F433225

General Info

Members Datasets Scaffolds Average Seq Length
395 201 790 142

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10050180|Ga0207643_100501802
Length 161
Sequence MPALHPAPPAAGLGMRGRKPPRRVAWIAGMLSLLASALAWAALAPIELSSRDELFEIPKGTWARRMVGDKVEILPSTIRLTLGINDVLLIRNQDDVPQTFGPTIMMPGQSFRLPFERPASYQFVCTAHASGQLTIDVEAEPTTPWARIHWRARHWWENRKK

Samples

Sample ID Description Type Environment
1 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
146 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
152 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 3.54
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 18.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207643_10050180 3300025908 Bacteria 2366
2 rootL2_10038858 3300003322 Bacteria 1349
3 rootL2_10038859 3300003322 Unclassified 1370
4 Ga0065707_10134002 3300005295 Bacteria 1872
5 Ga0070658_10624814 3300005327 Unclassified 934
6 Ga0070676_10107170 3300005328 Unclassified 1735
7 Ga0070676_10402262 3300005328 Bacteria 953
8 Ga0070690_100049796 3300005330 Bacteria 2672
9 Ga0070690_100914478 3300005330 Bacteria 687
10 Ga0070670_101093493 3300005331 Bacteria 727
11 Ga0070677_10041466 3300005333 Bacteria 1817
12 Ga0068869_100981370 3300005334 Archaea 735
13 Ga0070666_10059129 3300005335 Bacteria 2592
14 Ga0070682_100095699 3300005337 Bacteria 1950
15 Ga0070682_100283406 3300005337 Bacteria 1209
16 Ga0070682_100303366 3300005337 Bacteria 1173
17 Ga0070682_100383501 3300005337 Bacteria 1058
18 Ga0070682_100774395 3300005337 Bacteria 777
19 Ga0070682_101015826 3300005337 Unclassified 689
20 Ga0070682_101563649 3300005337 Unclassified 569
21 Ga0070689_100238810 3300005340 Unclassified 1496
22 Ga0070689_101664904 3300005340 Unclassified 580
23 Ga0070661_101028916 3300005344 Unclassified 684
24 Ga0070661_101199074 3300005344 Bacteria 635
25 Ga0070668_100145400 3300005347 Bacteria 1913
26 Ga0070668_100175510 3300005347 Bacteria 1747
27 Ga0070668_100176743 3300005347 Bacteria 1741
28 Ga0070675_100010209 3300005354 Bacteria 7325
29 Ga0070675_100053133 3300005354 Bacteria 3332
30 Ga0070675_100148604 3300005354 Bacteria 2008
31 Ga0070675_100719086 3300005354 Unclassified 910
32 Ga0070671_100319932 3300005355 Bacteria 1322
33 Ga0070671_101046803 3300005355 Unclassified 716
34 Ga0070671_101074622 3300005355 Unclassified 706
35 Ga0070674_100057210 3300005356 Bacteria 2706
36 Ga0070674_100237743 3300005356 Bacteria 1424
37 Ga0070673_100338664 3300005364 Unclassified 1332
38 Ga0070673_100541450 3300005364 Bacteria 1057
39 Ga0070688_100169326 3300005365 Bacteria 1506
40 Ga0070688_100210565 3300005365 Unclassified 1365
41 Ga0070659_100438283 3300005366 Unclassified 1107
42 Ga0070667_100013359 3300005367 Bacteria 6786
43 Ga0070667_100324996 3300005367 Unclassified 1389
44 Ga0070667_100542803 3300005367 Bacteria 1068
45 Ga0070713_100633144 3300005436 Unclassified 1018
46 Ga0070710_10075555 3300005437 Bacteria 1953
47 Ga0070701_10097515 3300005438 Unclassified 1622
48 Ga0070701_10300845 3300005438 Bacteria 986
49 Ga0070700_100078129 3300005441 Bacteria 2130
50 Ga0070700_100382919 3300005441 Bacteria 1053
51 Ga0070663_100177429 3300005455 Bacteria 1650
52 Ga0070678_100103578 3300005456 Bacteria 2211
53 Ga0070678_100435430 3300005456 Bacteria 1146
54 Ga0070662_100949303 3300005457 Bacteria 735
55 Ga0068867_100077879 3300005459 Bacteria 2492
56 Ga0068867_100077923 3300005459 Bacteria 2492
57 Ga0068867_100492911 3300005459 Bacteria 1052
58 Ga0068867_100975380 3300005459 Unclassified 767
59 Ga0070685_10159344 3300005466 Bacteria 1437
60 Ga0070685_10199855 3300005466 Bacteria 1299
61 Ga0070679_100208380 3300005530 Bacteria 1919
62 Ga0068853_100028936 3300005539 Bacteria 4664
63 Ga0068853_100137928 3300005539 Bacteria 2188
64 Ga0068853_101009538 3300005539 Bacteria 801
65 Ga0068853_102302780 3300005539 Bacteria 522
66 Ga0070672_100002828 3300005543 Bacteria 11118
67 Ga0070672_100016112 3300005543 Bacteria 5346
68 Ga0070672_100022151 3300005543 Bacteria 4661
69 Ga0070672_100040474 3300005543 Bacteria 3576
70 Ga0070686_100037255 3300005544 Bacteria 3016
71 Ga0070686_100171372 3300005544 Bacteria 1535
72 Ga0070686_100755995 3300005544 Bacteria 780
73 Ga0070665_100003603 3300005548 Bacteria 16402
74 Ga0070665_100080452 3300005548 Bacteria 3264
75 Ga0070665_100473676 3300005548 Bacteria 1263
76 Ga0070665_101925066 3300005548 Bacteria 597
77 Ga0070665_102152309 3300005548 Bacteria 562
78 Ga0070704_101946721 3300005549 Unclassified 545
79 Ga0068855_100476277 3300005563 Bacteria 1359
80 Ga0070664_100010472 3300005564 Bacteria 7516
81 Ga0070664_101446162 3300005564 Archaea 650
82 Ga0068857_100129481 3300005577 Bacteria 2275
83 Ga0068856_100545913 3300005614 Bacteria 1180
84 Ga0068856_101103135 3300005614 Bacteria 811
85 Ga0070702_100451966 3300005615 Bacteria 932
86 Ga0068859_100000151 3300005617 Bacteria 66183
87 Ga0068859_100459198 3300005617 Bacteria 1370
88 Ga0068859_100466303 3300005617 Bacteria 1359
89 Ga0068864_100172524 3300005618 Bacteria 1973
90 Ga0068864_100334450 3300005618 Unclassified 1426
91 Ga0068866_10143840 3300005718 Bacteria 1372
92 Ga0068866_10378304 3300005718 Bacteria 907
93 Ga0068861_100145244 3300005719 Bacteria 1941
94 Ga0068861_100963533 3300005719 Unclassified 812
95 Ga0068870_10016937 3300005840 Bacteria 3495
96 Ga0068870_10017728 3300005840 Bacteria 3425
97 Ga0068870_10245332 3300005840 Bacteria 1108
98 Ga0068863_100014402 3300005841 Bacteria 7616
99 Ga0068863_100055877 3300005841 Bacteria 3738
100 Ga0068863_100216891 3300005841 Bacteria 1843
101 Ga0068863_100337651 3300005841 Bacteria 1465
102 Ga0068863_100978085 3300005841 Archaea 848
103 Ga0068863_100978086 3300005841 Unclassified 848
104 Ga0068863_101062268 3300005841 Bacteria 814
105 Ga0068858_100647681 3300005842 Bacteria 1026
106 Ga0068862_100002773 3300005844 Bacteria 15346
107 Ga0068862_100091248 3300005844 Bacteria 2653
108 Ga0068862_100184353 3300005844 Bacteria 1875
109 Ga0068862_100407201 3300005844 Bacteria 1273
110 Ga0068862_100829517 3300005844 Bacteria 905
111 Ga0070715_10278664 3300006163 Bacteria 885
112 Ga0097621_100014235 3300006237 Bacteria 5949
113 Ga0097621_100030587 3300006237 Bacteria 4263
114 Ga0097621_100109970 3300006237 Bacteria 2328
115 Ga0097621_100404465 3300006237 Unclassified 1223
116 Ga0068871_100009012 3300006358 Bacteria 7207
117 Ga0068871_100013573 3300006358 Bacteria 6048
118 Ga0068871_100031654 3300006358 Bacteria 4173
119 Ga0068871_100063774 3300006358 Bacteria 3014
120 Ga0068871_100346232 3300006358 Bacteria 1313
121 Ga0075428_101077690 3300006844 Bacteria 849
122 Ga0075430_101235875 3300006846 Unclassified 615
123 Ga0068865_100106730 3300006881 Bacteria 2059
124 Ga0068865_100119367 3300006881 Bacteria 1958
125 Ga0068865_100129906 3300006881 Bacteria 1886
126 Ga0068865_100674708 3300006881 Bacteria 881
127 Ga0068865_100833187 3300006881 Archaea 798
128 Ga0097620_100000151 3300006931 Bacteria 66183
129 Ga0097620_100459183 3300006931 Bacteria 1370
130 Ga0097620_100466307 3300006931 Bacteria 1359
131 Ga0075435_100357569 3300007076 Bacteria 1252
132 Ga0105240_10873524 3300009093 Bacteria 969
133 Ga0111539_10028444 3300009094 Bacteria 6819
134 Ga0105247_10163057 3300009101 Bacteria 1477
135 Ga0105243_10433554 3300009148 Bacteria 1229
136 Ga0105243_10873004 3300009148 Bacteria 893
137 Ga0105241_10135604 3300009174 Bacteria 1998
138 Ga0105242_10314452 3300009176 Bacteria 1434
139 Ga0105242_10920552 3300009176 Bacteria 876
140 Ga0105242_11295680 3300009176 Unclassified 752
141 Ga0105248_10035518 3300009177 Bacteria 5576
142 Ga0105248_11599179 3300009177 Unclassified 738
143 Ga0105238_11042880 3300009551 Bacteria 839
144 Ga0105249_10729841 3300009553 Bacteria 1052
145 Ga0105239_10448154 3300010375 Bacteria 1464
146 Ga0105239_12181485 3300010375 Unclassified 644
147 Ga0157370_11004025 3300013104 Bacteria 755
148 Ga0157370_11411945 3300013104 Bacteria 626
149 Ga0157374_10078646 3300013296 Bacteria 3124
150 Ga0157374_10108756 3300013296 Bacteria 2665
151 Ga0163162_10010583 3300013306 Bacteria 8972
152 Ga0163162_10087788 3300013306 Bacteria 3189
153 Ga0163162_10368166 3300013306 Bacteria 1570
154 Ga0157372_10386870 3300013307 Bacteria 1630
155 Ga0157375_10004701 3300013308 Bacteria 11887
156 Ga0157375_10012567 3300013308 Bacteria 7514
157 Ga0157375_10586544 3300013308 Unclassified 1275
158 Ga0157375_11374903 3300013308 Bacteria 831
159 Ga0157375_12668711 3300013308 Bacteria 597
160 Ga0163163_10089615 3300014325 Bacteria 3088
161 Ga0163163_10281309 3300014325 Bacteria 1715
162 Ga0163163_11088310 3300014325 Bacteria 862
163 Ga0163163_11133006 3300014325 Bacteria 845
164 Ga0163163_11359334 3300014325 Unclassified 772
165 Ga0163163_12203333 3300014325 Unclassified 610
166 Ga0157380_10030003 3300014326 Bacteria 4161
167 Ga0157380_10101698 3300014326 Bacteria 2395
168 Ga0157380_10484798 3300014326 Unclassified 1197
169 Ga0157380_10635021 3300014326 Bacteria 1062
170 Ga0157380_10792996 3300014326 Bacteria 963
171 Ga0157380_12746274 3300014326 Bacteria 559
172 Ga0157377_11541488 3300014745 Unclassified 530
173 Ga0157379_10273645 3300014968 Bacteria 1536
174 Ga0157379_10670780 3300014968 Bacteria 972
175 Ga0157379_11343500 3300014968 Bacteria 691
176 Ga0157376_10010196 3300014969 Bacteria 6861
177 Ga0157376_10084887 3300014969 Bacteria 2727
178 Ga0157376_10119201 3300014969 Bacteria 2336
179 Ga0157376_10215171 3300014969 Bacteria 1776
180 Ga0157376_10281678 3300014969 Bacteria 1566
181 Ga0157376_10615018 3300014969 Bacteria 1083
182 Ga0157376_12267213 3300014969 Bacteria 582
183 Ga0163161_10398295 3300017792 Bacteria 1103
184 Ga0163161_10560184 3300017792 Bacteria 938
185 Ga0163161_10776203 3300017792 Bacteria 803
186 Ga0163161_11152298 3300017792 Unclassified 668
187 Ga0207697_10266291 3300025315 Unclassified 759
188 Ga0207682_10005978 3300025893 Bacteria 4923
189 Ga0207642_10044762 3300025899 Bacteria 1961
190 Ga0207680_10030679 3300025903 Bacteria 3036
191 Ga0207680_10111179 3300025903 Bacteria 1777
192 Ga0207685_10077393 3300025905 Bacteria 1366
193 Ga0207645_10273400 3300025907 Bacteria 1121
194 Ga0207645_10734718 3300025907 Unclassified 671
195 Ga0207643_10003576 3300025908 Bacteria 8370
196 Ga0207643_10016401 3300025908 Bacteria 4041
197 Ga0207695_11425980 3300025913 Bacteria 573
198 Ga0207662_10385174 3300025918 Bacteria 948
199 Ga0207649_11061335 3300025920 Unclassified 638
200 Ga0207681_10108235 3300025923 Bacteria 2017
201 Ga0207681_10807179 3300025923 Bacteria 784
202 Ga0207694_10874725 3300025924 Bacteria 760
203 Ga0207650_10201532 3300025925 Bacteria 1594
204 Ga0207650_10509842 3300025925 Bacteria 1006
205 Ga0207659_10116984 3300025926 Bacteria 2036
206 Ga0207659_10185790 3300025926 Bacteria 1650
207 Ga0207659_10265534 3300025926 Unclassified 1398
208 Ga0207644_10206137 3300025931 Bacteria 1553
209 Ga0207644_11365263 3300025931 Unclassified 595
210 Ga0207644_11469082 3300025931 Unclassified 572
211 Ga0207690_11071289 3300025932 Archaea 671
212 Ga0207706_10251910 3300025933 Bacteria 1542
213 Ga0207686_10161098 3300025934 Bacteria 1572
214 Ga0207686_10952353 3300025934 Unclassified 695
215 Ga0207670_11245483 3300025936 Unclassified 630
216 Ga0207669_10040884 3300025937 Bacteria 2693
217 Ga0207669_10145187 3300025937 Bacteria 1653
218 Ga0207704_10106185 3300025938 Bacteria 1886
219 Ga0207704_10598884 3300025938 Bacteria 902
220 Ga0207704_11007501 3300025938 Archaea 705
221 Ga0207704_11839233 3300025938 Unclassified 521
222 Ga0207691_10005747 3300025940 Bacteria 12000
223 Ga0207691_10037020 3300025940 Bacteria 4520
224 Ga0207691_10044915 3300025940 Bacteria 4065
225 Ga0207691_10046396 3300025940 Bacteria 3993
226 Ga0207691_10181896 3300025940 Bacteria 1836
227 Ga0207691_10377311 3300025940 Bacteria 1211
228 Ga0207691_11015639 3300025940 Unclassified 692
229 Ga0207711_10465374 3300025941 Unclassified 1177
230 Ga0207689_10101624 3300025942 Bacteria 2362
231 Ga0207689_10107327 3300025942 Bacteria 2295
232 Ga0207689_11249753 3300025942 Unclassified 625
233 Ga0207679_10550068 3300025945 Bacteria 1035
234 Ga0207679_11026158 3300025945 Unclassified 756
235 Ga0207667_10922685 3300025949 Bacteria 864
236 Ga0207651_10626801 3300025960 Unclassified 942
237 Ga0207712_10051011 3300025961 Bacteria 2891
238 Ga0207712_10487510 3300025961 Bacteria 1052
239 Ga0207668_10037273 3300025972 Bacteria 3253
240 Ga0207668_10189188 3300025972 Bacteria 1630
241 Ga0207668_10192992 3300025972 Bacteria 1615
242 Ga0207658_10143168 3300025986 Bacteria 1938
243 Ga0207658_10506257 3300025986 Bacteria 1076
244 Ga0207658_10604501 3300025986 Bacteria 985
245 Ga0207677_11907382 3300026023 Unclassified 552
246 Ga0207703_10483768 3300026035 Bacteria 1160
247 Ga0207639_10116592 3300026041 Bacteria 2187
248 Ga0207639_10123194 3300026041 Bacteria 2134
249 Ga0207639_10354380 3300026041 Bacteria 1311
250 Ga0207639_10440291 3300026041 Bacteria 1181
251 Ga0207639_10609133 3300026041 Bacteria 1008
252 Ga0207678_10165557 3300026067 Bacteria 1888
253 Ga0207678_10179626 3300026067 Bacteria 1807
254 Ga0207678_10188453 3300026067 Bacteria 1762
255 Ga0207708_10040804 3300026075 Bacteria 3539
256 Ga0207708_10086901 3300026075 Bacteria 2407
257 Ga0207708_10469200 3300026075 Bacteria 1051
258 Ga0207702_10135474 3300026078 Bacteria 2222
259 Ga0207641_10094874 3300026088 Bacteria 2617
260 Ga0207641_10268707 3300026088 Bacteria 1599
261 Ga0207641_10288753 3300026088 Bacteria 1545
262 Ga0207641_10339393 3300026088 Bacteria 1429
263 Ga0207648_10013121 3300026089 Bacteria 7724
264 Ga0207648_10015790 3300026089 Bacteria 6924
265 Ga0207648_10084328 3300026089 Bacteria 2771
266 Ga0207648_10703620 3300026089 Bacteria 936
267 Ga0207648_10790536 3300026089 Unclassified 883
268 Ga0207676_10011285 3300026095 Bacteria 6384
269 Ga0207676_10177679 3300026095 Bacteria 1861
270 Ga0207674_10534639 3300026116 Bacteria 1132
271 Ga0207675_100252335 3300026118 Bacteria 1708
272 Ga0207675_100380954 3300026118 Unclassified 1387
273 Ga0207675_100751889 3300026118 Bacteria 986
274 Ga0207675_100995258 3300026118 Bacteria 857
275 Ga0207683_10069401 3300026121 Bacteria 3112
276 Ga0207683_10140605 3300026121 Unclassified 2175
277 Ga0207683_10446874 3300026121 Bacteria 1191
278 Ga0268266_10004864 3300028379 Bacteria 12745
279 Ga0268266_10057649 3300028379 Bacteria 3343
280 Ga0268266_10771640 3300028379 Bacteria 928
281 Ga0268266_11343514 3300028379 Bacteria 690
282 Ga0268266_11695725 3300028379 Bacteria 607
283 Ga0268265_10000554 3300028380 Bacteria 38099
284 Ga0268265_10083441 3300028380 Bacteria 2530
285 Ga0268265_10238042 3300028380 Bacteria 1604
286 Ga0268265_10624064 3300028380 Unclassified 1033
287 Ga0268264_10007846 3300028381 Bacteria 8885
288 Ga0268264_10289321 3300028381 Bacteria 1538
289 Ga0268264_10414699 3300028381 Unclassified 1297
290 Ga0268264_10526578 3300028381 Bacteria 1156
291 Ga0307515_10272329 3300028794 Bacteria 1412
292 Ga0307513_10036586 3300031456 Bacteria 5473
293 Ga0307513_10060565 3300031456 Bacteria 4013
294 Ga0307513_10197230 3300031456 Bacteria 1858
295 Ga0307509_10031569 3300031507 Bacteria 5849
296 Ga0307509_10049953 3300031507 Bacteria 4481
297 Ga0307408_100036171 3300031548 Bacteria 3470
298 Ga0307408_100049655 3300031548 Bacteria 3014
299 Ga0307408_100354505 3300031548 Bacteria 1246
300 Ga0307408_101544131 3300031548 Unclassified 629
301 Ga0307405_11194156 3300031731 Bacteria 658
302 Ga0307413_10006142 3300031824 Bacteria 5452
303 Ga0307413_10046651 3300031824 Bacteria 2578
304 Ga0307413_11202761 3300031824 Unclassified 659
305 Ga0307406_10010098 3300031901 Bacteria 5318
306 Ga0307406_10298997 3300031901 Bacteria 1236
307 Ga0307407_10118587 3300031903 Bacteria 1673
308 Ga0307407_10420033 3300031903 Bacteria 963
309 Ga0307409_100061382 3300031995 Bacteria 2937
310 Ga0307409_100198581 3300031995 Bacteria 1792
311 Ga0307416_100325315 3300032002 Bacteria 1542
312 Ga0307416_100525506 3300032002 Bacteria 1252
313 Ga0307414_10425517 3300032004 Unclassified 1159
314 Ga0307411_10000884 3300032005 Bacteria 11352
315 Ga0307411_10035580 3300032005 Bacteria 3111
316 Ga0307411_10169734 3300032005 Bacteria 1644
317 Ga0307415_100056983 3300032126 Bacteria 2683
318 Ga0307415_100117423 3300032126 Bacteria 1987
319 Ga0307415_100292034 3300032126 Bacteria 1346
320 Ga0373944_0027849 3300035089 Bacteria 1679
321 Ga0373936_0095382 3300035113 Bacteria 1251
322 Ga0373954_0362231 3300035118 Bacteria 716
323 Ga0373946_0708352 3300035171 Unclassified 527
324 Ga0373955_0961925 3300035172 Unclassified 526
325 Ga0373935_0902283 3300035692 Bacteria 655
326 Ga0373937_0359152 3300036401 Bacteria 1380
327 Ga0373937_1150480 3300036401 Unclassified 724
328 Ga0373925_1447707 3300037068 Unclassified 562
329 Ga0451789_0848012 3300041443 Bacteria 1528
330 Ga0451797_0256080 3300041453 Unclassified 762
331 Ga0451795_0828306 3300041456 Unclassified 741
332 Ga0451795_1270429 3300041456 Bacteria 909
333 Ga0451798_0428982 3300041458 Bacteria 3406
334 Ga0451800_1138260 3300041459 Bacteria 1421
335 Ga0451802_0440653 3300041460 Bacteria 1021
336 Ga0451807_0455525 3300041486 Bacteria 1850
337 Ga0451807_1994860 3300041486 Bacteria 1082
338 Ga0451833_1096462 3300041491 Unclassified 661
339 Ga0451845_0416300 3300041501 Bacteria 696
340 Ga0451843_1327590 3300041509 Unclassified 506
341 Ga0451843_1606178 3300041509 Bacteria 1401
342 Ga0451853_0417456 3300041512 Bacteria 1676
343 Ga0451853_0599778 3300041512 Unclassified 875
344 Ga0450916_037151 3300042530 Bacteria 730
345 Ga0495603_0321770 3300046455 Bacteria 888
346 Ga0495590_0096899 3300046457 Unclassified 1046
347 Ga0495629_0545412 3300046459 Bacteria 779
348 Ga0495638_0028670 3300046460 Bacteria 3592
349 Ga0495582_0173096 3300046473 Bacteria 1229
350 Ga0495605_0309684 3300046474 Bacteria 667
351 Ga0495616_0000837 3300046513 Bacteria 22426
352 Ga0495620_0054957 3300046515 Bacteria 1680
353 Ga0495632_0104477 3300046519 Bacteria 1333
354 Ga0495587_0190374 3300046536 Bacteria 1162
355 Ga0495625_0004587 3300046660 Bacteria 12991
356 Ga0495625_0154756 3300046660 Bacteria 1539
357 Ga0495635_0220392 3300046663 Unclassified 1283
358 Ga0495657_0083911 3300046675 Bacteria 2056
359 Ga0495647_0060473 3300046681 Bacteria 1494
360 Ga0495658_0027863 3300046683 Bacteria 3044
361 Ga0495670_0501806 3300046691 Bacteria 659
362 Ga0495670_0507514 3300046691 Unclassified 655
363 Ga0495649_0001712 3300046694 Bacteria 16270
364 Ga0495649_0063551 3300046694 Bacteria 1983
365 Ga0495649_0099329 3300046694 Bacteria 1548
366 Ga0495589_0436235 3300046794 Unclassified 600
367 Ga0495600_0422882 3300046809 Unclassified 827
368 Ga0495680_0256551 3300047322 Bacteria 1238
369 Ga0495686_0094731 3300047472 Bacteria 1809
370 Ga0495686_0131234 3300047472 Bacteria 1485
371 Ga0495615_0129467 3300048090 Bacteria 737
372 Ga0496102_0086488 3300048905 Bacteria 2895
373 Ga0496103_0248519 3300048906 Bacteria 1144
374 Ga0496104_0131415 3300048907 Bacteria 2405
375 Ga0496110_0481951 3300048913 Bacteria 1130
376 Ga0496114_0083478 3300048917 Bacteria 2703
377 Ga0496117_0287670 3300048920 Bacteria 877
378 Ga0496118_0007082 3300048921 Bacteria 12045
379 Ga0495682_0361028 3300049460 Unclassified 512
380 Ga0501031_0719203 3300049568 Bacteria 641
381 Ga0501032_0520835 3300049569 Unclassified 759
382 Ga0501034_0150550 3300049571 Bacteria 2303
383 Ga0501036_0466371 3300049572 Bacteria 1052
384 Ga0501037_0207137 3300049573 Bacteria 1384
385 Ga0501042_0102262 3300049578 Bacteria 2061
386 Ga0501068_0109966 3300049584 Bacteria 1713
387 Ga0501070_0815601 3300049586 Bacteria 732
388 Ga0501071_0812206 3300049587 Bacteria 721
389 Ga0501073_0103726 3300049589 Bacteria 1974
390 Ga0501079_0512754 3300049741 Bacteria 943
391 nmdc:mga0qj67_1117538_c1 3300050509 Unclassified 615
392 nmdc:mga0rr50_374377_c1 3300050513 Bacteria 1200
393 Ga0495601_0406114 3300053077 Bacteria 883
394 Ga0500611_054260 3300053727 Bacteria 928
395 Ga0530510_0770859 3300061734 Bacteria 734
396 Ga0207643_10050180
397 rootL2_10038858
398 rootL2_10038859
399 Ga0065707_10134002
400 Ga0070658_10624814
401 Ga0070676_10107170
402 Ga0070676_10402262
403 Ga0070690_100049796
404 Ga0070690_100914478
405 Ga0070670_101093493
406 Ga0070677_10041466
407 Ga0068869_100981370
408 Ga0070666_10059129
409 Ga0070682_100095699
410 Ga0070682_100283406
411 Ga0070682_100303366
412 Ga0070682_100383501
413 Ga0070682_100774395
414 Ga0070682_101015826
415 Ga0070682_101563649
416 Ga0070689_100238810
417 Ga0070689_101664904
418 Ga0070661_101028916
419 Ga0070661_101199074
420 Ga0070668_100145400
421 Ga0070668_100175510
422 Ga0070668_100176743
423 Ga0070675_100010209
424 Ga0070675_100053133
425 Ga0070675_100148604
426 Ga0070675_100719086
427 Ga0070671_100319932
428 Ga0070671_101046803
429 Ga0070671_101074622
430 Ga0070674_100057210
431 Ga0070674_100237743
432 Ga0070673_100338664
433 Ga0070673_100541450
434 Ga0070688_100169326
435 Ga0070688_100210565
436 Ga0070659_100438283
437 Ga0070667_100013359
438 Ga0070667_100324996
439 Ga0070667_100542803
440 Ga0070713_100633144
441 Ga0070710_10075555
442 Ga0070701_10097515
443 Ga0070701_10300845
444 Ga0070700_100078129
445 Ga0070700_100382919
446 Ga0070663_100177429
447 Ga0070678_100103578
448 Ga0070678_100435430
449 Ga0070662_100949303
450 Ga0068867_100077879
451 Ga0068867_100077923
452 Ga0068867_100492911
453 Ga0068867_100975380
454 Ga0070685_10159344
455 Ga0070685_10199855
456 Ga0070679_100208380
457 Ga0068853_100028936
458 Ga0068853_100137928
459 Ga0068853_101009538
460 Ga0068853_102302780
461 Ga0070672_100002828
462 Ga0070672_100016112
463 Ga0070672_100022151
464 Ga0070672_100040474
465 Ga0070686_100037255
466 Ga0070686_100171372
467 Ga0070686_100755995
468 Ga0070665_100003603
469 Ga0070665_100080452
470 Ga0070665_100473676
471 Ga0070665_101925066
472 Ga0070665_102152309
473 Ga0070704_101946721
474 Ga0068855_100476277
475 Ga0070664_100010472
476 Ga0070664_101446162
477 Ga0068857_100129481
478 Ga0068856_100545913
479 Ga0068856_101103135
480 Ga0070702_100451966
481 Ga0068859_100000151
482 Ga0068859_100459198
483 Ga0068859_100466303
484 Ga0068864_100172524
485 Ga0068864_100334450
486 Ga0068866_10143840
487 Ga0068866_10378304
488 Ga0068861_100145244
489 Ga0068861_100963533
490 Ga0068870_10016937
491 Ga0068870_10017728
492 Ga0068870_10245332
493 Ga0068863_100014402
494 Ga0068863_100055877
495 Ga0068863_100216891
496 Ga0068863_100337651
497 Ga0068863_100978085
498 Ga0068863_100978086
499 Ga0068863_101062268
500 Ga0068858_100647681
501 Ga0068862_100002773
502 Ga0068862_100091248
503 Ga0068862_100184353
504 Ga0068862_100407201
505 Ga0068862_100829517
506 Ga0070715_10278664
507 Ga0097621_100014235
508 Ga0097621_100030587
509 Ga0097621_100109970
510 Ga0097621_100404465
511 Ga0068871_100009012
512 Ga0068871_100013573
513 Ga0068871_100031654
514 Ga0068871_100063774
515 Ga0068871_100346232
516 Ga0075428_101077690
517 Ga0075430_101235875
518 Ga0068865_100106730
519 Ga0068865_100119367
520 Ga0068865_100129906
521 Ga0068865_100674708
522 Ga0068865_100833187
523 Ga0097620_100000151
524 Ga0097620_100459183
525 Ga0097620_100466307
526 Ga0075435_100357569
527 Ga0105240_10873524
528 Ga0111539_10028444
529 Ga0105247_10163057
530 Ga0105243_10433554
531 Ga0105243_10873004
532 Ga0105241_10135604
533 Ga0105242_10314452
534 Ga0105242_10920552
535 Ga0105242_11295680
536 Ga0105248_10035518
537 Ga0105248_11599179
538 Ga0105238_11042880
539 Ga0105249_10729841
540 Ga0105239_10448154
541 Ga0105239_12181485
542 Ga0157370_11004025
543 Ga0157370_11411945
544 Ga0157374_10078646
545 Ga0157374_10108756
546 Ga0163162_10010583
547 Ga0163162_10087788
548 Ga0163162_10368166
549 Ga0157372_10386870
550 Ga0157375_10004701
551 Ga0157375_10012567
552 Ga0157375_10586544
553 Ga0157375_11374903
554 Ga0157375_12668711
555 Ga0163163_10089615
556 Ga0163163_10281309
557 Ga0163163_11088310
558 Ga0163163_11133006
559 Ga0163163_11359334
560 Ga0163163_12203333
561 Ga0157380_10030003
562 Ga0157380_10101698
563 Ga0157380_10484798
564 Ga0157380_10635021
565 Ga0157380_10792996
566 Ga0157380_12746274
567 Ga0157377_11541488
568 Ga0157379_10273645
569 Ga0157379_10670780
570 Ga0157379_11343500
571 Ga0157376_10010196
572 Ga0157376_10084887
573 Ga0157376_10119201
574 Ga0157376_10215171
575 Ga0157376_10281678
576 Ga0157376_10615018
577 Ga0157376_12267213
578 Ga0163161_10398295
579 Ga0163161_10560184
580 Ga0163161_10776203
581 Ga0163161_11152298
582 Ga0207697_10266291
583 Ga0207682_10005978
584 Ga0207642_10044762
585 Ga0207680_10030679
586 Ga0207680_10111179
587 Ga0207685_10077393
588 Ga0207645_10273400
589 Ga0207645_10734718
590 Ga0207643_10003576
591 Ga0207643_10016401
592 Ga0207695_11425980
593 Ga0207662_10385174
594 Ga0207649_11061335
595 Ga0207681_10108235
596 Ga0207681_10807179
597 Ga0207694_10874725
598 Ga0207650_10201532
599 Ga0207650_10509842
600 Ga0207659_10116984
601 Ga0207659_10185790
602 Ga0207659_10265534
603 Ga0207644_10206137
604 Ga0207644_11365263
605 Ga0207644_11469082
606 Ga0207690_11071289
607 Ga0207706_10251910
608 Ga0207686_10161098
609 Ga0207686_10952353
610 Ga0207670_11245483
611 Ga0207669_10040884
612 Ga0207669_10145187
613 Ga0207704_10106185
614 Ga0207704_10598884
615 Ga0207704_11007501
616 Ga0207704_11839233
617 Ga0207691_10005747
618 Ga0207691_10037020
619 Ga0207691_10044915
620 Ga0207691_10046396
621 Ga0207691_10181896
622 Ga0207691_10377311
623 Ga0207691_11015639
624 Ga0207711_10465374
625 Ga0207689_10101624
626 Ga0207689_10107327
627 Ga0207689_11249753
628 Ga0207679_10550068
629 Ga0207679_11026158
630 Ga0207667_10922685
631 Ga0207651_10626801
632 Ga0207712_10051011
633 Ga0207712_10487510
634 Ga0207668_10037273
635 Ga0207668_10189188
636 Ga0207668_10192992
637 Ga0207658_10143168
638 Ga0207658_10506257
639 Ga0207658_10604501
640 Ga0207677_11907382
641 Ga0207703_10483768
642 Ga0207639_10116592
643 Ga0207639_10123194
644 Ga0207639_10354380
645 Ga0207639_10440291
646 Ga0207639_10609133
647 Ga0207678_10165557
648 Ga0207678_10179626
649 Ga0207678_10188453
650 Ga0207708_10040804
651 Ga0207708_10086901
652 Ga0207708_10469200
653 Ga0207702_10135474
654 Ga0207641_10094874
655 Ga0207641_10268707
656 Ga0207641_10288753
657 Ga0207641_10339393
658 Ga0207648_10013121
659 Ga0207648_10015790
660 Ga0207648_10084328
661 Ga0207648_10703620
662 Ga0207648_10790536
663 Ga0207676_10011285
664 Ga0207676_10177679
665 Ga0207674_10534639
666 Ga0207675_100252335
667 Ga0207675_100380954
668 Ga0207675_100751889
669 Ga0207675_100995258
670 Ga0207683_10069401
671 Ga0207683_10140605
672 Ga0207683_10446874
673 Ga0268266_10004864
674 Ga0268266_10057649
675 Ga0268266_10771640
676 Ga0268266_11343514
677 Ga0268266_11695725
678 Ga0268265_10000554
679 Ga0268265_10083441
680 Ga0268265_10238042
681 Ga0268265_10624064
682 Ga0268264_10007846
683 Ga0268264_10289321
684 Ga0268264_10414699
685 Ga0268264_10526578
686 Ga0307515_10272329
687 Ga0307513_10036586
688 Ga0307513_10060565
689 Ga0307513_10197230
690 Ga0307509_10031569
691 Ga0307509_10049953
692 Ga0307408_100036171
693 Ga0307408_100049655
694 Ga0307408_100354505
695 Ga0307408_101544131
696 Ga0307405_11194156
697 Ga0307413_10006142
698 Ga0307413_10046651
699 Ga0307413_11202761
700 Ga0307406_10010098
701 Ga0307406_10298997
702 Ga0307407_10118587
703 Ga0307407_10420033
704 Ga0307409_100061382
705 Ga0307409_100198581
706 Ga0307416_100325315
707 Ga0307416_100525506
708 Ga0307414_10425517
709 Ga0307411_10000884
710 Ga0307411_10035580
711 Ga0307411_10169734
712 Ga0307415_100056983
713 Ga0307415_100117423
714 Ga0307415_100292034
715 Ga0373944_0027849
716 Ga0373936_0095382
717 Ga0373954_0362231
718 Ga0373946_0708352
719 Ga0373955_0961925
720 Ga0373935_0902283
721 Ga0373937_0359152
722 Ga0373937_1150480
723 Ga0373925_1447707
724 Ga0451789_0848012
725 Ga0451797_0256080
726 Ga0451795_0828306
727 Ga0451795_1270429
728 Ga0451798_0428982
729 Ga0451800_1138260
730 Ga0451802_0440653
731 Ga0451807_0455525
732 Ga0451807_1994860
733 Ga0451833_1096462
734 Ga0451845_0416300
735 Ga0451843_1327590
736 Ga0451843_1606178
737 Ga0451853_0417456
738 Ga0451853_0599778
739 Ga0450916_037151
740 Ga0495603_0321770
741 Ga0495590_0096899
742 Ga0495629_0545412
743 Ga0495638_0028670
744 Ga0495582_0173096
745 Ga0495605_0309684
746 Ga0495616_0000837
747 Ga0495620_0054957
748 Ga0495632_0104477
749 Ga0495587_0190374
750 Ga0495625_0004587
751 Ga0495625_0154756
752 Ga0495635_0220392
753 Ga0495657_0083911
754 Ga0495647_0060473
755 Ga0495658_0027863
756 Ga0495670_0501806
757 Ga0495670_0507514
758 Ga0495649_0001712
759 Ga0495649_0063551
760 Ga0495649_0099329
761 Ga0495589_0436235
762 Ga0495600_0422882
763 Ga0495680_0256551
764 Ga0495686_0094731
765 Ga0495686_0131234
766 Ga0495615_0129467
767 Ga0496102_0086488
768 Ga0496103_0248519
769 Ga0496104_0131415
770 Ga0496110_0481951
771 Ga0496114_0083478
772 Ga0496117_0287670
773 Ga0496118_0007082
774 Ga0495682_0361028
775 Ga0501031_0719203
776 Ga0501032_0520835
777 Ga0501034_0150550
778 Ga0501036_0466371
779 Ga0501037_0207137
780 Ga0501042_0102262
781 Ga0501068_0109966
782 Ga0501070_0815601
783 Ga0501071_0812206
784 Ga0501073_0103726
785 Ga0501079_0512754
786 nmdc:mga0qj67_1117538_c1
787 nmdc:mga0rr50_374377_c1
788 Ga0495601_0406114
789 Ga0500611_054260
790 Ga0530510_0770859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zqe-assembly1.cif.gz_M plastocyanin bound to psi of chlamydomonas reinhardtii 0.7774 52 119
1z3q-assembly1.cif.gz_A resolution of the structure of the allergenic and antifungal banana fruit thaumatin-like protein at 1.7a 0.7759 68 106
1teg-assembly2.cif.gz_B crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond 0.7743 56 119
2ahn-assembly1.cif.gz_A high resolution structure of a cherry allergen pru av 2 0.774 68 106
1byo-assembly2.cif.gz_B wild-type plastocyanin from silene 0.7707 56 119
ID Description Score Start End Superfamily
af_G5ED60_306_413_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8391 66 95 2.60.200.20
af_A0A1D6NE26_94_204_2.60.110.10 Mainly Beta;Sandwich;Thaumatin;Thaumatin 0.8207 68 106 2.60.110.10
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7095 35 119 2.60.40.420
af_Q9AUW1_29_129_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7061 67 122 2.60.40.420
af_Q19213_18_104_2.60.40.780 Mainly Beta;Sandwich;Immunoglobulin-like;von Hippel-Lindau disease tumour suppressor, 0.7044 68 106 2.60.40.780
ID Description Score Start End GO Terms
AF-A0A534Q553-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9827 9 142
AF-A0A841HT58-F1-model_v4 Plastocyanin 0.9595 1 142
AF-A0A4Y9T3S0-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9577 17 138 GO:0042597
AF-A0A4Q5VC17-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9563 22 138
AF-A0A841HT58-F1-model_v4 Plastocyanin 0.953 1 142

Map