F433233

General Info

Members Datasets Scaffolds Average Seq Length
395 261 790 261

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10077985|Ga0207664_100779852
Length 297
Sequence MATVLGYNWRRSRAAEYEPGNVVRRVEVGDVKVVMLCGGKGTRLREETEFRPKPMVEIGGRPILWHIMKLYAYYGFNEFVLCLGYKGSVIKDYFLNYNSMLNDFTLSLGTRNGRAITYHGDDEIHDFIVTLADTGEETLTAGRLKRVERYLDDDTFMVTYGDGLADVNIRDLLAFHHAHGKLATVTAIQPTSRFGLLDIEHDGSVSRFVEKPQVDEWINGGFFVFNRRIFNYINRDCMLEQDPLMSLAEDGQLVAYRHTGFWQAMDTYRDTLYLNDIWREGDAPWAVWQRAPVALKV

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
146 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
161 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
237 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
241 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
242 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
243 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
244 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
245 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
246 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
247 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
248 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
249 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
250 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
251 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
252 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
253 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
254 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
255 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
256 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
257 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
258 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
259 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
260 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
261 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.67
Metatranscriptomes 0.51
Isolates 5.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 3.04
Rhizoplane 1.77
Rhizosphere 80.51
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10077985 3300025929 Bacteria 2686
2 JGI25153J46596_10022285 3300003215 Bacteria 2340
3 JGI25160J50197_1004971 3300003354 Bacteria 5643
4 Ga0007409J51694_1040004 3300003575 Bacteria 1915
5 Ga0065712_10010685 3300005290 Bacteria 2458
6 Ga0065707_10204170 3300005295 Bacteria 1296
7 Ga0065707_10270834 3300005295 Bacteria 1072
8 Ga0065707_10315408 3300005295 Bacteria 976
9 Ga0070676_10032451 3300005328 Bacteria 2992
10 Ga0070676_10208637 3300005328 Bacteria 1284
11 Ga0070683_100001472 3300005329 Bacteria 18134
12 Ga0070670_100144029 3300005331 Bacteria 2061
13 Ga0068869_100059385 3300005334 Bacteria 2800
14 Ga0068869_100092025 3300005334 Bacteria 2282
15 Ga0070666_10039032 3300005335 Bacteria 3162
16 Ga0070680_100026662 3300005336 Bacteria 4621
17 Ga0070680_100072796 3300005336 Bacteria 2825
18 Ga0070680_100259213 3300005336 Bacteria 1471
19 Ga0070680_100562358 3300005336 Bacteria 978
20 Ga0068868_100181540 3300005338 Bacteria 1746
21 Ga0070669_100476452 3300005353 Bacteria 1032
22 Ga0070675_100094271 3300005354 Bacteria 2511
23 Ga0070671_100001464 3300005355 Bacteria 17629
24 Ga0070671_100062598 3300005355 Bacteria 3098
25 Ga0070673_100005402 3300005364 Bacteria 8174
26 Ga0070673_100084642 3300005364 Bacteria 2579
27 Ga0070688_100098992 3300005365 Bacteria 1919
28 Ga0070688_100300675 3300005365 Bacteria 1160
29 Ga0070659_100192727 3300005366 Bacteria 1676
30 Ga0070667_100003703 3300005367 Bacteria 13006
31 Ga0070709_10142879 3300005434 Bacteria 1646
32 Ga0070714_100051464 3300005435 Bacteria 3511
33 Ga0070701_10004983 3300005438 Bacteria 5440
34 Ga0070705_100000670 3300005440 Bacteria 19576
35 Ga0070705_100007798 3300005440 Bacteria 5286
36 Ga0070700_100026966 3300005441 Bacteria 3401
37 Ga0070700_100323922 3300005441 Bacteria 1133
38 Ga0070694_100003717 3300005444 Bacteria 9097
39 Ga0070708_100707444 3300005445 Bacteria 948
40 Ga0070681_10010314 3300005458 Bacteria 9223
41 Ga0070685_10217005 3300005466 Bacteria 1251
42 Ga0070707_100167265 3300005468 Bacteria 2143
43 Ga0070698_100000421 3300005471 Bacteria 45224
44 Ga0070699_100011287 3300005518 Bacteria 7717
45 Ga0070679_100000040 3300005530 Bacteria 96771
46 Ga0070679_100134389 3300005530 Bacteria 2454
47 Ga0070684_100000983 3300005535 Bacteria 20350
48 Ga0070684_100240993 3300005535 Bacteria 1652
49 Ga0070684_100526081 3300005535 Bacteria 1096
50 Ga0070697_100008361 3300005536 Bacteria 8075
51 Ga0070697_100282551 3300005536 Bacteria 1424
52 Ga0070686_100076843 3300005544 Bacteria 2200
53 Ga0070695_100015678 3300005545 Bacteria 4578
54 Ga0070696_100000070 3300005546 Bacteria 49576
55 Ga0070696_100063999 3300005546 Bacteria 2577
56 Ga0070696_100127734 3300005546 Unclassified 1846
57 Ga0070696_100198148 3300005546 Bacteria 1498
58 Ga0070665_100003279 3300005548 Bacteria 17367
59 Ga0070665_100010856 3300005548 Bacteria 9212
60 Ga0070665_101026157 3300005548 Bacteria 837
61 Ga0070704_100003430 3300005549 Bacteria 9086
62 Ga0070704_100037902 3300005549 Unclassified 3298
63 Ga0068855_100008888 3300005563 Bacteria 12144
64 Ga0068856_100000837 3300005614 Bacteria 33198
65 Ga0068856_100116282 3300005614 Bacteria 2675
66 Ga0068856_100158613 3300005614 Bacteria 2273
67 Ga0068856_100237099 3300005614 Bacteria 1840
68 Ga0070702_100012951 3300005615 Bacteria 4200
69 Ga0068852_100000394 3300005616 Bacteria 29271
70 Ga0068852_100066004 3300005616 Bacteria 3159
71 Ga0068859_100000456 3300005617 Bacteria 40505
72 Ga0068859_100004984 3300005617 Bacteria 13487
73 Ga0068859_100676515 3300005617 Bacteria 1123
74 Ga0068859_100743934 3300005617 Unclassified 1070
75 Ga0068861_100018447 3300005719 Bacteria 4971
76 Ga0068861_100068436 3300005719 Bacteria 2744
77 Ga0068861_100145000 3300005719 Unclassified 1942
78 Ga0068861_100448936 3300005719 Bacteria 1155
79 Ga0068858_100000239 3300005842 Bacteria 59492
80 Ga0068858_100295450 3300005842 Bacteria 1545
81 Ga0068858_100674301 3300005842 Bacteria 1005
82 Ga0068860_100050030 3300005843 Bacteria 3980
83 Ga0081455_10000367 3300005937 Bacteria 59549
84 Ga0081539_10059642 3300005985 Unclassified 2099
85 Ga0075363_100000126 3300006048 Bacteria 18188
86 Ga0075364_10293253 3300006051 Bacteria 1107
87 Ga0070716_100346860 3300006173 Bacteria 1049
88 Ga0075366_10021699 3300006195 Bacteria 3734
89 Ga0097621_100228432 3300006237 Bacteria 1624
90 Ga0075370_10013904 3300006353 Bacteria 4284
91 Ga0068871_100294824 3300006358 Bacteria 1422
92 Ga0075428_100009483 3300006844 Bacteria 10805
93 Ga0075428_100090129 3300006844 Unclassified 3345
94 Ga0075428_100312830 3300006844 Bacteria 1688
95 Ga0075430_100019376 3300006846 Bacteria 5786
96 Ga0075430_100046615 3300006846 Bacteria 3661
97 Ga0075430_100100447 3300006846 Bacteria 2416
98 Ga0075431_100164401 3300006847 Bacteria 2281
99 Ga0075433_10093422 3300006852 Bacteria 2661
100 Ga0075433_10457416 3300006852 Bacteria 1125
101 Ga0075434_100063066 3300006871 Bacteria 3689
102 Ga0075434_100181997 3300006871 Bacteria 2122
103 Ga0075434_100223386 3300006871 Bacteria 1903
104 Ga0075434_100302056 3300006871 Bacteria 1621
105 Ga0068865_100257491 3300006881 Bacteria 1380
106 Ga0068865_100459524 3300006881 Bacteria 1054
107 Ga0075436_100000141 3300006914 Bacteria 43568
108 Ga0097620_100000456 3300006931 Bacteria 40505
109 Ga0097620_100004983 3300006931 Bacteria 13487
110 Ga0097620_100676428 3300006931 Bacteria 1123
111 Ga0097620_100743941 3300006931 Unclassified 1070
112 Ga0075435_100203397 3300007076 Bacteria 1678
113 Ga0105240_10002083 3300009093 Bacteria 32763
114 Ga0105240_10003249 3300009093 Bacteria 25440
115 Ga0105240_10020369 3300009093 Bacteria 8850
116 Ga0111539_10317622 3300009094 Bacteria 1813
117 Ga0111539_10353613 3300009094 Bacteria 1710
118 Ga0105245_10350089 3300009098 Bacteria 1463
119 Ga0105247_10000170 3300009101 Bacteria 64314
120 Ga0114129_10000349 3300009147 Bacteria 53637
121 Ga0114129_10020657 3300009147 Bacteria 9361
122 Ga0114129_10048494 3300009147 Bacteria 5968
123 Ga0114129_10250971 3300009147 Bacteria 2375
124 Ga0114129_10742733 3300009147 Bacteria 1257
125 Ga0105243_10036903 3300009148 Bacteria 3796
126 Ga0105243_10065313 3300009148 Bacteria 2922
127 Ga0105243_10190795 3300009148 Bacteria 1790
128 Ga0105241_10300359 3300009174 Bacteria 1378
129 Ga0105242_10060543 3300009176 Bacteria 3111
130 Ga0105242_10490503 3300009176 Bacteria 1166
131 Ga0105242_10688343 3300009176 Bacteria 999
132 Ga0105248_10023722 3300009177 Bacteria 6817
133 Ga0105248_10054054 3300009177 Bacteria 4504
134 Ga0105248_10054438 3300009177 Bacteria 4487
135 Ga0105237_10001152 3300009545 Bacteria 35466
136 Ga0105237_10032535 3300009545 Bacteria 5279
137 Ga0105237_10311444 3300009545 Bacteria 1577
138 Ga0105238_10012497 3300009551 Bacteria 8564
139 Ga0105238_10014085 3300009551 Bacteria 8085
140 Ga0105238_10049454 3300009551 Bacteria 4234
141 Ga0105249_10009188 3300009553 Bacteria 8643
142 Ga0105249_10020014 3300009553 Bacteria 5976
143 Ga0105239_10000248 3300010375 Bacteria 80738
144 Ga0157370_10008202 3300013104 Bacteria 11287
145 Ga0157370_10009072 3300013104 Bacteria 10666
146 Ga0157370_10093300 3300013104 Bacteria 2825
147 Ga0157369_10021215 3300013105 Bacteria 7263
148 Ga0157369_10060913 3300013105 Bacteria 4069
149 Ga0157369_10457681 3300013105 Bacteria 1321
150 Ga0157378_10014258 3300013297 Bacteria 6958
151 Ga0163162_10084991 3300013306 Bacteria 3240
152 Ga0157372_10515914 3300013307 Bacteria 1393
153 Ga0157375_11086534 3300013308 Unclassified 936
154 Ga0163163_10004752 3300014325 Bacteria 11650
155 Ga0163163_10045735 3300014325 Bacteria 4298
156 Ga0157377_10024631 3300014745 Bacteria 3201
157 Ga0157379_10008222 3300014968 Bacteria 9060
158 Ga0157379_10250340 3300014968 Bacteria 1608
159 Ga0213875_10027271 3300021388 Bacteria 2718
160 Ga0209026_1000539 3300025250 Bacteria 26079
161 Ga0209758_1000516 3300025297 Bacteria 62036
162 Ga0209758_1039434 3300025297 Bacteria 1797
163 Ga0209050_1000090 3300025298 Bacteria 253783
164 Ga0207426_1000160 3300025302 Bacteria 174540
165 Ga0209257_1002389 3300025304 Bacteria 18811
166 Ga0209257_1002767 3300025304 Bacteria 16583
167 Ga0207697_10161113 3300025315 Bacteria 979
168 Ga0207680_10008542 3300025903 Bacteria 5037
169 Ga0207645_10027333 3300025907 Bacteria 3685
170 Ga0207645_10202566 3300025907 Bacteria 1306
171 Ga0207707_10000232 3300025912 Bacteria 60065
172 Ga0207707_10093616 3300025912 Bacteria 2625
173 Ga0207695_10004555 3300025913 Bacteria 18846
174 Ga0207695_10014184 3300025913 Bacteria 9454
175 Ga0207695_10032550 3300025913 Bacteria 5704
176 Ga0207695_10035948 3300025913 Bacteria 5362
177 Ga0207671_10004764 3300025914 Bacteria 12810
178 Ga0207671_10076977 3300025914 Bacteria 2497
179 Ga0207660_10057876 3300025917 Bacteria 2777
180 Ga0207652_10013527 3300025921 Bacteria 6601
181 Ga0207652_10153700 3300025921 Bacteria 2061
182 Ga0207646_10119929 3300025922 Bacteria 2363
183 Ga0207681_10302073 3300025923 Bacteria 1267
184 Ga0207694_10016410 3300025924 Bacteria 5591
185 Ga0207694_10028815 3300025924 Bacteria 4235
186 Ga0207694_10253150 3300025924 Bacteria 1442
187 Ga0207650_10025483 3300025925 Bacteria 4213
188 Ga0207659_10004027 3300025926 Bacteria 8865
189 Ga0207644_10013696 3300025931 Bacteria 5413
190 Ga0207706_10205601 3300025933 Bacteria 1727
191 Ga0207686_10044936 3300025934 Bacteria 2715
192 Ga0207709_10140938 3300025935 Bacteria 1657
193 Ga0207709_10279181 3300025935 Bacteria 1233
194 Ga0207704_10077235 3300025938 Bacteria 2137
195 Ga0207665_10021719 3300025939 Bacteria 4222
196 Ga0207711_10025958 3300025941 Bacteria 4913
197 Ga0207711_10134329 3300025941 Bacteria 2221
198 Ga0207711_10374524 3300025941 Bacteria 1320
199 Ga0207689_10135345 3300025942 Bacteria 2029
200 Ga0207661_10181780 3300025944 Bacteria 1837
201 Ga0207679_10341688 3300025945 Bacteria 1302
202 Ga0207667_10008131 3300025949 Bacteria 12490
203 Ga0207651_10007787 3300025960 Bacteria 5729
204 Ga0207651_10047446 3300025960 Bacteria 2896
205 Ga0207651_10133480 3300025960 Bacteria 1905
206 Ga0207712_10138473 3300025961 Bacteria 1864
207 Ga0207658_10002599 3300025986 Bacteria 13108
208 Ga0207658_10003048 3300025986 Bacteria 11980
209 Ga0207677_10458883 3300026023 Bacteria 1093
210 Ga0207703_10004395 3300026035 Bacteria 11587
211 Ga0207703_10046868 3300026035 Bacteria 3484
212 Ga0207703_10537470 3300026035 Bacteria 1101
213 Ga0207708_10030333 3300026075 Bacteria 4099
214 Ga0207702_10005199 3300026078 Bacteria 11436
215 Ga0207702_10260312 3300026078 Bacteria 1633
216 Ga0207648_10259942 3300026089 Bacteria 1549
217 Ga0207648_10375796 3300026089 Bacteria 1284
218 Ga0207674_10101737 3300026116 Bacteria 2854
219 Ga0207674_10106033 3300026116 Bacteria 2788
220 Ga0207675_100035619 3300026118 Bacteria 4642
221 Ga0207675_100092035 3300026118 Bacteria 2852
222 Ga0207675_100114995 3300026118 Bacteria 2542
223 Ga0207675_100279858 3300026118 Bacteria 1621
224 Ga0207698_10063184 3300026142 Bacteria 2896
225 Ga0268266_10024703 3300028379 Bacteria 5113
226 Ga0268265_10026648 3300028380 Bacteria 4115
227 Ga0268264_10038159 3300028381 Bacteria 3962
228 Ga0268264_10760048 3300028381 Bacteria 966
229 Ga0265319_1003866 3300028563 Bacteria 7649
230 Ga0307517_10008378 3300028786 Bacteria 14839
231 Ga0307515_10002251 3300028794 Bacteria 42303
232 Ga0307511_10000015 3300030521 Bacteria 126567
233 Ga0265330_10000028 3300031235 Archaea 138261
234 Ga0265332_10000004 3300031238 Bacteria 426592
235 Ga0265339_10054370 3300031249 Bacteria 2175
236 Ga0265316_10006307 3300031344 Bacteria 11355
237 Ga0307513_10011268 3300031456 Bacteria 11128
238 Ga0307513_10024220 3300031456 Bacteria 7067
239 Ga0307513_10026467 3300031456 Bacteria 6685
240 Ga0307509_10067217 3300031507 Bacteria 3756
241 Ga0307509_10069562 3300031507 Bacteria 3679
242 Ga0307408_100030019 3300031548 Bacteria 3772
243 Ga0307408_100117499 3300031548 Bacteria 2054
244 Ga0307508_10010392 3300031616 Bacteria 8517
245 Ga0307514_10018767 3300031649 Bacteria 5666
246 Ga0316579_10002618 3300031691 Bacteria 6832
247 Ga0316579_10151902 3300031691 Bacteria 1117
248 Ga0265342_10000015 3300031712 Archaea 194661
249 Ga0316576_10001213 3300031727 Bacteria 13619
250 Ga0316578_10000026 3300031728 Bacteria 29947
251 Ga0307405_10011570 3300031731 Bacteria 4633
252 Ga0316577_10003660 3300031733 Bacteria 7809
253 Ga0307413_10155492 3300031824 Bacteria 1599
254 Ga0307410_10051725 3300031852 Bacteria 2770
255 Ga0307406_10025314 3300031901 Bacteria 3552
256 Ga0307412_10059446 3300031911 Bacteria 2562
257 Ga0307409_100042497 3300031995 Bacteria 3405
258 Ga0307416_100018000 3300032002 Bacteria 4963
259 Ga0307411_10005140 3300032005 Bacteria 6390
260 Ga0307411_10356802 3300032005 Bacteria 1194
261 Ga0316583_10071921 3300032133 Bacteria 1210
262 Ga0316585_10001389 3300032137 Bacteria 6376
263 Ga0316580_10003192 3300032139 Bacteria 4635
264 Ga0307510_10384595 3300033180 Bacteria 848
265 Ga0316587_1005772 3300033529 Bacteria 1868
266 Ga0316582_0000852 3300036647 Bacteria 12415
267 Ga0316584_0000875 3300036712 Bacteria 17104
268 Ga0395899_0000091 3300037312 Bacteria 154780
269 Ga0395900_0000008 3300037418 Bacteria 480459
270 Ga0395900_0184048 3300037418 Bacteria 2121
271 Ga0395905_0000114 3300037471 Bacteria 134334
272 Ga0395905_0048162 3300037471 Bacteria 3995
273 Ga0395905_0164315 3300037471 Bacteria 2086
274 Ga0436364_0004663 3300037853 Bacteria 901
275 Ga0436364_0390115 3300037853 Bacteria 2362
276 Ga0436364_1220745 3300037853 Bacteria 1089
277 Ga0436364_1297695 3300037853 Bacteria 9465
278 Ga0436364_1436078 3300037853 Bacteria 2346
279 Ga0395901_0000008 3300038443 Bacteria 495962
280 Ga0400483_183393 3300039062 Bacteria 3561
281 Ga0436365_0370809 3300039437 Bacteria 961
282 Ga0436365_0588054 3300039437 Bacteria 1688
283 Ga0436365_1380562 3300039437 Bacteria 2095
284 Ga0436361_1081907 3300039447 Bacteria 1156
285 Ga0436361_1201302 3300039447 Bacteria 11640
286 Ga0436363_0427729 3300039450 Bacteria 2507
287 Ga0436362_0625556 3300039453 Bacteria 2125
288 Ga0439464_0145065 3300042439 Bacteria 741
289 Ga0466969_0100256 3300044656 Bacteria 1364
290 Ga0453683_0000006 3300044673 Bacteria 586638
291 Ga0466966_0044971 3300044684 Bacteria 2824
292 Ga0453684_0004928 3300044712 Bacteria 27219
293 Ga0453684_0032082 3300044712 Bacteria 7362
294 Ga0453684_0939167 3300044712 Bacteria 924
295 Ga0466971_0042547 3300044719 Bacteria 2041
296 Ga0451576_0000642 3300045051 Bacteria 72433
297 Ga0451576_0036990 3300045051 Bacteria 5172
298 Ga0451576_0234718 3300045051 Bacteria 1915
299 Ga0451576_0317977 3300045051 Bacteria 1629
300 Ga0466967_0773498 3300045976 Bacteria 953
301 Ga0495590_0005512 3300046457 Bacteria 5013
302 Ga0495638_0094677 3300046460 Bacteria 1795
303 Ga0495605_0153675 3300046474 Bacteria 1025
304 Ga0495584_0033008 3300046491 Bacteria 2618
305 Ga0495608_0032408 3300046511 Bacteria 3532
306 Ga0495616_0001065 3300046513 Bacteria 19541
307 Ga0495632_0024860 3300046519 Bacteria 3175
308 Ga0495632_0038789 3300046519 Bacteria 2410
309 Ga0495663_0015634 3300046525 Bacteria 2139
310 Ga0495642_0046001 3300046528 Bacteria 1784
311 Ga0495609_0000449 3300046538 Bacteria 33799
312 Ga0495609_0063534 3300046538 Bacteria 1629
313 Ga0495621_0012045 3300046539 Bacteria 2690
314 Ga0495622_0055622 3300046557 Bacteria 1835
315 Ga0495667_0008861 3300046559 Bacteria 6841
316 Ga0495668_0047455 3300046616 Bacteria 2385
317 Ga0495659_0055348 3300046664 Bacteria 1453
318 Ga0495657_0003771 3300046675 Bacteria 12272
319 Ga0495649_0018333 3300046694 Bacteria 3939
320 Ga0495649_0210348 3300046694 Bacteria 1008
321 Ga0495636_0016966 3300047318 Bacteria 2911
322 Ga0495672_0016407 3300047320 Bacteria 4992
323 Ga0495677_0100032 3300047445 Bacteria 1097
324 Ga0495673_0014648 3300047469 Bacteria 4071
325 Ga0495673_0055247 3300047469 Bacteria 1723
326 Ga0495686_0185040 3300047472 Bacteria 1204
327 Ga0496104_0210797 3300048907 Bacteria 1854
328 Ga0496106_0119933 3300048909 Bacteria 2055
329 Ga0496108_0151799 3300048911 Bacteria 1999
330 Ga0496113_0215498 3300048916 Bacteria 1529
331 Ga0496113_0499033 3300048916 Bacteria 977
332 Ga0496115_0231134 3300048918 Bacteria 1525
333 Ga0496115_0240424 3300048918 Bacteria 1492
334 Ga0496116_0000026 3300048919 Bacteria 450803
335 Ga0496116_0018937 3300048919 Bacteria 5287
336 Ga0496121_0000533 3300048924 Bacteria 72413
337 Ga0496124_0238812 3300048927 Bacteria 1353
338 Ga0496125_0002793 3300048928 Bacteria 22077
339 Ga0496126_0048147 3300048929 Bacteria 3898
340 Ga0496126_0081428 3300048929 Bacteria 2862
341 Ga0495682_0071809 3300049460 Bacteria 1246
342 Ga0501299_025361 3300049522 Bacteria 1113
343 Ga0501032_0175618 3300049569 Unclassified 1403
344 Ga0501047_0007638 3300049581 Bacteria 10182
345 Ga0501075_0438843 3300049591 Bacteria 996
346 Ga0501077_0148610 3300049593 Bacteria 1487
347 nmdc:mga00v17_331881_c1 3300050491 Bacteria 988
348 nmdc:mga0k408_11701_c1 3300050493 Bacteria 4783
349 nmdc:mga05p37_10461_c1 3300050507 Bacteria 11010
350 nmdc:mga05p37_426085_c1 3300050507 Bacteria 1543
351 nmdc:mga05p37_44678_c1 3300050507 Bacteria 5451
352 nmdc:mga05p37_859183_c1 3300050507 Unclassified 984
353 nmdc:mga09592_310442_c1 3300050508 Bacteria 1367
354 nmdc:mga0qj67_252105_c1 3300050509 Bacteria 1432
355 nmdc:mga0qj67_3448_c2 3300050509 Bacteria 5796
356 nmdc:mga0qj67_61106_c1 3300050509 Bacteria 2991
357 nmdc:mga06r32_138378_c1 3300050510 Bacteria 2409
358 nmdc:mga08y16_19479_c1 3300050511 Bacteria 7153
359 nmdc:mga08y16_260318_c1 3300050511 Bacteria 1791
360 nmdc:mga0n895_41868_c1 3300050512 Bacteria 4454
361 nmdc:mga0n895_446900_c1 3300050512 Bacteria 1305
362 nmdc:mga0rr50_187634_c1 3300050513 Bacteria 1693
363 nmdc:mga08x19_497_c1 3300050514 Bacteria 26186
364 nmdc:mga0a205_453530_c1 3300050515 Bacteria 1142
365 nmdc:mga0sz30_28162_c1 3300050516 Bacteria 2310
366 nmdc:mga0sz30_87083_c1 3300050516 Bacteria 1356
367 Ga0500562_011655 3300053108 Bacteria 2232
368 Ga0500568_0026936 3300053139 Bacteria 2408
369 Ga0500590_077719 3300053148 Bacteria 1637
370 Ga0500638_150856 3300053162 Bacteria 1034
371 Ga0500636_0300514 3300053177 Bacteria 791
372 Ga0500645_000940 3300053730 Bacteria 16583
373 2513648674 2513237095 Bacteria 8976980
374 2513698578 2513237101 Bacteria 7952346
375 2513891770 2513237141 Bacteria 8496279
376 2585994347 2585427633 Bacteria 6413184
377 2585998805 2585427634 Bacteria 6455027
378 2586003708 2585427634 Bacteria 6455027
379 2644301315 2643221654 Bacteria 5273570
380 2818241910 2816332527 Bacteria 8933356
381 2824747895 2824746037 Bacteria 7911610
382 2841959151 2841957949 Bacteria 8652217
383 2841968709 2841966195 Bacteria 8673214
384 2857579566 2857576091 Bacteria 5465855
385 2881667567 2881665667 Bacteria 8175609
386 2889299379 2889295896 Bacteria 4704906
387 2908778339 2908775508 Bacteria 8092255
388 2935646887 2935638405 Bacteria 10015038
389 2935836154 2935827899 Bacteria 10038562
390 2941535237 2941531003 Bacteria 7653939
391 2980182358 2980182181 Bacteria 9454109
392 2981288850 2981284811 Bacteria 4641497
393 2981293697 2981289755 Bacteria 4641509
394 2981984458 2981980479 Bacteria 4641628
395 2981989414 2981985349 Bacteria 4641497
396 Ga0207664_10077985
397 JGI25153J46596_10022285
398 JGI25160J50197_1004971
399 Ga0007409J51694_1040004
400 Ga0065712_10010685
401 Ga0065707_10204170
402 Ga0065707_10270834
403 Ga0065707_10315408
404 Ga0070676_10032451
405 Ga0070676_10208637
406 Ga0070683_100001472
407 Ga0070670_100144029
408 Ga0068869_100059385
409 Ga0068869_100092025
410 Ga0070666_10039032
411 Ga0070680_100026662
412 Ga0070680_100072796
413 Ga0070680_100259213
414 Ga0070680_100562358
415 Ga0068868_100181540
416 Ga0070669_100476452
417 Ga0070675_100094271
418 Ga0070671_100001464
419 Ga0070671_100062598
420 Ga0070673_100005402
421 Ga0070673_100084642
422 Ga0070688_100098992
423 Ga0070688_100300675
424 Ga0070659_100192727
425 Ga0070667_100003703
426 Ga0070709_10142879
427 Ga0070714_100051464
428 Ga0070701_10004983
429 Ga0070705_100000670
430 Ga0070705_100007798
431 Ga0070700_100026966
432 Ga0070700_100323922
433 Ga0070694_100003717
434 Ga0070708_100707444
435 Ga0070681_10010314
436 Ga0070685_10217005
437 Ga0070707_100167265
438 Ga0070698_100000421
439 Ga0070699_100011287
440 Ga0070679_100000040
441 Ga0070679_100134389
442 Ga0070684_100000983
443 Ga0070684_100240993
444 Ga0070684_100526081
445 Ga0070697_100008361
446 Ga0070697_100282551
447 Ga0070686_100076843
448 Ga0070695_100015678
449 Ga0070696_100000070
450 Ga0070696_100063999
451 Ga0070696_100127734
452 Ga0070696_100198148
453 Ga0070665_100003279
454 Ga0070665_100010856
455 Ga0070665_101026157
456 Ga0070704_100003430
457 Ga0070704_100037902
458 Ga0068855_100008888
459 Ga0068856_100000837
460 Ga0068856_100116282
461 Ga0068856_100158613
462 Ga0068856_100237099
463 Ga0070702_100012951
464 Ga0068852_100000394
465 Ga0068852_100066004
466 Ga0068859_100000456
467 Ga0068859_100004984
468 Ga0068859_100676515
469 Ga0068859_100743934
470 Ga0068861_100018447
471 Ga0068861_100068436
472 Ga0068861_100145000
473 Ga0068861_100448936
474 Ga0068858_100000239
475 Ga0068858_100295450
476 Ga0068858_100674301
477 Ga0068860_100050030
478 Ga0081455_10000367
479 Ga0081539_10059642
480 Ga0075363_100000126
481 Ga0075364_10293253
482 Ga0070716_100346860
483 Ga0075366_10021699
484 Ga0097621_100228432
485 Ga0075370_10013904
486 Ga0068871_100294824
487 Ga0075428_100009483
488 Ga0075428_100090129
489 Ga0075428_100312830
490 Ga0075430_100019376
491 Ga0075430_100046615
492 Ga0075430_100100447
493 Ga0075431_100164401
494 Ga0075433_10093422
495 Ga0075433_10457416
496 Ga0075434_100063066
497 Ga0075434_100181997
498 Ga0075434_100223386
499 Ga0075434_100302056
500 Ga0068865_100257491
501 Ga0068865_100459524
502 Ga0075436_100000141
503 Ga0097620_100000456
504 Ga0097620_100004983
505 Ga0097620_100676428
506 Ga0097620_100743941
507 Ga0075435_100203397
508 Ga0105240_10002083
509 Ga0105240_10003249
510 Ga0105240_10020369
511 Ga0111539_10317622
512 Ga0111539_10353613
513 Ga0105245_10350089
514 Ga0105247_10000170
515 Ga0114129_10000349
516 Ga0114129_10020657
517 Ga0114129_10048494
518 Ga0114129_10250971
519 Ga0114129_10742733
520 Ga0105243_10036903
521 Ga0105243_10065313
522 Ga0105243_10190795
523 Ga0105241_10300359
524 Ga0105242_10060543
525 Ga0105242_10490503
526 Ga0105242_10688343
527 Ga0105248_10023722
528 Ga0105248_10054054
529 Ga0105248_10054438
530 Ga0105237_10001152
531 Ga0105237_10032535
532 Ga0105237_10311444
533 Ga0105238_10012497
534 Ga0105238_10014085
535 Ga0105238_10049454
536 Ga0105249_10009188
537 Ga0105249_10020014
538 Ga0105239_10000248
539 Ga0157370_10008202
540 Ga0157370_10009072
541 Ga0157370_10093300
542 Ga0157369_10021215
543 Ga0157369_10060913
544 Ga0157369_10457681
545 Ga0157378_10014258
546 Ga0163162_10084991
547 Ga0157372_10515914
548 Ga0157375_11086534
549 Ga0163163_10004752
550 Ga0163163_10045735
551 Ga0157377_10024631
552 Ga0157379_10008222
553 Ga0157379_10250340
554 Ga0213875_10027271
555 Ga0209026_1000539
556 Ga0209758_1000516
557 Ga0209758_1039434
558 Ga0209050_1000090
559 Ga0207426_1000160
560 Ga0209257_1002389
561 Ga0209257_1002767
562 Ga0207697_10161113
563 Ga0207680_10008542
564 Ga0207645_10027333
565 Ga0207645_10202566
566 Ga0207707_10000232
567 Ga0207707_10093616
568 Ga0207695_10004555
569 Ga0207695_10014184
570 Ga0207695_10032550
571 Ga0207695_10035948
572 Ga0207671_10004764
573 Ga0207671_10076977
574 Ga0207660_10057876
575 Ga0207652_10013527
576 Ga0207652_10153700
577 Ga0207646_10119929
578 Ga0207681_10302073
579 Ga0207694_10016410
580 Ga0207694_10028815
581 Ga0207694_10253150
582 Ga0207650_10025483
583 Ga0207659_10004027
584 Ga0207644_10013696
585 Ga0207706_10205601
586 Ga0207686_10044936
587 Ga0207709_10140938
588 Ga0207709_10279181
589 Ga0207704_10077235
590 Ga0207665_10021719
591 Ga0207711_10025958
592 Ga0207711_10134329
593 Ga0207711_10374524
594 Ga0207689_10135345
595 Ga0207661_10181780
596 Ga0207679_10341688
597 Ga0207667_10008131
598 Ga0207651_10007787
599 Ga0207651_10047446
600 Ga0207651_10133480
601 Ga0207712_10138473
602 Ga0207658_10002599
603 Ga0207658_10003048
604 Ga0207677_10458883
605 Ga0207703_10004395
606 Ga0207703_10046868
607 Ga0207703_10537470
608 Ga0207708_10030333
609 Ga0207702_10005199
610 Ga0207702_10260312
611 Ga0207648_10259942
612 Ga0207648_10375796
613 Ga0207674_10101737
614 Ga0207674_10106033
615 Ga0207675_100035619
616 Ga0207675_100092035
617 Ga0207675_100114995
618 Ga0207675_100279858
619 Ga0207698_10063184
620 Ga0268266_10024703
621 Ga0268265_10026648
622 Ga0268264_10038159
623 Ga0268264_10760048
624 Ga0265319_1003866
625 Ga0307517_10008378
626 Ga0307515_10002251
627 Ga0307511_10000015
628 Ga0265330_10000028
629 Ga0265332_10000004
630 Ga0265339_10054370
631 Ga0265316_10006307
632 Ga0307513_10011268
633 Ga0307513_10024220
634 Ga0307513_10026467
635 Ga0307509_10067217
636 Ga0307509_10069562
637 Ga0307408_100030019
638 Ga0307408_100117499
639 Ga0307508_10010392
640 Ga0307514_10018767
641 Ga0316579_10002618
642 Ga0316579_10151902
643 Ga0265342_10000015
644 Ga0316576_10001213
645 Ga0316578_10000026
646 Ga0307405_10011570
647 Ga0316577_10003660
648 Ga0307413_10155492
649 Ga0307410_10051725
650 Ga0307406_10025314
651 Ga0307412_10059446
652 Ga0307409_100042497
653 Ga0307416_100018000
654 Ga0307411_10005140
655 Ga0307411_10356802
656 Ga0316583_10071921
657 Ga0316585_10001389
658 Ga0316580_10003192
659 Ga0307510_10384595
660 Ga0316587_1005772
661 Ga0316582_0000852
662 Ga0316584_0000875
663 Ga0395899_0000091
664 Ga0395900_0000008
665 Ga0395900_0184048
666 Ga0395905_0000114
667 Ga0395905_0048162
668 Ga0395905_0164315
669 Ga0436364_0004663
670 Ga0436364_0390115
671 Ga0436364_1220745
672 Ga0436364_1297695
673 Ga0436364_1436078
674 Ga0395901_0000008
675 Ga0400483_183393
676 Ga0436365_0370809
677 Ga0436365_0588054
678 Ga0436365_1380562
679 Ga0436361_1081907
680 Ga0436361_1201302
681 Ga0436363_0427729
682 Ga0436362_0625556
683 Ga0439464_0145065
684 Ga0466969_0100256
685 Ga0453683_0000006
686 Ga0466966_0044971
687 Ga0453684_0004928
688 Ga0453684_0032082
689 Ga0453684_0939167
690 Ga0466971_0042547
691 Ga0451576_0000642
692 Ga0451576_0036990
693 Ga0451576_0234718
694 Ga0451576_0317977
695 Ga0466967_0773498
696 Ga0495590_0005512
697 Ga0495638_0094677
698 Ga0495605_0153675
699 Ga0495584_0033008
700 Ga0495608_0032408
701 Ga0495616_0001065
702 Ga0495632_0024860
703 Ga0495632_0038789
704 Ga0495663_0015634
705 Ga0495642_0046001
706 Ga0495609_0000449
707 Ga0495609_0063534
708 Ga0495621_0012045
709 Ga0495622_0055622
710 Ga0495667_0008861
711 Ga0495668_0047455
712 Ga0495659_0055348
713 Ga0495657_0003771
714 Ga0495649_0018333
715 Ga0495649_0210348
716 Ga0495636_0016966
717 Ga0495672_0016407
718 Ga0495677_0100032
719 Ga0495673_0014648
720 Ga0495673_0055247
721 Ga0495686_0185040
722 Ga0496104_0210797
723 Ga0496106_0119933
724 Ga0496108_0151799
725 Ga0496113_0215498
726 Ga0496113_0499033
727 Ga0496115_0231134
728 Ga0496115_0240424
729 Ga0496116_0000026
730 Ga0496116_0018937
731 Ga0496121_0000533
732 Ga0496124_0238812
733 Ga0496125_0002793
734 Ga0496126_0048147
735 Ga0496126_0081428
736 Ga0495682_0071809
737 Ga0501299_025361
738 Ga0501032_0175618
739 Ga0501047_0007638
740 Ga0501075_0438843
741 Ga0501077_0148610
742 nmdc:mga00v17_331881_c1
743 nmdc:mga0k408_11701_c1
744 nmdc:mga05p37_10461_c1
745 nmdc:mga05p37_426085_c1
746 nmdc:mga05p37_44678_c1
747 nmdc:mga05p37_859183_c1
748 nmdc:mga09592_310442_c1
749 nmdc:mga0qj67_252105_c1
750 nmdc:mga0qj67_3448_c2
751 nmdc:mga0qj67_61106_c1
752 nmdc:mga06r32_138378_c1
753 nmdc:mga08y16_19479_c1
754 nmdc:mga08y16_260318_c1
755 nmdc:mga0n895_41868_c1
756 nmdc:mga0n895_446900_c1
757 nmdc:mga0rr50_187634_c1
758 nmdc:mga08x19_497_c1
759 nmdc:mga0a205_453530_c1
760 nmdc:mga0sz30_28162_c1
761 nmdc:mga0sz30_87083_c1
762 Ga0500562_011655
763 Ga0500568_0026936
764 Ga0500590_077719
765 Ga0500638_150856
766 Ga0500636_0300514
767 Ga0500645_000940
768 2513648674
769 2513698578
770 2513891770
771 2585994347
772 2585998805
773 2586003708
774 2644301315
775 2818241910
776 2824747895
777 2841959151
778 2841968709
779 2857579566
780 2881667567
781 2889299379
782 2908778339
783 2935646887
784 2935836154
785 2941535237
786 2980182358
787 2981288850
788 2981293697
789 2981984458
790 2981989414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

32

263

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9272 2 254
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.914 2 254
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9024 2 254
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8931 2 254
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8435 1 249
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9272 2 254 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9024 2 254 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8454 94 233 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8379 1 247 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8305 1 247 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A257GWQ9-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9842 1 136 GO:0009058
GO:0047343
AF-A0A258KUJ6-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9812 1 147 GO:0009058
GO:0047343
AF-A0A7V0UHJ4-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9784 1 254 GO:0009243
GO:0047343
AF-A0A382RYG7-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9766 1 135 GO:0009058
GO:0047343
AF-A0A4Q3T577-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9737 1 255 GO:0009243
GO:0047343

Map