Ga0501070_0024963 Ga0501070_0024963_2814_3437 205
376 3300049589 Ga0501073_0001021 Ga0501073_0001021_6764_7387 205
377 3300049590 Ga0501074_0000870 Ga0501074_0000870_17737_18360 205
378 3300049663 Ga0501223_013519 Ga0501223_013519_310_927 205
379 3300049666 Ga0501228_005470 Ga0501228_005470_458_1075 205
380 3300049686 Ga0501257_012910 Ga0501257_012910_651_1277 205
381 3300049690 Ga0501261_016285 Ga0501261_016285_342_962 205
382 3300049741 Ga0501079_0057970 Ga0501079_0057970_1042_1665 205
383 3300049742 Ga0501080_0028432 Ga0501080_0028432_893_1516 205
384 3300049744 Ga0501083_0049309 Ga0501083_0049309_1440_2063 205
385 3300049822 Ga0501035_0001809 Ga0501035_0001809_14510_15133 205
386 3300049823 Ga0501044_0017021 Ga0501044_0017021_5642_6265 205
387 3300049824 Ga0501045_0147532 Ga0501045_0147532_459_1082 205
388 3300050507 nmdc:mga05p37_119347_c1 nmdc:mga05p37_119347_c1_2129_2746 205
389 3300050508 nmdc:mga09592_25516_c1 nmdc:mga09592_25516_c1_1182_1799 205
390 3300050509 nmdc:mga0qj67_35368_c1 nmdc:mga0qj67_35368_c1_3046_3663 205
391 3300050510 nmdc:mga06r32_293986_c1 nmdc:mga06r32_293986_c1_655_1272 205
392 3300050511 nmdc:mga08y16_31513_c1 nmdc:mga08y16_31513_c1_1205_1822 205
393 3300053139 Ga0500568_0000473 Ga0500568_0000473_4997_5662 205
394 3300054114 Ga0501084_0222272 Ga0501084_0222272_58_681 205
395 3300060353 Ga0501082_0128216 Ga0501082_0128216_1501_2124 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

18

187

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o17-assembly1.cif.gz_B abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.8657 1 187
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.8625 3 202
7nhn-assembly1.cif.gz_0 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.8601 3 201
7e7q-assembly1.cif.gz_A cryo-em structure of human abca4 in atp-bound state 0.856 3 192
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.8488 3 201
ID Description Score Start End Superfamily
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.885 3 201 3.40.50.300
af_A0A0R0KFM3_480_665_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8809 84 191 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8809 3 201 3.40.50.300
af_Q2G196_1_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8798 3 201 3.40.50.300
af_Q9VRG3_531_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8763 3 201 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1T5PCN8-F1-model_v4 ABC-type multidrug transport system, ATPase component 0.9974 1 205 GO:0005524
GO:0016887
AF-A0A1Z5SDF2-F1-model_v4 ABC transporter ATP-binding protein 0.994 1 205 GO:0005524
GO:0016887
AF-A0A4R3KWS2-F1-model_v4 ABC-type multidrug transport system ATPase subunit 0.9916 1 205 GO:0005524
GO:0016887
AF-A0A257LA86-F1-model_v4 ABC transporter ATP-binding protein 0.99 1 205 GO:0005524
GO:0016887
AF-A0A1W2BAD7-F1-model_v4 ABC transporter 0.9895 1 205 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
95.64 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map